Protein Family IF00825
Metagenome
128
Members
47
Samples
128
Scaffolds
206.73
Avg Length
Representative Sequence
- ID
- 3300002462|JGI24702J35022_10390795|JGI24702J35022_103907951
- Length
- 234 aa
- Sequence
- LSKKNEIKPWLQEQWCIPKPSAEFVERMEDVLEIYKLPYDMLRPVVCLDETNRQLIGEVNTPIPMSAGRPRIYDYEYKRNGVADIFMMFEPLAARRFTKVTDTRTKIDFAYCLRDLSDKYYPHAEKIILVMDNLNTHNLASLYEAFVPDEARRISERFDIHFTPKHGSWLNMAEIEIGVMSRQCLKHRIATKDEMAYQVKAWTCTRNAANLSVDWQFTTDDARIKLKHLYPKF*
Sample Types
Isolate
0.0%
Metagenome
100.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
64.4%
Kalotermitidae
24.4%
Rhinotermitidae
4.4%
Termopsidae
4.4%
Passalidae
2.2%
Taxonomy
Archaea
0
Bacteria
115
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 5 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 6 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 7 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 8 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 9 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 10 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 11 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 12 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 13 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 14 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 15 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 19 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 20 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 21 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 22 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 23 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 24 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 25 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 26 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 27 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 28 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 29 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 30 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 31 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 32 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 33 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 34 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 35 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 36 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 37 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 38 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 39 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 40 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 41 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 42 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 43 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 44 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 45 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 46 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 47 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466731_190648 | 3300042622 | Bacteria | 1391 |
| 2 | Ga0466731_368715 | 3300042622 | Bacteria | 1607 |
| 3 | Ga0466712_268270 | 3300042614 | Bacteria | 1373 |
| 4 | Ga0466715_494946 | 3300042616 | Bacteria | 5281 |
| 5 | Ga0466723_079501 | 3300042618 | Bacteria | 1460 |
| 6 | Ga0466691_217405 | 3300042593 | Bacteria | 1304 |
