Protein Family IF00826
Metagenome
Isolate
185
Members
62
Samples
162
Scaffolds
153.98
Avg Length
Representative Sequence
- ID
- 3300002462|JGI24702J35022_10448563|JGI24702J35022_104485631
- Length
- 172 aa
- Sequence
- MEIENQLTGGDSMGKFSKAGGREMPELNTTSLPDLVFAILFFFMMITTMREVTLKVQFRSPQATELQKLEKKSLITFIYVGKPINAELITKLGTESRIQLNDQIAEIAEVGAYIGQEKASMKEEDQPFMTTSIKADFETRMSIITDLKQALREAYALKISYSARPRSPGSR*
Sample Types
Isolate
12.4%
Metagenome
87.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
37.7%
Kalotermitidae
23.0%
Termitidae
21.3%
Termopsidae
6.6%
Unclassified
4.9%
Passalidae
3.3%
Hodotermitidae
1.6%
Rhinotermitidae
1.6%
Taxonomy
Archaea
0
Bacteria
167
Eukaryota
0
Viruses
0
Unclassified
18
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 2 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 3 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 4 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 5 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 6 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 7 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 8 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 9 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 10 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 11 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 12 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 13 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 14 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 15 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 16 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 17 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 18 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 19 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 20 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 21 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 22 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 23 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 24 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 25 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 26 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 27 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 28 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 29 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 30 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 31 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 32 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 33 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 34 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 35 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 36 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 37 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 38 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 39 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 40 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 41 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 42 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 43 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 44 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 45 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 46 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 47 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 48 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 