Protein Family IF00863

Metagenome Isolate
120 Members
64 Samples
104 Scaffolds
342.23 Avg Length

🧬 Representative Sequence

ID
3300002501|JGI24703J35330_11624370|JGI24703J35330_116243701
Length
346 aa
Sequence
MRKSEDAQALIIPNATAEFLTFAFQTGGDGIEIRVQDGTVWLSQKLMAQLFDTTPENIISHIKSITKEAELDPEATTKDFLVVQIEGTRSVNRKIKHYNLDMIIAVGYRVNSGKATAFRRWAITVLRDFALRGYVIDKERMKNGTFFNDDYFEHLLAEIREIRLSERRFHQKITDIYSTAMDYNKDAPTTRDFFAKVQNKLHWAIHGHTAAELIYKRADSEKQHMGLSTWQNAPSGKILKKDVAVAKNYLTQDEIKDLELVVSGYLDLAEALAKRKVPMTMDEWSEHLDMILRASKYEILDNLGSITKEIAKMHAEAEFAKYRVVQDKLFESDFDKFIETTGEIL*

📊 Sample Types

Isolate 13.3%
Metagenome 86.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 37.1%
Blattidae 22.6%
Kalotermitidae 21.0%
Unclassified 6.5%
Termopsidae 6.5%
Passalidae 3.2%
Rhinotermitidae 1.6%
Hodotermitidae 1.6%

