Protein Family IF00863
Metagenome
Isolate
120
Members
64
Samples
104
Scaffolds
342.23
Avg Length
Representative Sequence
- ID
- 3300002501|JGI24703J35330_11624370|JGI24703J35330_116243701
- Length
- 346 aa
- Sequence
- MRKSEDAQALIIPNATAEFLTFAFQTGGDGIEIRVQDGTVWLSQKLMAQLFDTTPENIISHIKSITKEAELDPEATTKDFLVVQIEGTRSVNRKIKHYNLDMIIAVGYRVNSGKATAFRRWAITVLRDFALRGYVIDKERMKNGTFFNDDYFEHLLAEIREIRLSERRFHQKITDIYSTAMDYNKDAPTTRDFFAKVQNKLHWAIHGHTAAELIYKRADSEKQHMGLSTWQNAPSGKILKKDVAVAKNYLTQDEIKDLELVVSGYLDLAEALAKRKVPMTMDEWSEHLDMILRASKYEILDNLGSITKEIAKMHAEAEFAKYRVVQDKLFESDFDKFIETTGEIL*
Sample Types
Isolate
13.3%
Metagenome
86.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.1%
Blattidae
22.6%
Kalotermitidae
21.0%
Unclassified
6.5%
Termopsidae
6.5%
Passalidae
3.2%
Rhinotermitidae
1.6%
Hodotermitidae
1.6%
Taxonomy
Archaea
1
Bacteria
106
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 2 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 3 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 4 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 5 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 6 | 2740892546 | Fibrobacteria bacterium GUT307 IN01_307 | Isolate | Unclassified |
| 7 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 8 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 9 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 10 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 11 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 12 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 13 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 14 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 15 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 16 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 17 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 18 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 19 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 20 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 21 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 22 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 23 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 24 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 25 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 26 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 27 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 28 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 29 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 30 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 31 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 32 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 33 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 34 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 35 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 36 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 37 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 38 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 39 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 40 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 41 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 42 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 