49 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 50 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 51 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 52 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 53 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 54 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 55 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 56 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 57 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 58 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 59 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 60 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 61 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 62 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_019476 | 3300042612 | Bacteria | 24974 |
| 2 | Ga0466733_184071 | 3300042659 | Bacteria | 32833 |
| 3 | Ga0466710_163935 | 3300042613 | Bacteria | 2060 |
| 4 | Ga0466728_180564 | 3300042620 | Bacteria | 92308 |
| 5 | Ga0123353_11391237 | 3300010167 | Bacteria | 903 |
| 6 | Ga0466706_195965 | 3300042599 | Bacteria | 1073 |
| 7 | Ga0466707_409501 | 3300042601 | Bacteria | 1911 |
| 8 | Ga0466716_484837 | 3300042605 | Bacteria | 30730 |
| 9 | Ga0466719_119717 | 3300042606 | Bacteria | 17932 |
| 10 | Ga0466722_138448 | 3300042609 | Bacteria | 6032 |
| 11 | Ga0466722_156135 | 3300042609 | Bacteria | 6286 |
| 12 | Ga0466735_233477 | 3300042624 | Bacteria | 1560 |
| 13 | Ga0466703_019525 | 3300042636 | Bacteria | 29012 |
| 14 | Ga0466703_202519 | 3300042636 | Bacteria | 22773 |
| 15 | Ga0466709_204908 | 3300042648 | Bacteria | 5360 |
| 16 | Ga0466708_066300 | 3300042652 | Bacteria | 36627 |
| 17 | Ga0466656_176815 | 3300042550 | Bacteria | 2267 |
| 18 | Ga0466657_072121 | 3300042582 | Bacteria | 9488 |
| 19 | Ga0466657_168532 | 3300042582 | Bacteria | 9954 |
| 20 | Ga0466657_308384 | 3300042582 | Bacteria | 1019 |
| 21 | Ga0466690_039968 | 3300042590 | Bacteria | 9494 |
| 22 | Ga0466690_150289 | 3300042590 | Bacteria | 55221 |
| 23 | Ga0466690_416236 | 3300042590 | Unclassified | 2081 |
| 24 | Ga0466691_127886 | 3300042593 | Bacteria | 16442 |
| 25 | Ga0466696_061891 | 3300042596 | Bacteria | 14268 |
| 26 | Ga0466696_215903 | 3300042596 | Bacteria | 16708 |
| 27 | IMNBL1DRAFT_c0030229 | 3300000062 | Bacteria | 1990 |
| 28 | JGI24702J35022_10394775 | 3300002462 | Bacteria | 834 |
| 29 | JGI24696J40584_12960523 | 3300002834 | Unclassified | 7479 |
| 30 | Ga0466697_201058 | 3300042611 | Bacteria | 1969 |
| 31 | Ga0466705_399685 | 3300042612 | Unclassified | 2115 |
| 32 | Ga0466711_009877 | 3300042615 | Bacteria | 14278 |
| 33 | Ga0466726_005153 | 3300042619 | Bacteria | 16947 |
| 34 | Ga0466728_018673 | 3300042620 | Bacteria | 22808 |
| 35 | Ga0466728_438356 | 3300042620 | Bacteria | 29481 |
| 36 | Ga0466706_050074 | 3300042599 | Bacteria | 18582 |
| 37 | Ga0466716_059727 | 3300042605 | Bacteria | 9929 |
| 38 | Ga0466719_068358 | 3300042606 | Bacteria | 7078 |
| 39 | Ga0466704_043621 | 3300042643 | Bacteria | 12179 |
| 40 | Ga0466704_095285 | 3300042643 | Bacteria | 3139 |
| 41 | Ga0466704_393392 | 3300042643 | Bacteria | 8481 |
| 42 | Ga0466704_438870 | 3300042643 | Bacteria | 17990 |
| 43 | Ga0466656_224030 | 3300042550 | Bacteria | 11159 |
| 44 | Ga0466690_402356 | 3300042590 | Bacteria | 64397 |
| 45 | Ga0466691_045847 | 3300042593 | Bacteria | 49393 |