🌳 Taxonomy

Archaea 1
Bacteria 106
Eukaryota 0
Viruses 0
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
2 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
3 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
4 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
5 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
6 2740892546 Fibrobacteria bacterium GUT307 IN01_307 Isolate Unclassified
7 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
8 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
9 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
10 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
11 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
12 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
13 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
14 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
15 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
16 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
17 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
18 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
19 3004672520 Bacteroides sp. 51 Isolate Blattidae
20 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
21 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
22 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
23 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
24 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
25 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
26 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
27 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
28 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
29 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
30 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
31 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
32 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
33 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
34 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
35 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
36 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
37 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
38 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
39 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
40 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
41 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
42 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
43 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
44 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
45 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
46 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
47 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
48 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
49 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
50 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
51 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
52 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
53 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
54 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
55 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
56 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
57 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
58 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
59 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
60 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
61 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
62 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
63 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
64 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_068883 3300042656 Bacteria 2735
2 Ga0466705_415237 3300042612 Bacteria 5041
3 Ga0466696_177856 3300042596 Bacteria 1504
4 Ga0466696_391746 3300042596 Bacteria 10993
5 Ga0466699_357835 3300042597 Bacteria 3784
6 Ga0466700_332611 3300042600 Bacteria 1611
7 Ga0466722_147025 3300042609 Bacteria 4772
8 IMNBL1DRAFT_c0008518 3300000062 Bacteria 5208
9 IMNBL1DRAFT_c0017232 3300000062 Unclassified 3051
10 Ga0123353_10741224 3300010167 Bacteria 1369
11 Ga0123354_10044285 3300010882 Bacteria 6827
12 Ga0466705_144279 3300042612 Bacteria 5695
13 Ga0466731_274714 3300042622 Bacteria 5633
14 Ga0466704_363579 3300042643 Bacteria 24250
15 Ga0466709_075648 3300042648 Bacteria 4824
16 Ga0466732_226497 3300042656 Bacteria 4339
17 Ga0466715_172861 3300042616 Unclassified 2916
18 IMNBL1DRAFT_c0002597 3300000062 Bacteria 12416
19 IMNBL1DRAFT_c0012004 3300000062 Bacteria 3993
20 IMNBL1DRAFT_c0012646 3300000062 Bacteria 3844
21 JGI24698J34947_10004441 3300002449 Bacteria 7637
22 JGI24698J34947_10016164 3300002449 Bacteria 4053
23 JGI24698J34947_10092660 3300002449 Unclassified 1381
24 Ga0068305_10162891 3300005083 Bacteria 5560
25 Ga0123353_10004826 3300010167 Bacteria 17512
26 Ga0466731_416896 3300042622 Bacteria 1958
27 Ga0466735_110396 3300042624 Bacteria 1721
28 Ga0466703_289327 3300042636 Bacteria 1191
29 Ga0466715_212643 3300042616 Bacteria 2056
30 Ga0466718_138905 3300042617 Bacteria 1544
31 Ga0466657_033384 3300042582 Bacteria 3004
32 Ga0466701_005263 3300042598 Bacteria 1503
33 Ga0466706_092568 3300042599 Bacteria 5815
34 Ga0466707_420126 3300042601 Bacteria 1496
35 2227447468 2225789004 Unclassified 5444
36 IMNBL1DRAFT_c0018807 3300000062 Bacteria 2856
37 FAAS_10007610 3300001880 Bacteria 1101
38 JGI24698J34947_10027286 3300002449 Bacteria 3031
39 JGI24695J34938_10095979 3300002450 Bacteria 1214
40 Ga0466704_214858 3300042643 Bacteria 4153
41 Ga0466733_156408 3300042659 Bacteria 45949
42 Ga0466726_309011 3300042619 Bacteria 1399
43 Ga0415639_119326 3300038395 Unclassified 1821
44 Ga0466696_102909 3300042596 Bacteria 5338
45 Ga0466699_131041 3300042597 Archaea 2347
46 Ga0466716_016699 3300042605 Bacteria 2538
47 Ga0466720_007877 3300042607 Bacteria 20619
48 Ga0466720_030889 3300042607 Bacteria 5804
49 Ga0466720_097898 3300042607 Bacteria 5518
50 Ga0466720_112167 3300042607 Bacteria 13198
51 Ga0466698_358110 3300042610 Bacteria 1373
52 IMNBL1DRAFT_c0038564 3300000062 Unclassified 1642
53 JGI24698J34947_10020663 3300002449 Bacteria 3544
54 JGI24703J35330_11624370 3300002501 Unclassified 1467
55 Ga0123355_10136167 3300009826 Bacteria 3772
56 Ga0123353_10629268 3300010167 Bacteria 1525
57 Ga0466705_047522 3300042612 Bacteria 12961
58 Ga0466704_219592 3300042643 Bacteria 2021
59 Ga0466708_101376 3300042652 Bacteria 1432
60 Ga0466711_005989 3300042615 Bacteria 2167
61 Ga0466728_114650 3300042620 Bacteria 8762
62 Ga0466695_262320 3300042595 Bacteria 38774
63 Ga0466719_022987 3300042606 Bacteria 1279
64 Ga0466720_080892 3300042607 Bacteria 26978
65 2227466304 2225789004 Unclassified 24553
66 IMNBL1DRAFT_c0019152 3300000062 Bacteria 2815
67 AustNasuHG_c1023980 3300000089 Bacteria 1940
68 Ga0072941_1016130 3300005201 Unclassified 14960
69 Ga0466728_342924 3300042620 Bacteria 1444
70 Ga0466691_030038 3300042593 Bacteria 51774
71 Ga0466707_396095 3300042601 Bacteria 1578
72 2227474624 2225789004 Bacteria 22862
73 AustNasuHG_c1005440 3300000089 Bacteria 4551
74 Ga0068302_10043293 3300005071 Bacteria 2057
75 Ga0072941_1008778 3300005201 Bacteria 22332
76 Ga0123357_10159219 3300009784 Bacteria 2712
77 Ga0123353_10653119 3300010167 Unclassified 1488
78 Ga0123354_10074080 3300010882 Bacteria 4882
79 Ga0466709_080197 3300042648 Bacteria 10370
80 Ga0466733_070281 3300042659 Bacteria 14721
81 Ga0466705_460186 3300042612 Bacteria 1639
82 Ga0466712_129135 3300042614 Bacteria 16333
83 Ga0466718_014690 3300042617 Bacteria 8638
84 Ga0466728_049858 3300042620 Bacteria 1515
85 Ga0466696_124173 3300042596 Unclassified 1124
86 Ga0466707_109763 3300042601 Bacteria 1478
87 JGI24698J34947_10022927 3300002449 Bacteria 3341
88 JGI24702J35022_10080748 3300002462 Bacteria 1761
89 Ga0466703_253475 3300042636 Bacteria 2758
90 Ga0466727_204804 3300042655 Bacteria 1654
91 Ga0466733_032077 3300042659 Unclassified 6299
92 Ga0466712_069687 3300042614 Bacteria 15367
93 Ga0466690_045452 3300042590 Bacteria 6413
94 Ga0466690_085600 3300042590 Bacteria 3415
95 Ga0466695_070566 3300042595 Bacteria 1828
96 Ga0466696_474308 3300042596 Bacteria 2215
97 2227492706 2225789004 Bacteria 4036
98 JGI24698J34947_10030619 3300002449 Unclassified 2837
99 JGI24698J34947_10089756 3300002449 Bacteria 1414
100 Ga0123356_10375569 3300010049 Bacteria 1553
101 Ga0123353_10000797 3300010167 Bacteria 38391
102 Ga0466703_014351 3300042636 Bacteria 16224
103 Ga0466704_321521 3300042643 Bacteria 4723
104 Ga0466708_061962 3300042652 Bacteria 3387