43 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 44 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 45 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 46 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 47 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 48 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 49 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 50 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 51 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 52 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 53 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 54 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 55 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 56 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 57 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 58 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 59 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 60 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 61 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 62 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 63 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 64 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_068883 | 3300042656 | Bacteria | 2735 |
| 2 | Ga0466705_415237 | 3300042612 | Bacteria | 5041 |
| 3 | Ga0466696_177856 | 3300042596 | Bacteria | 1504 |
| 4 | Ga0466696_391746 | 3300042596 | Bacteria | 10993 |
| 5 | Ga0466699_357835 | 3300042597 | Bacteria | 3784 |
| 6 | Ga0466700_332611 | 3300042600 | Bacteria | 1611 |
| 7 | Ga0466722_147025 | 3300042609 | Bacteria | 4772 |
| 8 | IMNBL1DRAFT_c0008518 | 3300000062 | Bacteria | 5208 |
| 9 | IMNBL1DRAFT_c0017232 | 3300000062 | Unclassified | 3051 |
| 10 | Ga0123353_10741224 | 3300010167 | Bacteria | 1369 |
| 11 | Ga0123354_10044285 | 3300010882 | Bacteria | 6827 |
| 12 | Ga0466705_144279 | 3300042612 | Bacteria | 5695 |
| 13 | Ga0466731_274714 | 3300042622 | Bacteria | 5633 |
| 14 | Ga0466704_363579 | 3300042643 | Bacteria | 24250 |
| 15 | Ga0466709_075648 | 3300042648 | Bacteria | 4824 |
| 16 | Ga0466732_226497 | 3300042656 | Bacteria | 4339 |
| 17 | Ga0466715_172861 | 3300042616 | Unclassified | 2916 |
| 18 | IMNBL1DRAFT_c0002597 | 3300000062 | Bacteria | 12416 |
| 19 | IMNBL1DRAFT_c0012004 | 3300000062 | Bacteria | 3993 |
| 20 | IMNBL1DRAFT_c0012646 | 3300000062 | Bacteria | 3844 |
| 21 | JGI24698J34947_10004441 | 3300002449 | Bacteria | 7637 |
| 22 | JGI24698J34947_10016164 | 3300002449 | Bacteria | 4053 |
| 23 | JGI24698J34947_10092660 | 3300002449 | Unclassified | 1381 |
| 24 | Ga0068305_10162891 | 3300005083 | Bacteria | 5560 |
| 25 | Ga0123353_10004826 | 3300010167 | Bacteria | 17512 |
| 26 | Ga0466731_416896 | 3300042622 | Bacteria | 1958 |
| 27 | Ga0466735_110396 | 3300042624 | Bacteria | 1721 |
| 28 | Ga0466703_289327 | 3300042636 | Bacteria | 1191 |
| 29 | Ga0466715_212643 | 3300042616 | Bacteria | 2056 |
| 30 | Ga0466718_138905 | 3300042617 | Bacteria | 1544 |
| 31 | Ga0466657_033384 | 3300042582 | Bacteria | 3004 |
| 32 | Ga0466701_005263 | 3300042598 | Bacteria | 1503 |
| 33 | Ga0466706_092568 | 3300042599 | Bacteria | 5815 |