| 46 | Ga0466696_433878 | 3300042596 | Unclassified | 1301 |
| 47 | IMNBL1DRAFT_c0003807 | 3300000062 | Bacteria | 9410 |
| 48 | JGI24702J35022_10037744 | 3300002462 | Bacteria | 2580 |
| 49 | JGI24702J35022_10111432 | 3300002462 | Bacteria | 1505 |
| 50 | Ga0068305_10005585 | 3300005083 | Bacteria | 21211 |
| 51 | Ga0068305_10017836 | 3300005083 | Bacteria | 19003 |
| 52 | Ga0466705_077990 | 3300042612 | Bacteria | 24079 |
| 53 | Ga0466711_285989 | 3300042615 | Bacteria | 7430 |
| 54 | Ga0466715_204293 | 3300042616 | Bacteria | 67582 |
| 55 | Ga0466715_273928 | 3300042616 | Bacteria | 5514 |
| 56 | Ga0466713_077495 | 3300042602 | Bacteria | 42226 |
| 57 | Ga0466716_485727 | 3300042605 | Bacteria | 6567 |
| 58 | Ga0466735_055308 | 3300042624 | Unclassified | 1181 |
| 59 | Ga0466735_129784 | 3300042624 | Unclassified | 4597 |
| 60 | Ga0466735_130732 | 3300042624 | Bacteria | 1034 |
| 61 | Ga0466703_237479 | 3300042636 | Bacteria | 23006 |
| 62 | Ga0466708_372311 | 3300042652 | Bacteria | 12035 |
| 63 | Ga0466727_040337 | 3300042655 | Bacteria | 31698 |
| 64 | Ga0466656_238755 | 3300042550 | Bacteria | 1691 |
| 65 | Ga0466696_285690 | 3300042596 | Unclassified | 2965 |
| 66 | 2227279693 | 2225789004 | Bacteria | 1262 |
| 67 | IMNBL1DRAFT_c0052490 | 3300000062 | Bacteria | 1277 |
| 68 | JGI24702J35022_10000840 | 3300002462 | Bacteria | 18966 |
| 69 | JGI24696J40584_12958633 | 3300002834 | Bacteria | 4282 |
| 70 | Ga0466733_048728 | 3300042659 | Bacteria | 24602 |
| 71 | Ga0466723_093881 | 3300042618 | Bacteria | 35007 |
| 72 | Ga0466706_095663 | 3300042599 | Bacteria | 79833 |
| 73 | Ga0466704_046663 | 3300042643 | Bacteria | 1697 |
| 74 | Ga0466704_157382 | 3300042643 | Bacteria | 6620 |
| 75 | Ga0466725_383969 | 3300042654 | Bacteria | 7339 |
| 76 | Ga0466727_165399 | 3300042655 | Bacteria | 2838 |
| 77 | Ga0466690_425264 | 3300042590 | Bacteria | 16300 |
| 78 | Ga0466696_052384 | 3300042596 | Bacteria | 2171 |
| 79 | Ga0466699_096967 | 3300042597 | Bacteria | 5112 |
| 80 | 2227358582 | 2225789004 | Bacteria | 27844 |
| 81 | JGI24702J35022_10448563 | 3300002462 | Bacteria | 785 |
| 82 | Ga0068302_10120824 | 3300005071 | Unclassified | 1981 |
| 83 | Ga0068305_10029560 | 3300005083 | Bacteria | 6769 |
| 84 | Ga0466706_013314 | 3300042599 | Bacteria | 67982 |
| 85 | Ga0466713_047540 | 3300042602 | Bacteria | 17647 |
| 86 | Ga0466716_025191 | 3300042605 | Bacteria | 12762 |
| 87 | Ga0466735_008892 | 3300042624 | Bacteria | 2153 |
| 88 | Ga0466735_064671 | 3300042624 | Bacteria | 78203 |
| 89 | Ga0466735_178990 | 3300042624 | Bacteria | 1355 |
| 90 | Ga0466704_287104 | 3300042643 | Bacteria | 2026 |
| 91 | Ga0466696_123817 | 3300042596 | Unclassified | 2070 |
| 92 | 2227546306 | 2225789004 | Bacteria | 2914 |
| 93 | JGI24702J35022_10004055 | 3300002462 | Bacteria | 8770 |
| 94 | Ga0466733_002151 | 3300042659 | Bacteria | 71476 |
| 95 | Ga0466710_388454 | 3300042613 | Bacteria | 7193 |
| 96 | Ga0466715_376227 | 3300042616 | Bacteria | 52075 |
| 97 | Ga0466728_082650 | 3300042620 | Bacteria | 29100 |
| 98 | Ga0466728_107128 | 3300042620 | Bacteria | 57029 |
| 99 | Ga0466728_122860 | 3300042620 | Bacteria | 67185 |
| 100 | Ga0466706_232032 | 3300042599 | Bacteria | 12970 |
| 101 | Ga0466707_121528 | 3300042601 | Bacteria | 7706 |
| 102 | Ga0466713_037887 | 3300042602 | Bacteria | 30344 |
| 103 | Ga0466735_019058 | 3300042624 | Unclassified | 1323 |