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042656 Ga0466732_226497 Ga0466732_226497_240_1154 304
2 3300042596 Ga0466696_124173 Ga0466696_124173_158_1099 313
3 3300042620 Ga0466728_114650 Ga0466728_114650_3767_4804 314
4 3300042601 Ga0466707_396095 Ga0466707_396095_235_1266 322
5 3300042636 Ga0466703_289327 Ga0466703_289327_67_1035 322
6 3300042593 Ga0466691_030038 Ga0466691_030038_713_1750 325
7 3300001880 FAAS_10007610 FAAS_100076101 327
8 3300042659 Ga0466733_156408 Ga0466733_156408_21542_22537 331
9 3300042643 Ga0466704_214858 Ga0466704_214858_2255_3256 333
10 iso_pr_bacteria 2940195863 2940197811 336
11 3300042598 Ga0466701_005263 Ga0466701_005263_324_1337 337
12 3300042619 Ga0466726_309011 Ga0466726_309011_124_1137 337
13 3300042652 Ga0466708_101376 Ga0466708_101376_373_1386 337
14 3300042659 Ga0466733_032077 Ga0466733_032077_2903_3916 337
15 3300042659 Ga0466733_070281 Ga0466733_070281_7051_8064 337
16 2225789004 2227474624 2227924972 338
17 3300000062 IMNBL1DRAFT_c0012646 IMNBL1DRAFT_00126462 338
18 3300000062 IMNBL1DRAFT_c0012004 IMNBL1DRAFT_00120042 339
19 3300000062 IMNBL1DRAFT_c0019152 IMNBL1DRAFT_00191524 339
20 3300042601 Ga0466707_420126 Ga0466707_420126_132_1151 339
21 3300042620 Ga0466728_049858 Ga0466728_049858_108_1127 339
22 3300042622 Ga0466731_274714 Ga0466731_274714_2859_3878 339
23 3300042643 Ga0466704_219592 Ga0466704_219592_346_1365 339
24 3300042648 Ga0466709_075648 Ga0466709_075648_3141_4160 339
25 3300042652 Ga0466708_061962 Ga0466708_061962_15_1034 339
26 3300042656 Ga0466732_068883 Ga0466732_068883_1371_2390 339
27 3300042609 Ga0466722_147025 Ga0466722_147025_1307_2329 340
28 iso_pr_bacteria 2740892546 2743910396 340
29 2225789004 2227447468 2227884965 341
30 3300002449 JGI24698J34947_10016164 JGI24698J34947_100161644 341
31 3300002449 JGI24698J34947_10022927 JGI24698J34947_100229272 341
32 3300002449 JGI24698J34947_10027286 JGI24698J34947_100272862 341
33 3300002449 JGI24698J34947_10089756 JGI24698J34947_100897562 341
34 3300002449 JGI24698J34947_10092660 JGI24698J34947_100926601 341
35 3300005201 Ga0072941_1008778 Ga0072941_10087786 341
36 3300005201 Ga0072941_1016130 Ga0072941_10161302 341
37 3300010167 Ga0123353_10741224 Ga0123353_107412242 341
38 3300042595 Ga0466695_070566 Ga0466695_070566_229_1254 341
39 3300042607 Ga0466720_007877 Ga0466720_007877_10490_11515 341
40 3300042607 Ga0466720_030889 Ga0466720_030889_1161_2186 341
41 3300042607 Ga0466720_097898 Ga0466720_097898_378_1403 341
42 3300042607 Ga0466720_112167 Ga0466720_112167_8488_9513 341
43 3300042610 Ga0466698_358110 Ga0466698_358110_152_1177 341
44 3300042612 Ga0466705_144279 Ga0466705_144279_3251_4276 341
45 3300042614 Ga0466712_069687 Ga0466712_069687_5583_6608 341
46 3300042624 Ga0466735_110396 Ga0466735_110396_488_1513 341
47 3300000089 AustNasuHG_c1005440 AustNasuHG_10054402 342
48 3300002449 JGI24698J34947_10004441 JGI24698J34947_100044414 342
49 3300002449 JGI24698J34947_10030619 JGI24698J34947_100306193 342
50 3300009784 Ga0123357_10159219 Ga0123357_101592192 342
51 3300010882 Ga0123354_10074080 Ga0123354_100740805 342
52 3300042582 Ga0466657_033384 Ga0466657_033384_672_1700 342
53 3300042597 Ga0466699_357835 Ga0466699_357835_799_1827 342
54 3300042605 Ga0466716_016699 Ga0466716_016699_1301_2329 342
55 3300042606 Ga0466719_022987 Ga0466719_022987_93_1121 342
56 3300042612 Ga0466705_415237 Ga0466705_415237_1087_2115 342
57 3300042655 Ga0466727_204804 Ga0466727_204804_435_1463 342
58 3300002450 JGI24695J34938_10095979 JGI24695J34938_100959792 343
59 3300042590 Ga0466690_085600 Ga0466690_085600_343_1374 343
60 3300042596 Ga0466696_474308 Ga0466696_474308_325_1356 343