| 34 | Ga0466707_420126 | 3300042601 | Bacteria | 1496 |
| 35 | 2227447468 | 2225789004 | Unclassified | 5444 |
| 36 | IMNBL1DRAFT_c0018807 | 3300000062 | Bacteria | 2856 |
| 37 | FAAS_10007610 | 3300001880 | Bacteria | 1101 |
| 38 | JGI24698J34947_10027286 | 3300002449 | Bacteria | 3031 |
| 39 | JGI24695J34938_10095979 | 3300002450 | Bacteria | 1214 |
| 40 | Ga0466704_214858 | 3300042643 | Bacteria | 4153 |
| 41 | Ga0466733_156408 | 3300042659 | Bacteria | 45949 |
| 42 | Ga0466726_309011 | 3300042619 | Bacteria | 1399 |
| 43 | Ga0415639_119326 | 3300038395 | Unclassified | 1821 |
| 44 | Ga0466696_102909 | 3300042596 | Bacteria | 5338 |
| 45 | Ga0466699_131041 | 3300042597 | Archaea | 2347 |
| 46 | Ga0466716_016699 | 3300042605 | Bacteria | 2538 |
| 47 | Ga0466720_007877 | 3300042607 | Bacteria | 20619 |
| 48 | Ga0466720_030889 | 3300042607 | Bacteria | 5804 |
| 49 | Ga0466720_097898 | 3300042607 | Bacteria | 5518 |
| 50 | Ga0466720_112167 | 3300042607 | Bacteria | 13198 |
| 51 | Ga0466698_358110 | 3300042610 | Bacteria | 1373 |
| 52 | IMNBL1DRAFT_c0038564 | 3300000062 | Unclassified | 1642 |
| 53 | JGI24698J34947_10020663 | 3300002449 | Bacteria | 3544 |
| 54 | JGI24703J35330_11624370 | 3300002501 | Unclassified | 1467 |
| 55 | Ga0123355_10136167 | 3300009826 | Bacteria | 3772 |
| 56 | Ga0123353_10629268 | 3300010167 | Bacteria | 1525 |
| 57 | Ga0466705_047522 | 3300042612 | Bacteria | 12961 |
| 58 | Ga0466704_219592 | 3300042643 | Bacteria | 2021 |
| 59 | Ga0466708_101376 | 3300042652 | Bacteria | 1432 |
| 60 | Ga0466711_005989 | 3300042615 | Bacteria | 2167 |
| 61 | Ga0466728_114650 | 3300042620 | Bacteria | 8762 |
| 62 | Ga0466695_262320 | 3300042595 | Bacteria | 38774 |
| 63 | Ga0466719_022987 | 3300042606 | Bacteria | 1279 |
| 64 | Ga0466720_080892 | 3300042607 | Bacteria | 26978 |
| 65 | 2227466304 | 2225789004 | Unclassified | 24553 |
| 66 | IMNBL1DRAFT_c0019152 | 3300000062 | Bacteria | 2815 |
| 67 | AustNasuHG_c1023980 | 3300000089 | Bacteria | 1940 |
| 68 | Ga0072941_1016130 | 3300005201 | Unclassified | 14960 |
| 69 | Ga0466728_342924 | 3300042620 | Bacteria | 1444 |
| 70 | Ga0466691_030038 | 3300042593 | Bacteria | 51774 |
| 71 | Ga0466707_396095 | 3300042601 | Bacteria | 1578 |
| 72 | 2227474624 | 2225789004 | Bacteria | 22862 |
| 73 | AustNasuHG_c1005440 | 3300000089 | Bacteria | 4551 |
| 74 | Ga0068302_10043293 | 3300005071 | Bacteria | 2057 |
| 75 | Ga0072941_1008778 | 3300005201 | Bacteria | 22332 |
| 76 | Ga0123357_10159219 | 3300009784 | Bacteria | 2712 |
| 77 | Ga0123353_10653119 | 3300010167 | Unclassified | 1488 |
| 78 | Ga0123354_10074080 | 3300010882 | Bacteria | 4882 |
| 79 | Ga0466709_080197 | 3300042648 | Bacteria | 10370 |
| 80 | Ga0466733_070281 | 3300042659 | Bacteria | 14721 |
| 81 | Ga0466705_460186 | 3300042612 | Bacteria | 1639 |
| 82 | Ga0466712_129135 | 3300042614 | Bacteria | 16333 |
| 83 | Ga0466718_014690 | 3300042617 | Bacteria | 8638 |
| 84 | Ga0466728_049858 | 3300042620 | Bacteria | 1515 |
| 85 | Ga0466696_124173 | 3300042596 | Unclassified | 1124 |
| 86 | Ga0466707_109763 | 3300042601 | Bacteria | 1478 |
| 87 | JGI24698J34947_10022927 | 3300002449 | Bacteria | 3341 |
| 88 | JGI24702J35022_10080748 | 3300002462 | Bacteria | 1761 |