| 104 | Ga0466735_104930 | 3300042624 | Unclassified | 3898 |
| 105 | Ga0466703_209026 | 3300042636 | Bacteria | 32874 |
| 106 | Ga0466704_461780 | 3300042643 | Unclassified | 6524 |
| 107 | Ga0466724_60298 | 3300042649 | Bacteria | 3736 |
| 108 | Ga0466727_068059 | 3300042655 | Bacteria | 5782 |
| 109 | Ga0466690_389175 | 3300042590 | Bacteria | 15062 |
| 110 | Ga0466696_014642 | 3300042596 | Bacteria | 5725 |
| 111 | Ga0466696_022332 | 3300042596 | Bacteria | 1952 |
| 112 | 2227481040 | 2225789004 | Bacteria | 4435 |
| 113 | IMNBL1DRAFT_c0000677 | 3300000062 | Bacteria | 27305 |
| 114 | Ga0068305_10001726 | 3300005083 | Bacteria | 19625 |
| 115 | Ga0072941_1589607 | 3300005201 | Bacteria | 1685 |
| 116 | Ga0466697_096879 | 3300042611 | Bacteria | 330838 |
| 117 | Ga0466732_178024 | 3300042656 | Bacteria | 2808 |
| 118 | Ga0466705_490633 | 3300042612 | Bacteria | 3338 |
| 119 | Ga0466711_265420 | 3300042615 | Bacteria | 8423 |
| 120 | Ga0466711_398384 | 3300042615 | Bacteria | 15110 |
| 121 | Ga0466723_217618 | 3300042618 | Bacteria | 13477 |
| 122 | Ga0466706_037096 | 3300042599 | Bacteria | 1203 |
| 123 | Ga0466706_064281 | 3300042599 | Unclassified | 4414 |
| 124 | Ga0466706_259531 | 3300042599 | Bacteria | 16194 |
| 125 | Ga0466707_027552 | 3300042601 | Bacteria | 3394 |
| 126 | Ga0466735_031635 | 3300042624 | Bacteria | 1522 |
| 127 | Ga0466735_235509 | 3300042624 | Bacteria | 1278 |
| 128 | Ga0466704_054809 | 3300042643 | Bacteria | 13922 |
| 129 | Ga0466704_080074 | 3300042643 | Bacteria | 18633 |
| 130 | Ga0466709_101953 | 3300042648 | Bacteria | 13846 |
| 131 | Ga0466709_285899 | 3300042648 | Bacteria | 8774 |
| 132 | Ga0466727_188438 | 3300042655 | Bacteria | 2995 |
| 133 | Ga0466657_217982 | 3300042582 | Bacteria | 10357 |
| 134 | Ga0466696_153010 | 3300042596 | Unclassified | 3046 |
| 135 | 2227180794 | 2225789004 | Bacteria | 8074 |
| 136 | IMNBL1DRAFT_c0092041 | 3300000062 | Bacteria | 829 |
| 137 | Ga0068305_10212060 | 3300005083 | Bacteria | 3027 |
| 138 | Ga0466705_128961 | 3300042612 | Bacteria | 4737 |
| 139 | Ga0466711_218034 | 3300042615 | Bacteria | 4023 |
| 140 | Ga0466715_106265 | 3300042616 | Bacteria | 12571 |
| 141 | Ga0466723_354948 | 3300042618 | Bacteria | 23912 |
| 142 | Ga0466726_048838 | 3300042619 | Bacteria | 2233 |
| 143 | Ga0466706_103796 | 3300042599 | Bacteria | 26141 |
| 144 | Ga0466706_153835 | 3300042599 | Unclassified | 1339 |
| 145 | Ga0466706_265429 | 3300042599 | Bacteria | 13406 |
| 146 | Ga0466713_084099 | 3300042602 | Bacteria | 3042 |
| 147 | Ga0466713_137499 | 3300042602 | Bacteria | 46639 |
| 148 | Ga0466722_139050 | 3300042609 | Bacteria | 1002 |
| 149 | Ga0466703_001595 | 3300042636 | Bacteria | 18307 |
| 150 | Ga0466704_247905 | 3300042643 | Bacteria | 30308 |
| 151 | Ga0466704_533188 | 3300042643 | Bacteria | 20326 |
| 152 | Ga0466727_070045 | 3300042655 | Bacteria | 1501 |
| 153 | Ga0466727_179059 | 3300042655 | Bacteria | 12208 |
| 154 | Ga0466656_028592 | 3300042550 | Bacteria | 1333 |
| 155 | Ga0466690_305294 | 3300042590 | Bacteria | 13677 |
| 156 | Ga0466693_277047 | 3300042592 | Bacteria | 1450 |
| 157 | Ga0466691_118162 | 3300042593 | Unclassified | 1172 |
| 158 | Ga0466696_300751 | 3300042596 | Bacteria | 1603 |
| 159 | IMNBL1DRAFT_c0003067 | 3300000062 | Unclassified | 11030 |
| 160 | JGI24702J35022_10763393 | 3300002462 | Bacteria | 602 |
| 161 | Ga0068302_10055682 | 3300005071 | Unclassified | 7052 |