| 7 | Ga0466694_192949 | 3300042594 | Bacteria | 3156 |
| 8 | Ga0466696_195144 | 3300042596 | Bacteria | 2914 |
| 9 | Ga0466701_081647 | 3300042598 | Bacteria | 1439 |
| 10 | Ga0466700_101431 | 3300042600 | Bacteria | 1422 |
| 11 | Ga0466716_533313 | 3300042605 | Bacteria | 1737 |
| 12 | 2227255521 | 2225789004 | Bacteria | 1309 |
| 13 | JGI24698J34947_10082306 | 3300002449 | Unclassified | 1505 |
| 14 | JGI24695J34938_10069421 | 3300002450 | Unclassified | 1477 |
| 15 | JGI24695J34938_10116290 | 3300002450 | Bacteria | 1089 |
| 16 | JGI24702J35022_10052131 | 3300002462 | Bacteria | 2180 |
| 17 | Ga0072941_1008955 | 3300005201 | Unclassified | 979 |
| 18 | Ga0123356_10245827 | 3300010049 | Bacteria | 1863 |
| 19 | Ga0123353_10000256 | 3300010167 | Bacteria | 67179 |
| 20 | Ga0466733_200531 | 3300042659 | Bacteria | 1110 |
| 21 | Ga0466731_058990 | 3300042622 | Bacteria | 1383 |
| 22 | Ga0466709_392023 | 3300042648 | Unclassified | 1529 |
| 23 | Ga0466715_446326 | 3300042616 | Bacteria | 1590 |
| 24 | Ga0466723_031090 | 3300042618 | Bacteria | 2121 |
| 25 | Ga0415639_205700 | 3300038395 | Bacteria | 1722 |
| 26 | Ga0466690_253471 | 3300042590 | Bacteria | 1802 |
| 27 | Ga0466699_416462 | 3300042597 | Bacteria | 1564 |
| 28 | Ga0466716_322466 | 3300042605 | Bacteria | 2201 |
| 29 | 2227555210 | 2225789004 | Bacteria | 2796 |
| 30 | JGI24702J35022_10178570 | 3300002462 | Bacteria | 1205 |
| 31 | JGI24702J35022_10390795 | 3300002462 | Bacteria | 838 |
| 32 | Ga0123353_10632122 | 3300010167 | Bacteria | 1521 |
| 33 | Ga0123354_10350285 | 3300010882 | Bacteria | 1317 |
| 34 | Ga0466731_041127 | 3300042622 | Bacteria | 1515 |
| 35 | Ga0466731_224975 | 3300042622 | Bacteria | 1687 |
| 36 | Ga0466715_153694 | 3300042616 | Bacteria | 1874 |
| 37 | Ga0466693_280416 | 3300042592 | Bacteria | 1458 |
| 38 | Ga0466696_166193 | 3300042596 | Bacteria | 1527 |
| 39 | Ga0466714_080315 | 3300042603 | Bacteria | 1727 |
| 40 | Ga0466716_526982 | 3300042605 | Bacteria | 1864 |
| 41 | Ga0466698_360752 | 3300042610 | Unclassified | 1611 |
| 42 | Ga0123355_10517609 | 3300009826 | Bacteria | 1462 |
| 43 | Ga0123355_10668573 | 3300009826 | Bacteria | 1205 |
| 44 | Ga0123353_10547657 | 3300010167 | Bacteria | 1670 |
| 45 | Ga0123354_10506876 | 3300010882 | Bacteria | 937 |
| 46 | Ga0466705_251408 | 3300042612 | Bacteria | 1433 |
| 47 | Ga0466703_059418 | 3300042636 | Bacteria | 2855 |
| 48 | Ga0466725_174306 | 3300042654 | Bacteria | 1496 |
| 49 | Ga0466725_406595 | 3300042654 | Bacteria | 1581 |
| 50 | Ga0466705_503254 | 3300042612 | Bacteria | 1509 |
| 51 | Ga0466710_452617 | 3300042613 | Bacteria | 2449 |
| 52 | Ga0466715_264433 | 3300042616 | Bacteria | 2104 |
| 53 | Ga0466715_305055 | 3300042616 | Bacteria | 1218 |
| 54 | Ga0466715_580593 | 3300042616 | Bacteria | 7290 |
| 55 | Ga0466729_011823 | 3300042621 | Bacteria | 2441 |
| 56 | Ga0466691_141601 | 3300042593 | Bacteria | 2670 |
| 57 | Ga0466694_060692 | 3300042594 | Bacteria | 1247 |
| 58 | Ga0466695_111347 | 3300042595 | Bacteria | 1031 |
| 59 | Ga0466696_340281 | 3300042596 | Bacteria | 2652 |
| 60 | Ga0466700_153638 | 3300042600 | Bacteria | 1292 |
| 61 | Ga0466698_008271 | 3300042610 | Bacteria | 1707 |
| 62 | JGI24698J34947_10065053 | 3300002449 | Bacteria | 1779 |
| 63 | JGI24696J40584_12909232 | 3300002834 | Bacteria | 1242 |
| 64 | Ga0123355_10197461 | 3300009826 | Bacteria | 2947 |
