Protein Family IF00822
Metagenome
Isolate
148
Members
52
Samples
144
Scaffolds
208.64
Avg Length
Representative Sequence
- ID
- 3300002462|JGI24702J35022_10170618|JGI24702J35022_101706182
- Length
- 235 aa
- Sequence
- MKISKKTFVAIAVILFILVLDQIIKILVKTNFTLGEDKQITSWFYIRFIENEGMAMGIKVFGKLFLTVFRLVASIAIAYYLYLLIRNNFKLSYIILVSMIFAGAVGNIIDSVFYGVIFSESAYTQVAVLFPEGGGYNGWLHGNVVDMFYFPLFSFNWPSWIPWIGGSNFEFFRYIFNIADSSISVGIVVLLLFFRKTLSLSFEKQEVESXSNRYGCFFDISFHCMQQSSFIYPF*
Sample Types
Isolate
2.7%
Metagenome
97.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
33.3%
Kalotermitidae
27.5%
Unclassified
9.8%
Termopsidae
7.8%
Rhinotermitidae
5.9%
Armadillidiidae
5.9%
Blattidae
3.9%
Passalidae
3.9%
Culicidae
2.0%
Taxonomy
Archaea
0
Bacteria
142
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 2 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 3 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 4 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 5 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 6 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 7 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 8 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 9 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 10 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 11 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 12 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 13 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 14 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 15 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 16 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 17 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 18 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 19 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 20 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 21 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 22 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 23 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 24 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 25 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 26 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 27 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 28 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 29 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 30 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 31 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 32 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 33 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 34 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 35 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 36 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 37 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 38 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 39 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 40 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 41 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 42 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 43 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 44 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 45 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 46 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 47 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 48 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 49 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 50 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 51 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 52 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_093779 | 3300042611 | Bacteria | 1377 |