| 89 | Ga0466703_253475 | 3300042636 | Bacteria | 2758 |
| 90 | Ga0466727_204804 | 3300042655 | Bacteria | 1654 |
| 91 | Ga0466733_032077 | 3300042659 | Unclassified | 6299 |
| 92 | Ga0466712_069687 | 3300042614 | Bacteria | 15367 |
| 93 | Ga0466690_045452 | 3300042590 | Bacteria | 6413 |
| 94 | Ga0466690_085600 | 3300042590 | Bacteria | 3415 |
| 95 | Ga0466695_070566 | 3300042595 | Bacteria | 1828 |
| 96 | Ga0466696_474308 | 3300042596 | Bacteria | 2215 |
| 97 | 2227492706 | 2225789004 | Bacteria | 4036 |
| 98 | JGI24698J34947_10030619 | 3300002449 | Unclassified | 2837 |
| 99 | JGI24698J34947_10089756 | 3300002449 | Bacteria | 1414 |
| 100 | Ga0123356_10375569 | 3300010049 | Bacteria | 1553 |
| 101 | Ga0123353_10000797 | 3300010167 | Bacteria | 38391 |
| 102 | Ga0466703_014351 | 3300042636 | Bacteria | 16224 |
| 103 | Ga0466704_321521 | 3300042643 | Bacteria | 4723 |
| 104 | Ga0466708_061962 | 3300042652 | Bacteria | 3387 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042656 | Ga0466732_226497 | Ga0466732_226497_240_1154 | 304 |
| 2 | 3300042596 | Ga0466696_124173 | Ga0466696_124173_158_1099 | 313 |
| 3 | 3300042620 | Ga0466728_114650 | Ga0466728_114650_3767_4804 | 314 |
| 4 | 3300042601 | Ga0466707_396095 | Ga0466707_396095_235_1266 | 322 |
| 5 | 3300042636 | Ga0466703_289327 | Ga0466703_289327_67_1035 | 322 |
| 6 | 3300042593 | Ga0466691_030038 | Ga0466691_030038_713_1750 | 325 |
| 7 | 3300001880 | FAAS_10007610 | FAAS_100076101 | 327 |
| 8 | 3300042659 | Ga0466733_156408 | Ga0466733_156408_21542_22537 | 331 |
| 9 | 3300042643 | Ga0466704_214858 | Ga0466704_214858_2255_3256 | 333 |
| 10 | iso_pr_bacteria | 2940195863 | 2940197811 | 336 |
| 11 | 3300042598 | Ga0466701_005263 | Ga0466701_005263_324_1337 | 337 |
| 12 | 3300042619 | Ga0466726_309011 | Ga0466726_309011_124_1137 | 337 |
| 13 | 3300042652 | Ga0466708_101376 | Ga0466708_101376_373_1386 | 337 |
| 14 | 3300042659 | Ga0466733_032077 | Ga0466733_032077_2903_3916 | 337 |
| 15 | 3300042659 | Ga0466733_070281 | Ga0466733_070281_7051_8064 | 337 |
| 16 | 2225789004 | 2227474624 | 2227924972 | 338 |
| 17 | 3300000062 | IMNBL1DRAFT_c0012646 | IMNBL1DRAFT_00126462 | 338 |
| 18 | 3300000062 | IMNBL1DRAFT_c0012004 | IMNBL1DRAFT_00120042 | 339 |
| 19 | 3300000062 | IMNBL1DRAFT_c0019152 | IMNBL1DRAFT_00191524 | 339 |
| 20 | 3300042601 | Ga0466707_420126 | Ga0466707_420126_132_1151 | 339 |
| 21 | 3300042620 | Ga0466728_049858 | Ga0466728_049858_108_1127 | 339 |
| 22 | 3300042622 | Ga0466731_274714 | Ga0466731_274714_2859_3878 | 339 |
| 23 | 3300042643 | Ga0466704_219592 | Ga0466704_219592_346_1365 | 339 |
| 24 | 3300042648 | Ga0466709_075648 | Ga0466709_075648_3141_4160 | 339 |
| 25 | 3300042652 | Ga0466708_061962 | Ga0466708_061962_15_1034 | 339 |
| 26 | 3300042656 | Ga0466732_068883 | Ga0466732_068883_1371_2390 | 339 |
| 27 | 3300042609 | Ga0466722_147025 | Ga0466722_147025_1307_2329 | 340 |
| 28 | iso_pr_bacteria | 2740892546 | 2743910396 | 340 |
| 29 | 2225789004 | 2227447468 | 2227884965 | 341 |
| 30 | 3300002449 | JGI24698J34947_10016164 | JGI24698J34947_100161644 | 341 |
| 31 | 3300002449 | JGI24698J34947_10022927 | JGI24698J34947_100229272 | 341 |
| 32 | 3300002449 | JGI24698J34947_10027286 | JGI24698J34947_100272862 | 341 |