| 162 | Ga0068305_10015112 | 3300005083 | Bacteria | 28238 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042597 | Ga0466699_096967 | Ga0466699_096967_4080_4547 | 129 |
| 2 | 3300042649 | Ga0466724_60298 | Ga0466724_60298_2114_2566 | 140 |
| 3 | 3300042601 | Ga0466707_027552 | Ga0466707_027552_382_852 | 142 |
| 4 | 3300005201 | Ga0072941_1589607 | Ga0072941_15896074 | 143 |
| 5 | 3300042609 | Ga0466722_138448 | Ga0466722_138448_4309_4776 | 143 |
| 6 | 3300042656 | Ga0466732_178024 | Ga0466732_178024_1596_2063 | 143 |
| 7 | 3300002462 | JGI24702J35022_10394775 | JGI24702J35022_103947752 | 144 |
| 8 | 3300042596 | Ga0466696_153010 | Ga0466696_153010_2021_2479 | 144 |
| 9 | 3300042596 | Ga0466696_433878 | Ga0466696_433878_114_572 | 144 |
| 10 | 3300042624 | Ga0466735_008892 | Ga0466735_008892_711_1184 | 144 |
| 11 | 3300042624 | Ga0466735_233477 | Ga0466735_233477_371_844 | 144 |
| 12 | 2225789004 | 2227279693 | 2227731646 | 145 |
| 13 | 2225789004 | 2227358582 | 2227806525 | 145 |
| 14 | 3300042550 | Ga0466656_028592 | Ga0466656_028592_272_739 | 145 |
| 15 | 3300042596 | Ga0466696_285690 | Ga0466696_285690_1637_2098 | 145 |
| 16 | 3300042596 | Ga0466696_300751 | Ga0466696_300751_476_937 | 145 |
| 17 | 3300000062 | IMNBL1DRAFT_c0003067 | IMNBL1DRAFT_00030677 | 146 |
| 18 | 3300042582 | Ga0466657_072121 | Ga0466657_072121_7628_8098 | 146 |
| 19 | 3300042654 | Ga0466725_383969 | Ga0466725_383969_396_851 | 146 |
| 20 | 3300000062 | IMNBL1DRAFT_c0003807 | IMNBL1DRAFT_00038074 | 147 |
| 21 | 3300002462 | JGI24702J35022_10004055 | JGI24702J35022_1000405513 | 147 |
| 22 | 3300042582 | Ga0466657_168532 | Ga0466657_168532_8324_8791 | 147 |
| 23 | 3300042616 | Ga0466715_273928 | Ga0466715_273928_57_500 | 147 |
| 24 | 3300000062 | IMNBL1DRAFT_c0092041 | IMNBL1DRAFT_00920412 | 148 |
| 25 | 3300002834 | JGI24696J40584_12960523 | JGI24696J40584_1296052310 | 148 |
| 26 | 3300002462 | JGI24702J35022_10037744 | JGI24702J35022_100377445 | 149 |
| 27 | 3300042613 | Ga0466710_388454 | Ga0466710_388454_6647_7099 | 150 |
| 28 | 3300042611 | Ga0466697_096879 | Ga0466697_096879_59762_60217 | 151 |
| 29 | 3300042582 | Ga0466657_217982 | Ga0466657_217982_2079_2537 | 152 |
| 30 | 3300042582 | Ga0466657_308384 | Ga0466657_308384_460_918 | 152 |
| 31 | 3300042624 | Ga0466735_019058 | Ga0466735_019058_410_868 | 152 |
| 32 | 3300042624 | Ga0466735_055308 | Ga0466735_055308_92_550 | 152 |
| 33 | 3300042624 | Ga0466735_104930 | Ga0466735_104930_3239_3697 | 152 |
| 34 | 3300042624 | Ga0466735_129784 | Ga0466735_129784_2495_2953 | 152 |
| 35 | 3300042624 | Ga0466735_130732 | Ga0466735_130732_409_867 | 152 |
| 36 | 3300042613 | Ga0466710_163935 | Ga0466710_163935_1301_1762 | 153 |
| 37 | 3300042624 | Ga0466735_031635 | Ga0466735_031635_685_1161 | 153 |
| 38 | 3300042550 | Ga0466656_176815 | Ga0466656_176815_1032_1496 | 154 |
| 39 | 3300042590 | Ga0466690_150289 | Ga0466690_150289_20455_20919 | 154 |
| 40 | 3300042599 | Ga0466706_013314 | Ga0466706_013314_32231_32695 | 154 |
| 41 | 3300042599 | Ga0466706_050074 | Ga0466706_050074_2097_2561 | 154 |
| 42 | 3300042599 | Ga0466706_064281 | Ga0466706_064281_1980_2444 | 154 |
| 43 | 3300042599 | Ga0466706_153835 | Ga0466706_153835_703_1167 | 154 |
| 44 | 3300042599 | Ga0466706_195965 | Ga0466706_195965_173_637 | 154 |
| 45 | 3300042599 | Ga0466706_259531 | Ga0466706_259531_13286_13750 | 154 |