| 2 | Ga0466697_213337 | 3300042611 | Bacteria | 1862 |
| 3 | Ga0123356_10008036 | 3300010049 | Bacteria | 10500 |
| 4 | Ga0123356_10867752 | 3300010049 | Bacteria | 1074 |
| 5 | Ga0466711_043128 | 3300042615 | Bacteria | 56831 |
| 6 | Ga0466711_174702 | 3300042615 | Bacteria | 14756 |
| 7 | Ga0466690_190597 | 3300042590 | Bacteria | 6928 |
| 8 | Ga0466690_250711 | 3300042590 | Bacteria | 19853 |
| 9 | Ga0466692_114301 | 3300042591 | Bacteria | 28842 |
| 10 | Ga0466691_207003 | 3300042593 | Bacteria | 4291 |
| 11 | Ga0466704_108246 | 3300042643 | Bacteria | 8570 |
| 12 | Ga0466704_205716 | 3300042643 | Unclassified | 5160 |
| 13 | Ga0466727_121775 | 3300042655 | Bacteria | 4232 |
| 14 | Ga0466701_033084 | 3300042598 | Bacteria | 19683 |
| 15 | Ga0466713_082523 | 3300042602 | Bacteria | 11972 |
| 16 | Ga0466714_073904 | 3300042603 | Bacteria | 61298 |
| 17 | Ga0466719_370029 | 3300042606 | Bacteria | 2594 |
| 18 | Ga0466722_065958 | 3300042609 | Bacteria | 2171 |
| 19 | JGI24705J35276_12221365 | 3300002504 | Bacteria | 2335 |
| 20 | JGI24696J40584_12936906 | 3300002834 | Bacteria | 1590 |
| 21 | Ga0068302_10153414 | 3300005071 | Unclassified | 3291 |
| 22 | Ga0466728_275974 | 3300042620 | Bacteria | 7986 |
| 23 | Ga0160445_100325 | 3300012847 | Bacteria | 28697 |
| 24 | Ga0466692_178598 | 3300042591 | Bacteria | 2512 |
| 25 | Ga0466735_060672 | 3300042624 | Bacteria | 1314 |
| 26 | Ga0466727_289011 | 3300042655 | Bacteria | 5317 |
| 27 | Ga0466700_056183 | 3300042600 | Bacteria | 19305 |
| 28 | Ga0466700_228000 | 3300042600 | Bacteria | 2030 |
| 29 | Ga0466707_358553 | 3300042601 | Bacteria | 17333 |
| 30 | Ga0466713_035478 | 3300042602 | Bacteria | 46123 |
| 31 | Ga0466714_026681 | 3300042603 | Bacteria | 1447 |
| 32 | 2227563832 | 2225789004 | Bacteria | 2692 |
| 33 | JGI24702J35022_10002132 | 3300002462 | Bacteria | 12212 |
| 34 | JGI24702J35022_10040936 | 3300002462 | Bacteria | 2471 |
| 35 | JGI24705J35276_12219900 | 3300002504 | Bacteria | 2233 |
| 36 | JGI24699J35502_11134208 | 3300002509 | Bacteria | 58698 |
| 37 | Ga0068302_10382562 | 3300005071 | Bacteria | 1769 |
| 38 | Ga0123356_10830830 | 3300010049 | Bacteria | 1095 |
| 39 | Ga0123354_10004244 | 3300010882 | Bacteria | 20226 |
| 40 | Ga0466715_375411 | 3300042616 | Bacteria | 15689 |
| 41 | Ga0466715_518236 | 3300042616 | Unclassified | 1267 |
| 42 | Ga0466726_006129 | 3300042619 | Bacteria | 11303 |
| 43 | Ga0466690_046892 | 3300042590 | Bacteria | 11669 |
| 44 | Ga0466692_075152 | 3300042591 | Bacteria | 13452 |
| 45 | Ga0466734_037653 | 3300042623 | Bacteria | 2068 |
| 46 | Ga0466709_172128 | 3300042648 | Bacteria | 26267 |
| 47 | Ga0466707_385618 | 3300042601 | Bacteria | 6163 |
| 48 | Ga0466719_188005 | 3300042606 | Bacteria | 4597 |
| 49 | Ga0466719_515918 | 3300042606 | Bacteria | 12958 |
| 50 | Ga0466698_328289 | 3300042610 | Bacteria | 1555 |
| 51 | 2227634353 | 2225789004 | Unclassified | 2100 |
| 52 | JGI24702J35022_10010921 | 3300002462 | Bacteria | 5067 |
| 53 | JGI24699J35502_11134105 | 3300002509 | Bacteria | 31307 |