| 33 | 3300002449 | JGI24698J34947_10089756 | JGI24698J34947_100897562 | 341 |
| 34 | 3300002449 | JGI24698J34947_10092660 | JGI24698J34947_100926601 | 341 |
| 35 | 3300005201 | Ga0072941_1008778 | Ga0072941_10087786 | 341 |
| 36 | 3300005201 | Ga0072941_1016130 | Ga0072941_10161302 | 341 |
| 37 | 3300010167 | Ga0123353_10741224 | Ga0123353_107412242 | 341 |
| 38 | 3300042595 | Ga0466695_070566 | Ga0466695_070566_229_1254 | 341 |
| 39 | 3300042607 | Ga0466720_007877 | Ga0466720_007877_10490_11515 | 341 |
| 40 | 3300042607 | Ga0466720_030889 | Ga0466720_030889_1161_2186 | 341 |
| 41 | 3300042607 | Ga0466720_097898 | Ga0466720_097898_378_1403 | 341 |
| 42 | 3300042607 | Ga0466720_112167 | Ga0466720_112167_8488_9513 | 341 |
| 43 | 3300042610 | Ga0466698_358110 | Ga0466698_358110_152_1177 | 341 |
| 44 | 3300042612 | Ga0466705_144279 | Ga0466705_144279_3251_4276 | 341 |
| 45 | 3300042614 | Ga0466712_069687 | Ga0466712_069687_5583_6608 | 341 |
| 46 | 3300042624 | Ga0466735_110396 | Ga0466735_110396_488_1513 | 341 |
| 47 | 3300000089 | AustNasuHG_c1005440 | AustNasuHG_10054402 | 342 |
| 48 | 3300002449 | JGI24698J34947_10004441 | JGI24698J34947_100044414 | 342 |
| 49 | 3300002449 | JGI24698J34947_10030619 | JGI24698J34947_100306193 | 342 |
| 50 | 3300009784 | Ga0123357_10159219 | Ga0123357_101592192 | 342 |
| 51 | 3300010882 | Ga0123354_10074080 | Ga0123354_100740805 | 342 |
| 52 | 3300042582 | Ga0466657_033384 | Ga0466657_033384_672_1700 | 342 |
| 53 | 3300042597 | Ga0466699_357835 | Ga0466699_357835_799_1827 | 342 |
| 54 | 3300042605 | Ga0466716_016699 | Ga0466716_016699_1301_2329 | 342 |
| 55 | 3300042606 | Ga0466719_022987 | Ga0466719_022987_93_1121 | 342 |
| 56 | 3300042612 | Ga0466705_415237 | Ga0466705_415237_1087_2115 | 342 |
| 57 | 3300042655 | Ga0466727_204804 | Ga0466727_204804_435_1463 | 342 |
| 58 | 3300002450 | JGI24695J34938_10095979 | JGI24695J34938_100959792 | 343 |
| 59 | 3300042590 | Ga0466690_085600 | Ga0466690_085600_343_1374 | 343 |
| 60 | 3300042596 | Ga0466696_474308 | Ga0466696_474308_325_1356 | 343 |
| 61 | 3300042622 | Ga0466731_416896 | Ga0466731_416896_771_1802 | 343 |
| 62 | 3300042636 | Ga0466703_253475 | Ga0466703_253475_1313_2344 | 343 |
| 63 | iso_pr_bacteria | 2781125690 | 2781428472 | 343 |
| 64 | 2225789004 | 2227466304 | 2227905679 | 344 |
| 65 | 2225789004 | 2227492706 | 2227966527 | 344 |
| 66 | 3300000062 | IMNBL1DRAFT_c0018807 | IMNBL1DRAFT_00188074 | 344 |
| 67 | 3300002449 | JGI24698J34947_10020663 | JGI24698J34947_100206633 | 344 |
| 68 | 3300002462 | JGI24702J35022_10080748 | JGI24702J35022_100807482 | 344 |
| 69 | 3300010167 | Ga0123353_10629268 | Ga0123353_106292682 | 344 |
| 70 | 3300042590 | Ga0466690_045452 | Ga0466690_045452_4199_5233 | 344 |
| 71 | 3300042596 | Ga0466696_391746 | Ga0466696_391746_456_1490 | 344 |
| 72 | 3300042599 | Ga0466706_092568 | Ga0466706_092568_1596_2630 | 344 |
| 73 | 3300042601 | Ga0466707_109763 | Ga0466707_109763_382_1416 | 344 |
| 74 | 3300042607 | Ga0466720_080892 | Ga0466720_080892_7519_8553 | 344 |
| 75 | 3300042614 | Ga0466712_129135 | Ga0466712_129135_3779_4813 | 344 |
| 76 | 3300042615 | Ga0466711_005989 | Ga0466711_005989_381_1415 | 344 |