61 3300042622 Ga0466731_416896 Ga0466731_416896_771_1802 343
62 3300042636 Ga0466703_253475 Ga0466703_253475_1313_2344 343
63 iso_pr_bacteria 2781125690 2781428472 343
64 2225789004 2227466304 2227905679 344
65 2225789004 2227492706 2227966527 344
66 3300000062 IMNBL1DRAFT_c0018807 IMNBL1DRAFT_00188074 344
67 3300002449 JGI24698J34947_10020663 JGI24698J34947_100206633 344
68 3300002462 JGI24702J35022_10080748 JGI24702J35022_100807482 344
69 3300010167 Ga0123353_10629268 Ga0123353_106292682 344
70 3300042590 Ga0466690_045452 Ga0466690_045452_4199_5233 344
71 3300042596 Ga0466696_391746 Ga0466696_391746_456_1490 344
72 3300042599 Ga0466706_092568 Ga0466706_092568_1596_2630 344
73 3300042601 Ga0466707_109763 Ga0466707_109763_382_1416 344
74 3300042607 Ga0466720_080892 Ga0466720_080892_7519_8553 344
75 3300042614 Ga0466712_129135 Ga0466712_129135_3779_4813 344
76 3300042615 Ga0466711_005989 Ga0466711_005989_381_1415 344
77 3300042643 Ga0466704_321521 Ga0466704_321521_673_1707 344
78 iso_pr_bacteria 3004672520 3004673598 344
79 3300000062 IMNBL1DRAFT_c0002597 IMNBL1DRAFT_00025973 345
80 3300000062 IMNBL1DRAFT_c0008518 IMNBL1DRAFT_00085184 345
81 3300000062 IMNBL1DRAFT_c0017232 IMNBL1DRAFT_00172323 345
82 3300000062 IMNBL1DRAFT_c0038564 IMNBL1DRAFT_00385642 345
83 3300000089 AustNasuHG_c1023980 AustNasuHG_10239802 345
84 3300010049 Ga0123356_10375569 Ga0123356_103755691 345
85 3300010882 Ga0123354_10044285 Ga0123354_100442853 345
86 3300042617 Ga0466718_014690 Ga0466718_014690_6974_8011 345
87 iso_pr_bacteria 2940205530 2940209198 345
88 iso_pr_bacteria 2940212447 2940216112 345
89 iso_pr_bacteria 2940298504 2940302137 345
90 iso_pr_bacteria 2940302308 2940305985 345
91 iso_pr_bacteria 2940306115 2940309842 345
92 iso_pr_bacteria 2940309933 2940313603 345
93 iso_pr_bacteria 2940313741 2940317467 345
94 iso_pr_bacteria 2940317558 2940321251 345
95 iso_pr_bacteria 2940321370 2940325093 345
96 iso_pr_bacteria 2940325180 2940328883 345
97 iso_pr_bacteria 2940328985 2940332693 345
98 iso_pr_bacteria 2940332795 2940336518 345
99 3300002501 JGI24703J35330_11624370 JGI24703J35330_116243701 346
100 3300010167 Ga0123353_10653119 Ga0123353_106531192 346
101 3300042595 Ga0466695_262320 Ga0466695_262320_31784_32824 346
102 3300042617 Ga0466718_138905 Ga0466718_138905_278_1318 346
103 3300005071 Ga0068302_10043293 Ga0068302_100432932 347
104 3300009826 Ga0123355_10136167 Ga0123355_101361672 347
105 3300042596 Ga0466696_102909 Ga0466696_102909_541_1584 347
106 3300042596 Ga0466696_177856 Ga0466696_177856_335_1378 347
107 3300042597 Ga0466699_131041 Ga0466699_131041_255_1298 347
108 3300042612 Ga0466705_047522 Ga0466705_047522_4703_5746 347
109 3300042636 Ga0466703_014351 Ga0466703_014351_8560_9603 347
110 3300042648 Ga0466709_080197 Ga0466709_080197_5335_6378 347
111 3300042616 Ga0466715_172861 Ga0466715_172861_224_1270 348
112 3300010167 Ga0123353_10004826 Ga0123353_1000482614 350
113 3300042643 Ga0466704_363579 Ga0466704_363579_22170_23228 352
114 3300010167 Ga0123353_10000797 Ga0123353_100007979 353
115 3300042620 Ga0466728_342924 Ga0466728_342924_151_1212 353
116 3300042600 Ga0466700_332611 Ga0466700_332611_422_1486 354
117 3300005083 Ga0068305_10162891 Ga0068305_101628912 361
118 3300042616 Ga0466715_212643 Ga0466715_212643_135_1223 362
119 3300038395 Ga0415639_119326 Ga0415639_119326_641_1744 367
120 3300042612 Ga0466705_460186 Ga0466705_460186_181_1293 370

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13310 Virulence_RhuM Virulence protein RhuM family 75 328 0.98

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.46 0.53 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.