| 54 | Ga0123357_10051745 | 3300009784 | Bacteria | 5550 |
| 55 | Ga0466715_359091 | 3300042616 | Bacteria | 16012 |
| 56 | Ga0466726_481309 | 3300042619 | Bacteria | 2093 |
| 57 | Ga0466696_374988 | 3300042596 | Bacteria | 2904 |
| 58 | Ga0466729_261605 | 3300042621 | Bacteria | 23426 |
| 59 | Ga0466735_011826 | 3300042624 | Bacteria | 3600 |
| 60 | Ga0466735_066106 | 3300042624 | Bacteria | 1082 |
| 61 | Ga0466735_100631 | 3300042624 | Bacteria | 4241 |
| 62 | Ga0466703_246726 | 3300042636 | Bacteria | 23563 |
| 63 | Ga0466700_256070 | 3300042600 | Bacteria | 1121 |
| 64 | Ga0466707_167694 | 3300042601 | Bacteria | 22180 |
| 65 | Ga0466707_239589 | 3300042601 | Bacteria | 5144 |
| 66 | Ga0466707_240264 | 3300042601 | Bacteria | 18653 |
| 67 | Ga0466713_039611 | 3300042602 | Bacteria | 4717 |
| 68 | Ga0466716_183039 | 3300042605 | Bacteria | 1312 |
| 69 | 2227613510 | 2225789004 | Bacteria | 11995 |
| 70 | IMNBL1DRAFT_c0000159 | 3300000062 | Bacteria | 59691 |
| 71 | Ga0466732_330297 | 3300042656 | Bacteria | 1301 |
| 72 | Ga0123357_10010217 | 3300009784 | Bacteria | 11921 |
| 73 | Ga0123357_10019828 | 3300009784 | Bacteria | 8976 |
| 74 | Ga0123354_10011256 | 3300010882 | Bacteria | 13806 |
| 75 | Ga0123354_10218471 | 3300010882 | Unclassified | 2034 |
| 76 | Ga0466726_046595 | 3300042619 | Bacteria | 30556 |
| 77 | Ga0466726_122689 | 3300042619 | Bacteria | 1506 |
| 78 | Ga0466694_232656 | 3300042594 | Bacteria | 4739 |
| 79 | Ga0466735_065370 | 3300042624 | Bacteria | 13419 |
| 80 | Ga0466735_128070 | 3300042624 | Bacteria | 1866 |
| 81 | Ga0466708_208881 | 3300042652 | Bacteria | 10918 |
| 82 | Ga0466727_085133 | 3300042655 | Bacteria | 23683 |
| 83 | Ga0466727_267134 | 3300042655 | Bacteria | 6610 |
| 84 | Ga0466707_346472 | 3300042601 | Bacteria | 30724 |
| 85 | Ga0466713_003715 | 3300042602 | Bacteria | 18997 |
| 86 | Ga0466716_026639 | 3300042605 | Bacteria | 5692 |
| 87 | Ga0466719_325919 | 3300042606 | Bacteria | 1976 |
| 88 | Ga0466722_082196 | 3300042609 | Bacteria | 3646 |
| 89 | Ga0466697_002421 | 3300042611 | Bacteria | 1863 |
| 90 | IMNBL1DRAFT_c0001537 | 3300000062 | Bacteria | 17207 |
| 91 | Ga0068305_10491341 | 3300005083 | Bacteria | 2060 |
| 92 | Ga0123356_10857096 | 3300010049 | Bacteria | 1080 |
| 93 | Ga0123354_10003206 | 3300010882 | Bacteria | 22421 |
| 94 | Ga0123354_10037503 | 3300010882 | Bacteria | 7544 |
| 95 | Ga0466715_130115 | 3300042616 | Bacteria | 7059 |
| 96 | Ga0466723_004427 | 3300042618 | Bacteria | 15159 |
| 97 | Ga0466726_149979 | 3300042619 | Bacteria | 2128 |
| 98 | Ga0160468_100077 | 3300012819 | Unclassified | 126012 |
| 99 | Ga0160458_100063 | 3300012832 | Bacteria | 137674 |
| 100 | Ga0466690_122795 | 3300042590 | Bacteria | 25617 |
| 101 | Ga0466729_202842 | 3300042621 | Bacteria | 11367 |
| 102 | Ga0466735_123530 | 3300042624 | Bacteria | 2550 |
| 103 | Ga0466727_022653 | 3300042655 | Bacteria | 7496 |
| 104 | Ga0466707_318681 | 3300042601 | Bacteria | 32106 |
| 105 | Ga0466716_145341 | 3300042605 | Bacteria | 4659 |
| 106 | Ga0466722_193568 | 3300042609 | Bacteria | 1896 |
| 107 | Ga0466722_252821 | 3300042609 | Bacteria | 235840 |
| 108 | IMNBL1DRAFT_c0008818 | 3300000062 | Bacteria | 5081 |
| 109 | Ga0068305_10019085 | 3300005083 | Bacteria | 2610 |
| 110 | Ga0072941_1046359 | 3300005201 | Bacteria | 3377 |
| 111 | Ga0123353_10089641 | 3300010167 | Bacteria | 4952 |
| 112 | Ga0466728_405850 | 3300042620 | Bacteria | 1827 |