| 46 | 3300042599 | Ga0466706_265429 | Ga0466706_265429_312_776 | 154 |
| 47 | 3300042611 | Ga0466697_201058 | Ga0466697_201058_1479_1943 | 154 |
| 48 | 3300042624 | Ga0466735_178990 | Ga0466735_178990_597_1061 | 154 |
| 49 | iso_pr_bacteria | 2922326829 | 2922327593 | 154 |
| 50 | iso_pr_bacteria | 3004667792 | 3004667973 | 154 |
| 51 | iso_pr_bacteria | 3004672520 | 3004672756 | 154 |
| 52 | iso_pr_bacteria | 3004677695 | 3004678145 | 154 |
| 53 | 3300005083 | Ga0068305_10001726 | Ga0068305_100017261 | 155 |
| 54 | 3300042550 | Ga0466656_238755 | Ga0466656_238755_985_1452 | 155 |
| 55 | 3300042590 | Ga0466690_305294 | Ga0466690_305294_5659_6126 | 155 |
| 56 | 3300042590 | Ga0466690_389175 | Ga0466690_389175_12069_12536 | 155 |
| 57 | 3300042590 | Ga0466690_402356 | Ga0466690_402356_57258_57725 | 155 |
| 58 | 3300042592 | Ga0466693_277047 | Ga0466693_277047_760_1227 | 155 |
| 59 | 3300042593 | Ga0466691_118162 | Ga0466691_118162_592_1059 | 155 |
| 60 | 3300042596 | Ga0466696_215903 | Ga0466696_215903_188_655 | 155 |
| 61 | 3300042599 | Ga0466706_095663 | Ga0466706_095663_47491_47958 | 155 |
| 62 | 3300042601 | Ga0466707_121528 | Ga0466707_121528_1267_1734 | 155 |
| 63 | 3300042602 | Ga0466713_137499 | Ga0466713_137499_26311_26778 | 155 |
| 64 | 3300042605 | Ga0466716_025191 | Ga0466716_025191_9619_10086 | 155 |
| 65 | 3300042605 | Ga0466716_484837 | Ga0466716_484837_12907_13374 | 155 |
| 66 | 3300042605 | Ga0466716_485727 | Ga0466716_485727_5898_6365 | 155 |
| 67 | 3300042606 | Ga0466719_119717 | Ga0466719_119717_8246_8713 | 155 |
| 68 | 3300042609 | Ga0466722_139050 | Ga0466722_139050_452_919 | 155 |
| 69 | 3300042612 | Ga0466705_019476 | Ga0466705_019476_15305_15772 | 155 |
| 70 | 3300042612 | Ga0466705_077990 | Ga0466705_077990_7665_8132 | 155 |
| 71 | 3300042612 | Ga0466705_399685 | Ga0466705_399685_1244_1711 | 155 |
| 72 | 3300042615 | Ga0466711_009877 | Ga0466711_009877_11451_11918 | 155 |
| 73 | 3300042615 | Ga0466711_218034 | Ga0466711_218034_2548_3015 | 155 |
| 74 | 3300042615 | Ga0466711_265420 | Ga0466711_265420_365_832 | 155 |
| 75 | 3300042615 | Ga0466711_285989 | Ga0466711_285989_4854_5321 | 155 |
| 76 | 3300042615 | Ga0466711_398384 | Ga0466711_398384_10626_11093 | 155 |
| 77 | 3300042616 | Ga0466715_106265 | Ga0466715_106265_1504_1971 | 155 |
| 78 | 3300042616 | Ga0466715_204293 | Ga0466715_204293_1308_1775 | 155 |
| 79 | 3300042616 | Ga0466715_376227 | Ga0466715_376227_40772_41239 | 155 |
| 80 | 3300042618 | Ga0466723_354948 | Ga0466723_354948_8929_9396 | 155 |
| 81 | 3300042619 | Ga0466726_048838 | Ga0466726_048838_873_1340 | 155 |
| 82 | 3300042620 | Ga0466728_082650 | Ga0466728_082650_9503_9970 | 155 |
| 83 | 3300042620 | Ga0466728_122860 | Ga0466728_122860_22427_22894 | 155 |
| 84 | 3300042620 | Ga0466728_180564 | Ga0466728_180564_87991_88458 | 155 |
| 85 | 3300042620 | Ga0466728_438356 | Ga0466728_438356_26028_26495 | 155 |
| 86 | 3300042636 | Ga0466703_209026 | Ga0466703_209026_8170_8637 | 155 |
| 87 | 3300042636 | Ga0466703_237479 | Ga0466703_237479_13216_13683 | 155 |
| 88 | 3300042643 | Ga0466704_046663 | Ga0466704_046663_824_1291 | 155 |
| 89 | 3300042643 | Ga0466704_095285 | Ga0466704_095285_1447_1914 | 155 |
| 90 | 3300042643 | Ga0466704_157382 | Ga0466704_157382_1728_2195 | 155 |
| 91 | 3300042643 | Ga0466704_247905 | Ga0466704_247905_22222_22689 | 155 |
| 92 | 3300042643 | Ga0466704_393392 | Ga0466704_393392_189_656 | 155 |