| 65 | Ga0123356_10072331 | 3300010049 | Bacteria | 3239 |
| 66 | Ga0123356_10313964 | 3300010049 | Bacteria | 1678 |
| 67 | Ga0466731_082106 | 3300042622 | Bacteria | 1382 |
| 68 | Ga0466734_039278 | 3300042623 | Bacteria | 1319 |
| 69 | Ga0466704_443500 | 3300042643 | Unclassified | 1461 |
| 70 | Ga0466708_307688 | 3300042652 | Bacteria | 1741 |
| 71 | Ga0466710_403333 | 3300042613 | Bacteria | 1190 |
| 72 | Ga0466715_039090 | 3300042616 | Bacteria | 12186 |
| 73 | Ga0466715_316707 | 3300042616 | Bacteria | 1321 |
| 74 | Ga0466718_106635 | 3300042617 | Bacteria | 3703 |
| 75 | Ga0265387_1010598 | 3300024582 | Unclassified | 1256 |
| 76 | Ga0466656_173581 | 3300042550 | Bacteria | 1189 |
| 77 | Ga0466692_034394 | 3300042591 | Unclassified | 1087 |
| 78 | Ga0466696_360609 | 3300042596 | Bacteria | 3017 |
| 79 | Ga0466699_215379 | 3300042597 | Bacteria | 1380 |
| 80 | JGI24702J35022_10113577 | 3300002462 | Unclassified | 1491 |
| 81 | Ga0123353_11281580 | 3300010167 | Bacteria | 953 |
| 82 | Ga0123354_10521685 | 3300010882 | Bacteria | 912 |
| 83 | Ga0466705_054646 | 3300042612 | Bacteria | 1219 |
| 84 | Ga0466705_272978 | 3300042612 | Bacteria | 5633 |
| 85 | Ga0466734_126040 | 3300042623 | Bacteria | 1437 |
| 86 | Ga0466715_146556 | 3300042616 | Bacteria | 2161 |
| 87 | Ga0466715_262848 | 3300042616 | Bacteria | 1743 |
| 88 | Ga0466726_449384 | 3300042619 | Bacteria | 2353 |
| 89 | Ga0466690_391881 | 3300042590 | Bacteria | 2368 |
| 90 | Ga0466694_180197 | 3300042594 | Bacteria | 2436 |
| 91 | Ga0466701_072544 | 3300042598 | Bacteria | 2241 |
| 92 | Ga0466714_125472 | 3300042603 | Unclassified | 2247 |
| 93 | Ga0466716_022327 | 3300042605 | Bacteria | 1445 |
| 94 | Ga0466716_447391 | 3300042605 | Bacteria | 4095 |
| 95 | JGI24698J34947_10038967 | 3300002449 | Bacteria | 2463 |
| 96 | JGI24703J35330_11564532 | 3300002501 | Bacteria | 1262 |
| 97 | Ga0123356_10133116 | 3300010049 | Bacteria | 2439 |
| 98 | Ga0123356_10204687 | 3300010049 | Bacteria | 2017 |
| 99 | Ga0123356_10377407 | 3300010049 | Bacteria | 1549 |
| 100 | Ga0123356_10501196 | 3300010049 | Bacteria | 1370 |
| 101 | Ga0123356_11473244 | 3300010049 | Bacteria | 839 |
| 102 | Ga0123353_10338381 | 3300010167 | Bacteria | 2274 |
| 103 | Ga0123353_10740500 | 3300010167 | Bacteria | 1370 |
| 104 | Ga0466702_014285 | 3300042635 | Bacteria | 1826 |
| 105 | Ga0466703_337065 | 3300042636 | Bacteria | 1332 |
| 106 | Ga0466725_012893 | 3300042654 | Bacteria | 1906 |
| 107 | Ga0466715_090489 | 3300042616 | Bacteria | 1223 |
| 108 | Ga0466726_405558 | 3300042619 | Bacteria | 2174 |
| 109 | Ga0466691_027145 | 3300042593 | Unclassified | 2218 |
| 110 | JGI24702J35022_10173401 | 3300002462 | Bacteria | 1221 |
| 111 | Ga0072941_1128654 | 3300005201 | Bacteria | 1315 |
| 112 | Ga0123356_10003913 | 3300010049 | Bacteria | 15506 |
| 113 | Ga0123356_10013670 | 3300010049 | Unclassified | 7821 |
| 114 | Ga0123356_10432119 | 3300010049 | Bacteria | 1461 |
| 115 | Ga0466705_265299 | 3300042612 | Bacteria | 1216 |
| 116 | Ga0466704_036694 | 3300042643 | Bacteria | 2085 |
| 117 | Ga0466709_107216 | 3300042648 | Bacteria | 1219 |
| 118 | Ga0466709_407011 | 3300042648 | Bacteria | 2059 |
| 119 | Ga0466708_006816 | 3300042652 | Bacteria | 4514 |
| 120 | Ga0466708_383719 | 3300042652 | Unclassified | 1203 |