| 77 | 3300042643 | Ga0466704_321521 | Ga0466704_321521_673_1707 | 344 |
| 78 | iso_pr_bacteria | 3004672520 | 3004673598 | 344 |
| 79 | 3300000062 | IMNBL1DRAFT_c0002597 | IMNBL1DRAFT_00025973 | 345 |
| 80 | 3300000062 | IMNBL1DRAFT_c0008518 | IMNBL1DRAFT_00085184 | 345 |
| 81 | 3300000062 | IMNBL1DRAFT_c0017232 | IMNBL1DRAFT_00172323 | 345 |
| 82 | 3300000062 | IMNBL1DRAFT_c0038564 | IMNBL1DRAFT_00385642 | 345 |
| 83 | 3300000089 | AustNasuHG_c1023980 | AustNasuHG_10239802 | 345 |
| 84 | 3300010049 | Ga0123356_10375569 | Ga0123356_103755691 | 345 |
| 85 | 3300010882 | Ga0123354_10044285 | Ga0123354_100442853 | 345 |
| 86 | 3300042617 | Ga0466718_014690 | Ga0466718_014690_6974_8011 | 345 |
| 87 | iso_pr_bacteria | 2940205530 | 2940209198 | 345 |
| 88 | iso_pr_bacteria | 2940212447 | 2940216112 | 345 |
| 89 | iso_pr_bacteria | 2940298504 | 2940302137 | 345 |
| 90 | iso_pr_bacteria | 2940302308 | 2940305985 | 345 |
| 91 | iso_pr_bacteria | 2940306115 | 2940309842 | 345 |
| 92 | iso_pr_bacteria | 2940309933 | 2940313603 | 345 |
| 93 | iso_pr_bacteria | 2940313741 | 2940317467 | 345 |
| 94 | iso_pr_bacteria | 2940317558 | 2940321251 | 345 |
| 95 | iso_pr_bacteria | 2940321370 | 2940325093 | 345 |
| 96 | iso_pr_bacteria | 2940325180 | 2940328883 | 345 |
| 97 | iso_pr_bacteria | 2940328985 | 2940332693 | 345 |
| 98 | iso_pr_bacteria | 2940332795 | 2940336518 | 345 |
| 99 | 3300002501 | JGI24703J35330_11624370 | JGI24703J35330_116243701 | 346 |
| 100 | 3300010167 | Ga0123353_10653119 | Ga0123353_106531192 | 346 |
| 101 | 3300042595 | Ga0466695_262320 | Ga0466695_262320_31784_32824 | 346 |
| 102 | 3300042617 | Ga0466718_138905 | Ga0466718_138905_278_1318 | 346 |
| 103 | 3300005071 | Ga0068302_10043293 | Ga0068302_100432932 | 347 |
| 104 | 3300009826 | Ga0123355_10136167 | Ga0123355_101361672 | 347 |
| 105 | 3300042596 | Ga0466696_102909 | Ga0466696_102909_541_1584 | 347 |
| 106 | 3300042596 | Ga0466696_177856 | Ga0466696_177856_335_1378 | 347 |
| 107 | 3300042597 | Ga0466699_131041 | Ga0466699_131041_255_1298 | 347 |
| 108 | 3300042612 | Ga0466705_047522 | Ga0466705_047522_4703_5746 | 347 |
| 109 | 3300042636 | Ga0466703_014351 | Ga0466703_014351_8560_9603 | 347 |
| 110 | 3300042648 | Ga0466709_080197 | Ga0466709_080197_5335_6378 | 347 |
| 111 | 3300042616 | Ga0466715_172861 | Ga0466715_172861_224_1270 | 348 |
| 112 | 3300010167 | Ga0123353_10004826 | Ga0123353_1000482614 | 350 |
| 113 | 3300042643 | Ga0466704_363579 | Ga0466704_363579_22170_23228 | 352 |
| 114 | 3300010167 | Ga0123353_10000797 | Ga0123353_100007979 | 353 |
| 115 | 3300042620 | Ga0466728_342924 | Ga0466728_342924_151_1212 | 353 |
| 116 | 3300042600 | Ga0466700_332611 | Ga0466700_332611_422_1486 | 354 |
| 117 | 3300005083 | Ga0068305_10162891 | Ga0068305_101628912 | 361 |
| 118 | 3300042616 | Ga0466715_212643 | Ga0466715_212643_135_1223 | 362 |
| 119 | 3300038395 | Ga0415639_119326 | Ga0415639_119326_641_1744 | 367 |
| 120 | 3300042612 | Ga0466705_460186 | Ga0466705_460186_181_1293 | 370 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13310 | Virulence_RhuM | Virulence protein RhuM family | 75 | 328 | 0.98 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.46 | 0.53 | Medium |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.