| 93 | 3300042643 | Ga0466704_438870 | Ga0466704_438870_17392_17859 | 155 |
| 94 | 3300042643 | Ga0466704_461780 | Ga0466704_461780_5926_6393 | 155 |
| 95 | 3300042643 | Ga0466704_533188 | Ga0466704_533188_10143_10610 | 155 |
| 96 | 3300042652 | Ga0466708_066300 | Ga0466708_066300_29605_30072 | 155 |
| 97 | 3300042652 | Ga0466708_372311 | Ga0466708_372311_5538_6005 | 155 |
| 98 | 3300042655 | Ga0466727_040337 | Ga0466727_040337_7851_8318 | 155 |
| 99 | 3300042655 | Ga0466727_070045 | Ga0466727_070045_658_1125 | 155 |
| 100 | 3300042655 | Ga0466727_179059 | Ga0466727_179059_525_992 | 155 |
| 101 | 3300042659 | Ga0466733_184071 | Ga0466733_184071_25979_26446 | 155 |
| 102 | iso_pr_bacteria | 2940195863 | 2940196481 | 155 |
| 103 | iso_pr_bacteria | 2940199050 | 2940202095 | 155 |
| 104 | iso_pr_bacteria | 2940202316 | 2940204305 | 155 |
| 105 | iso_pr_bacteria | 2940205530 | 2940206058 | 155 |
| 106 | iso_pr_bacteria | 2940209341 | 2940212106 | 155 |
| 107 | iso_pr_bacteria | 2940212447 | 2940212973 | 155 |
| 108 | iso_pr_bacteria | 2940298504 | 2940299030 | 155 |
| 109 | iso_pr_bacteria | 2940302308 | 2940302898 | 155 |
| 110 | iso_pr_bacteria | 2940306115 | 2940306306 | 155 |
| 111 | iso_pr_bacteria | 2940309933 | 2940310061 | 155 |
| 112 | iso_pr_bacteria | 2940313741 | 2940313870 | 155 |
| 113 | iso_pr_bacteria | 2940317558 | 2940317749 | 155 |
| 114 | iso_pr_bacteria | 2940321370 | 2940321499 | 155 |
| 115 | iso_pr_bacteria | 2940325180 | 2940325770 | 155 |
| 116 | iso_pr_bacteria | 2940328985 | 2940329576 | 155 |
| 117 | iso_pr_bacteria | 2940332795 | 2940332986 | 155 |
| 118 | iso_pr_bacteria | 2940346213 | 2940348802 | 155 |
| 119 | 3300002834 | JGI24696J40584_12958633 | JGI24696J40584_129586335 | 156 |
| 120 | 3300005071 | Ga0068302_10120824 | Ga0068302_101208242 | 156 |
| 121 | 3300005083 | Ga0068305_10005585 | Ga0068305_1000558532 | 156 |
| 122 | 3300005083 | Ga0068305_10015112 | Ga0068305_100151124 | 156 |
| 123 | 3300010167 | Ga0123353_11391237 | Ga0123353_113912372 | 156 |
| 124 | 3300042550 | Ga0466656_224030 | Ga0466656_224030_3264_3734 | 156 |
| 125 | 3300042590 | Ga0466690_039968 | Ga0466690_039968_7913_8383 | 156 |
| 126 | 3300042590 | Ga0466690_416236 | Ga0466690_416236_1229_1699 | 156 |
| 127 | 3300042590 | Ga0466690_425264 | Ga0466690_425264_11914_12384 | 156 |
| 128 | 3300042596 | Ga0466696_014642 | Ga0466696_014642_4179_4649 | 156 |
| 129 | 3300042596 | Ga0466696_052384 | Ga0466696_052384_1354_1824 | 156 |
| 130 | 3300042596 | Ga0466696_061891 | Ga0466696_061891_806_1276 | 156 |
| 131 | 3300042596 | Ga0466696_123817 | Ga0466696_123817_1482_1952 | 156 |
| 132 | 3300042599 | Ga0466706_103796 | Ga0466706_103796_12427_12897 | 156 |
| 133 | 3300042601 | Ga0466707_409501 | Ga0466707_409501_119_589 | 156 |
| 134 | 3300042602 | Ga0466713_037887 | Ga0466713_037887_27650_28120 | 156 |
| 135 | 3300042602 | Ga0466713_077495 | Ga0466713_077495_22496_22966 | 156 |
| 136 | 3300042602 | Ga0466713_084099 | Ga0466713_084099_787_1257 | 156 |
| 137 | 3300042605 | Ga0466716_059727 | Ga0466716_059727_1635_2105 | 156 |
| 138 | 3300042606 | Ga0466719_068358 | Ga0466719_068358_2458_2928 | 156 |
| 139 | 3300042609 | Ga0466722_156135 | Ga0466722_156135_113_583 | 156 |
| 140 | 3300042612 | Ga0466705_128961 | Ga0466705_128961_733_1203 | 156 |
| 141 | 3300042612 | Ga0466705_490633 | Ga0466705_490633_2329_2799 | 156 |
| 142 | 3300042618 | Ga0466723_217618 | Ga0466723_217618_1727_2197 | 156 |