| 121 | Ga0466715_237828 | 3300042616 | Bacteria | 20065 |
| 122 | Ga0466657_032811 | 3300042582 | Bacteria | 1407 |
| 123 | Ga0466717_147312 | 3300042604 | Bacteria | 1343 |
| 124 | Ga0466717_222847 | 3300042604 | Bacteria | 1293 |
| 125 | Ga0466698_015630 | 3300042610 | Bacteria | 1355 |
| 126 | JGI24695J34938_10086471 | 3300002450 | Bacteria | 1290 |
| 127 | Ga0068302_10327371 | 3300005071 | Bacteria | 908 |
| 128 | Ga0123353_10500977 | 3300010167 | Bacteria | 1770 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042618 | Ga0466723_031090 | Ga0466723_031090_978_1535 | 185 |
| 2 | 3300042594 | Ga0466694_060692 | Ga0466694_060692_660_1226 | 188 |
| 3 | 3300042610 | Ga0466698_008271 | Ga0466698_008271_388_954 | 188 |
| 4 | 3300005201 | Ga0072941_1128654 | Ga0072941_11286541 | 198 |
| 5 | 3300005201 | Ga0072941_1008955 | Ga0072941_10089552 | 199 |
| 6 | 3300009826 | Ga0123355_10517609 | Ga0123355_105176092 | 201 |
| 7 | 3300024582 | Ga0265387_1010598 | Ga0265387_10105983 | 204 |
| 8 | 3300042603 | Ga0466714_080315 | Ga0466714_080315_577_1191 | 204 |
| 9 | 3300042603 | Ga0466714_125472 | Ga0466714_125472_1520_2134 | 204 |
| 10 | 3300042605 | Ga0466716_447391 | Ga0466716_447391_3019_3633 | 204 |
| 11 | 3300042616 | Ga0466715_153694 | Ga0466715_153694_734_1348 | 204 |
| 12 | 2225789004 | 2227255521 | 2227699982 | 206 |
| 13 | 2225789004 | 2227555210 | 2228088019 | 206 |
| 14 | 3300038395 | Ga0415639_205700 | Ga0415639_205700_52_672 | 206 |
| 15 | 3300042582 | Ga0466657_032811 | Ga0466657_032811_690_1310 | 206 |
| 16 | 3300042590 | Ga0466690_253471 | Ga0466690_253471_910_1530 | 206 |
| 17 | 3300042590 | Ga0466690_391881 | Ga0466690_391881_755_1375 | 206 |
| 18 | 3300042591 | Ga0466692_034394 | Ga0466692_034394_103_723 | 206 |
| 19 | 3300042592 | Ga0466693_280416 | Ga0466693_280416_137_757 | 206 |
| 20 | 3300042593 | Ga0466691_027145 | Ga0466691_027145_727_1347 | 206 |
| 21 | 3300042593 | Ga0466691_217405 | Ga0466691_217405_588_1208 | 206 |
| 22 | 3300042594 | Ga0466694_180197 | Ga0466694_180197_724_1344 | 206 |
| 23 | 3300042594 | Ga0466694_192949 | Ga0466694_192949_1238_1858 | 206 |
| 24 | 3300042595 | Ga0466695_111347 | Ga0466695_111347_130_750 | 206 |
| 25 | 3300042596 | Ga0466696_166193 | Ga0466696_166193_708_1328 | 206 |
| 26 | 3300042596 | Ga0466696_195144 | Ga0466696_195144_2005_2625 | 206 |
| 27 | 3300042596 | Ga0466696_340281 | Ga0466696_340281_323_943 | 206 |
| 28 | 3300042596 | Ga0466696_360609 | Ga0466696_360609_654_1274 | 206 |
| 29 | 3300042597 | Ga0466699_215379 | Ga0466699_215379_565_1185 | 206 |
| 30 | 3300042597 | Ga0466699_416462 | Ga0466699_416462_182_802 | 206 |
| 31 | 3300042598 | Ga0466701_072544 | Ga0466701_072544_265_885 | 206 |
| 32 | 3300042598 | Ga0466701_081647 | Ga0466701_081647_664_1284 | 206 |
| 33 | 3300042600 | Ga0466700_101431 | Ga0466700_101431_785_1405 | 206 |
| 34 | 3300042600 | Ga0466700_153638 | Ga0466700_153638_626_1246 | 206 |
| 35 | 3300042604 | Ga0466717_147312 | Ga0466717_147312_18_638 | 206 |
| 36 | 3300042604 | Ga0466717_222847 | Ga0466717_222847_628_1248 | 206 |
| 37 | 3300042605 | Ga0466716_022327 | Ga0466716_022327_727_1347 | 206 |
| 38 | 3300042605 | Ga0466716_322466 | Ga0466716_322466_887_1507 | 206 |
| 39 | 3300042605 | Ga0466716_526982 | Ga0466716_526982_499_1119 | 206 |
| 40 | 3300042605 | Ga0466716_533313 | Ga0466716_533313_464_1084 | 206 |
| 41 | 3300042610 | Ga0466698_015630 | Ga0466698_015630_615_1235 | 206 |
| 42 | 3300042612 | Ga0466705_054646 | Ga0466705_054646_20_640 | 206 |
| 43 | 3300042612 | Ga0466705_251408 | Ga0466705_251408_376_996 | 206 |
| 44 | 3300042612 | Ga0466705_265299 | Ga0466705_265299_579_1199 | 206 |
| 45 | 3300042612 | Ga0466705_503254 | Ga0466705_503254_248_868 | 206 |
| 46 | 3300042614 | Ga0466712_268270 | Ga0466712_268270_681_1301 | 206 |
| 47 | 3300042616 | Ga0466715_039090 | Ga0466715_039090_11437_12057 | 206 |
| 48 | 3300042616 | Ga0466715_090489 | Ga0466715_090489_206_826 | 206 |
| 49 | 3300042616 | Ga0466715_146556 | Ga0466715_146556_1039_1659 | 206 |
| 50 | 3300042616 | Ga0466715_237828 | Ga0466715_237828_265_885 | 206 |
| 51 | 3300042616 | Ga0466715_262848 | Ga0466715_262848_778_1398 | 206 |
| 52 | 3300042616 | Ga0466715_264433 | Ga0466715_264433_1464_2084 | 206 |
| 53 | 3300042616 | Ga0466715_305055 | Ga0466715_305055_580_1200 | 206 |
| 54 | 3300042616 | Ga0466715_316707 | Ga0466715_316707_646_1266 | 206 |
| 55 | 3300042616 | Ga0466715_446326 | Ga0466715_446326_286_906 | 206 |
| 56 | 3300042616 | Ga0466715_494946 | Ga0466715_494946_267_887 | 206 |
| 57 | 3300042617 | Ga0466718_106635 | Ga0466718_106635_1636_2256 | 206 |
| 58 | 3300042618 | Ga0466723_079501 | Ga0466723_079501_298_918 | 206 |
| 59 | 3300042619 | Ga0466726_449384 | Ga0466726_449384_205_825 | 206 |
| 60 | 3300042621 | Ga0466729_011823 | Ga0466729_011823_1532_2152 | 206 |
| 61 | 3300042622 | Ga0466731_041127 | Ga0466731_041127_876_1496 | 206 |
| 62 | 3300042622 | Ga0466731_058990 | Ga0466731_058990_632_1252 | 206 |
| 63 | 3300042622 | Ga0466731_082106 | Ga0466731_082106_672_1292 | 206 |
| 64 | 3300042622 | Ga0466731_190648 | Ga0466731_190648_173_793 | 206 |
| 65 | 3300042622 | Ga0466731_224975 | Ga0466731_224975_1005_1625 | 206 |
| 66 | 3300042622 | Ga0466731_368715 | Ga0466731_368715_134_754 | 206 |
| 67 | 3300042623 | Ga0466734_039278 | Ga0466734_039278_45_665 | 206 |
| 68 | 3300042623 | Ga0466734_126040 | Ga0466734_126040_139_759 | 206 |
| 69 | 3300042635 | Ga0466702_014285 | Ga0466702_014285_945_1565 | 206 |
| 70 | 3300042636 | Ga0466703_337065 | Ga0466703_337065_18_638 | 206 |
| 71 | 3300042643 | Ga0466704_036694 | Ga0466704_036694_1103_1723 | 206 |
| 72 | 3300042643 | Ga0466704_443500 | Ga0466704_443500_712_1332 | 206 |
| 73 | 3300042648 | Ga0466709_107216 | Ga0466709_107216_19_639 | 206 |
| 74 | 3300042648 | Ga0466709_392023 | Ga0466709_392023_773_1393 | 206 |
| 75 | 3300042648 | Ga0466709_407011 | Ga0466709_407011_1246_1866 | 206 |
| 76 | 3300042652 | Ga0466708_006816 | Ga0466708_006816_937_1557 | 206 |
| 77 | 3300042652 | Ga0466708_307688 | Ga0466708_307688_425_1045 | 206 |
| 78 | 3300042652 | Ga0466708_383719 | Ga0466708_383719_311_931 | 206 |
| 79 | 3300042654 | Ga0466725_174306 | Ga0466725_174306_140_760 | 206 |
| 80 | 3300042654 | Ga0466725_406595 | Ga0466725_406595_133_753 | 206 |
| 81 | 3300042659 | Ga0466733_200531 | Ga0466733_200531_48_668 | 206 |
| 82 | 3300002449 | JGI24698J34947_10038967 | JGI24698J34947_100389672 | 207 |
| 83 | 3300002449 | JGI24698J34947_10065053 | JGI24698J34947_100650532 | 207 |
| 84 | 3300002449 | JGI24698J34947_10082306 | JGI24698J34947_100823062 | 207 |
| 85 | 3300002450 | JGI24695J34938_10069421 | JGI24695J34938_100694212 | 207 |