| 143 | 3300042619 | Ga0466726_005153 | Ga0466726_005153_5354_5824 | 156 |
| 144 | 3300042620 | Ga0466728_018673 | Ga0466728_018673_20388_20858 | 156 |
| 145 | 3300042624 | Ga0466735_235509 | Ga0466735_235509_156_626 | 156 |
| 146 | 3300042636 | Ga0466703_001595 | Ga0466703_001595_1293_1763 | 156 |
| 147 | 3300042636 | Ga0466703_202519 | Ga0466703_202519_8253_8723 | 156 |
| 148 | 3300042643 | Ga0466704_043621 | Ga0466704_043621_7959_8429 | 156 |
| 149 | 3300042643 | Ga0466704_054809 | Ga0466704_054809_6004_6474 | 156 |
| 150 | 3300042643 | Ga0466704_080074 | Ga0466704_080074_6400_6870 | 156 |
| 151 | 3300042643 | Ga0466704_287104 | Ga0466704_287104_1286_1756 | 156 |
| 152 | 3300042648 | Ga0466709_101953 | Ga0466709_101953_13046_13516 | 156 |
| 153 | 3300042648 | Ga0466709_204908 | Ga0466709_204908_1080_1550 | 156 |
| 154 | 3300042648 | Ga0466709_285899 | Ga0466709_285899_4425_4895 | 156 |
| 155 | 3300042655 | Ga0466727_068059 | Ga0466727_068059_3175_3645 | 156 |
| 156 | 3300042655 | Ga0466727_165399 | Ga0466727_165399_880_1350 | 156 |
| 157 | 3300042655 | Ga0466727_188438 | Ga0466727_188438_1887_2357 | 156 |
| 158 | 2225789004 | 2227180794 | 2227598460 | 157 |
| 159 | 2225789004 | 2227481040 | 2227941498 | 157 |
| 160 | 3300002462 | JGI24702J35022_10000840 | JGI24702J35022_1000084031 | 157 |
| 161 | 3300002462 | JGI24702J35022_10111432 | JGI24702J35022_101114323 | 157 |
| 162 | 3300005071 | Ga0068302_10055682 | Ga0068302_100556824 | 157 |
| 163 | 3300005083 | Ga0068305_10017836 | Ga0068305_100178365 | 157 |
| 164 | 3300005083 | Ga0068305_10029560 | Ga0068305_100295601 | 157 |
| 165 | 3300042593 | Ga0466691_127886 | Ga0466691_127886_10395_10868 | 157 |
| 166 | 3300042596 | Ga0466696_022332 | Ga0466696_022332_868_1341 | 157 |
| 167 | 3300042599 | Ga0466706_232032 | Ga0466706_232032_10806_11279 | 157 |
| 168 | 3300042620 | Ga0466728_107128 | Ga0466728_107128_38554_39027 | 157 |
| 169 | 3300042624 | Ga0466735_064671 | Ga0466735_064671_22439_22912 | 157 |
| 170 | 3300042636 | Ga0466703_019525 | Ga0466703_019525_13098_13571 | 157 |
| 171 | 3300042659 | Ga0466733_002151 | Ga0466733_002151_33861_34334 | 157 |
| 172 | iso_pr_bacteria | 2923982719 | 2923982880 | 157 |
| 173 | iso_pr_bacteria | 2940371297 | 2940372915 | 157 |
| 174 | 2225789004 | 2227546306 | 2228072098 | 158 |
| 175 | 3300000062 | IMNBL1DRAFT_c0000677 | IMNBL1DRAFT_000067713 | 158 |
| 176 | 3300000062 | IMNBL1DRAFT_c0030229 | IMNBL1DRAFT_00302292 | 158 |
| 177 | 3300000062 | IMNBL1DRAFT_c0052490 | IMNBL1DRAFT_00524902 | 158 |
| 178 | 3300042593 | Ga0466691_045847 | Ga0466691_045847_9286_9762 | 158 |
| 179 | 3300042659 | Ga0466733_048728 | Ga0466733_048728_16258_16734 | 158 |
| 180 | 3300042599 | Ga0466706_037096 | Ga0466706_037096_326_805 | 159 |
| 181 | 3300042602 | Ga0466713_047540 | Ga0466713_047540_13474_13953 | 159 |
| 182 | 3300002462 | JGI24702J35022_10763393 | JGI24702J35022_107633931 | 160 |
| 183 | 3300005083 | Ga0068305_10212060 | Ga0068305_102120604 | 160 |
| 184 | 3300042618 | Ga0466723_093881 | Ga0466723_093881_20270_20767 | 165 |
| 185 | 3300002462 | JGI24702J35022_10448563 | JGI24702J35022_104485631 | 172 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02472 | ExbD | Biopolymer transport protein ExbD/TolR | 22 | 160 | 0.78 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.57 | 0.76 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.