| 86 | 3300002450 | JGI24695J34938_10086471 | JGI24695J34938_100864712 | 207 |
| 87 | 3300002450 | JGI24695J34938_10116290 | JGI24695J34938_101162901 | 207 |
| 88 | 3300002462 | JGI24702J35022_10052131 | JGI24702J35022_100521311 | 207 |
| 89 | 3300002462 | JGI24702J35022_10113577 | JGI24702J35022_101135772 | 207 |
| 90 | 3300002462 | JGI24702J35022_10178570 | JGI24702J35022_101785702 | 207 |
| 91 | 3300002834 | JGI24696J40584_12909232 | JGI24696J40584_129092321 | 207 |
| 92 | 3300005071 | Ga0068302_10327371 | Ga0068302_103273711 | 207 |
| 93 | 3300009826 | Ga0123355_10197461 | Ga0123355_101974612 | 207 |
| 94 | 3300009826 | Ga0123355_10668573 | Ga0123355_106685732 | 207 |
| 95 | 3300010049 | Ga0123356_10003913 | Ga0123356_1000391314 | 207 |
| 96 | 3300010049 | Ga0123356_10013670 | Ga0123356_100136704 | 207 |
| 97 | 3300010049 | Ga0123356_10204687 | Ga0123356_102046872 | 207 |
| 98 | 3300010049 | Ga0123356_10245827 | Ga0123356_102458273 | 207 |
| 99 | 3300010049 | Ga0123356_10313964 | Ga0123356_103139642 | 207 |
| 100 | 3300010049 | Ga0123356_10377407 | Ga0123356_103774072 | 207 |
| 101 | 3300010049 | Ga0123356_10432119 | Ga0123356_104321192 | 207 |
| 102 | 3300010049 | Ga0123356_10501196 | Ga0123356_105011961 | 207 |
| 103 | 3300010049 | Ga0123356_11473244 | Ga0123356_114732441 | 207 |
| 104 | 3300010167 | Ga0123353_10000256 | Ga0123353_100002567 | 207 |
| 105 | 3300010167 | Ga0123353_10500977 | Ga0123353_105009773 | 207 |
| 106 | 3300010167 | Ga0123353_10547657 | Ga0123353_105476573 | 207 |
| 107 | 3300010167 | Ga0123353_10632122 | Ga0123353_106321221 | 207 |
| 108 | 3300010167 | Ga0123353_10740500 | Ga0123353_107405003 | 207 |
| 109 | 3300010167 | Ga0123353_11281580 | Ga0123353_112815801 | 207 |
| 110 | 3300010882 | Ga0123354_10350285 | Ga0123354_103502851 | 207 |
| 111 | 3300010882 | Ga0123354_10506876 | Ga0123354_105068762 | 207 |
| 112 | 3300010882 | Ga0123354_10521685 | Ga0123354_105216852 | 207 |
| 113 | 3300042613 | Ga0466710_403333 | Ga0466710_403333_445_1068 | 207 |
| 114 | 3300042636 | Ga0466703_059418 | Ga0466703_059418_791_1414 | 207 |
| 115 | 3300010167 | Ga0123353_10338381 | Ga0123353_103383815 | 208 |
| 116 | 3300042654 | Ga0466725_012893 | Ga0466725_012893_1142_1768 | 208 |
| 117 | 3300010049 | Ga0123356_10072331 | Ga0123356_100723313 | 209 |
| 118 | 3300042613 | Ga0466710_452617 | Ga0466710_452617_841_1470 | 209 |
| 119 | 3300010049 | Ga0123356_10133116 | Ga0123356_101331161 | 210 |
| 120 | 3300002462 | JGI24702J35022_10173401 | JGI24702J35022_101734011 | 211 |
| 121 | 3300042619 | Ga0466726_405558 | Ga0466726_405558_1173_1808 | 211 |
| 122 | 3300042593 | Ga0466691_141601 | Ga0466691_141601_1222_1872 | 216 |
| 123 | 3300042550 | Ga0466656_173581 | Ga0466656_173581_102_767 | 221 |
| 124 | 3300042616 | Ga0466715_580593 | Ga0466715_580593_6114_6779 | 221 |
| 125 | 3300042610 | Ga0466698_360752 | Ga0466698_360752_653_1327 | 224 |
| 126 | 3300042612 | Ga0466705_272978 | Ga0466705_272978_4595_5269 | 224 |
| 127 | 3300002501 | JGI24703J35330_11564532 | JGI24703J35330_115645321 | 225 |
| 128 | 3300002462 | JGI24702J35022_10390795 | JGI24702J35022_103907951 | 234 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13358 | DDE_3 | DDE superfamily endonuclease | 44 | 195 | 0.96 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.81 | 0.85 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.