| 113 | Ga0466692_011147 | 3300042591 | Bacteria | 45326 |
| 114 | Ga0466704_271613 | 3300042643 | Bacteria | 9548 |
| 115 | Ga0466719_080785 | 3300042606 | Bacteria | 5310 |
| 116 | Ga0466719_355698 | 3300042606 | Bacteria | 7294 |
| 117 | IMNBL1DRAFT_c0000956 | 3300000062 | Bacteria | 22304 |
| 118 | JGI24695J34938_10047424 | 3300002450 | Bacteria | 1897 |
| 119 | JGI24695J34938_10077948 | 3300002450 | Bacteria | 1373 |
| 120 | JGI24705J35276_12091913 | 3300002504 | Bacteria | 997 |
| 121 | Ga0123357_10001102 | 3300009784 | Bacteria | 27997 |
| 122 | Ga0466705_213893 | 3300042612 | Bacteria | 15470 |
| 123 | Ga0123357_10024211 | 3300009784 | Bacteria | 8168 |
| 124 | Ga0123356_11216877 | 3300010049 | Bacteria | 919 |
| 125 | Ga0123353_10110308 | 3300010167 | Bacteria | 4433 |
| 126 | Ga0123354_10058528 | 3300010882 | Bacteria | 5725 |
| 127 | Ga0123354_10089802 | 3300010882 | Bacteria | 4261 |
| 128 | Ga0466715_430756 | 3300042616 | Bacteria | 3506 |
| 129 | Ga0466726_025334 | 3300042619 | Bacteria | 3129 |
| 130 | Ga0466726_356717 | 3300042619 | Bacteria | 2747 |
| 131 | Ga0160457_1005456 | 3300012858 | Bacteria | 1938 |
| 132 | Ga0466696_340642 | 3300042596 | Bacteria | 2114 |
| 133 | Ga0466734_144871 | 3300042623 | Bacteria | 1879 |
| 134 | Ga0466703_097097 | 3300042636 | Bacteria | 8839 |
| 135 | Ga0466703_105273 | 3300042636 | Bacteria | 20412 |
| 136 | Ga0466704_000365 | 3300042643 | Bacteria | 8573 |
| 137 | Ga0466704_430903 | 3300042643 | Bacteria | 5394 |
| 138 | Ga0466727_089104 | 3300042655 | Bacteria | 2419 |
| 139 | Ga0466700_103161 | 3300042600 | Bacteria | 2122 |
| 140 | Ga0466700_113459 | 3300042600 | Bacteria | 15018 |
| 141 | Ga0466707_059850 | 3300042601 | Bacteria | 22773 |
| 142 | Ga0466707_319143 | 3300042601 | Bacteria | 7548 |
| 143 | Ga0466713_011830 | 3300042602 | Bacteria | 4040 |
| 144 | JGI24702J35022_10170618 | 3300002462 | Bacteria | 1230 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300012819 | Ga0160468_100077 | Ga0160468_10007728 | 189 |
| 2 | 3300010167 | Ga0123353_10089641 | Ga0123353_100896413 | 197 |
| 3 | 3300042591 | Ga0466692_178598 | Ga0466692_178598_1150_1776 | 198 |
| 4 | 3300042601 | Ga0466707_318681 | Ga0466707_318681_20910_21506 | 198 |
| 5 | 3300042606 | Ga0466719_080785 | Ga0466719_080785_1970_2587 | 198 |
| 6 | 3300042620 | Ga0466728_405850 | Ga0466728_405850_195_821 | 198 |
| 7 | 3300002450 | JGI24695J34938_10047424 | JGI24695J34938_100474243 | 199 |
| 8 | 3300042603 | Ga0466714_026681 | Ga0466714_026681_831_1433 | 200 |
| 9 | 3300042636 | Ga0466703_105273 | Ga0466703_105273_2952_3557 | 201 |
| 10 | 3300042621 | Ga0466729_202842 | Ga0466729_202842_926_1534 | 202 |
| 11 | 3300042624 | Ga0466735_060672 | Ga0466735_060672_164_772 | 202 |
| 12 | 3300042591 | Ga0466692_011147 | Ga0466692_011147_29927_30538 | 203 |
| 13 | 3300042598 | Ga0466701_033084 | Ga0466701_033084_18018_18629 | 203 |
| 14 | 3300042601 | Ga0466707_167694 | Ga0466707_167694_20595_21206 | 203 |
| 15 | 3300042601 | Ga0466707_385618 | Ga0466707_385618_4867_5478 | 203 |
| 16 | 3300042605 | Ga0466716_026639 | Ga0466716_026639_4379_4990 | 203 |
| 17 | 3300042605 | Ga0466716_183039 | Ga0466716_183039_478_1089 | 203 |
| 18 | 3300042606 | Ga0466719_355698 | Ga0466719_355698_3974_4585 | 203 |
| 19 | 3300042606 | Ga0466719_370029 | Ga0466719_370029_451_1062 | 203 |
| 20 | 3300042609 | Ga0466722_193568 | Ga0466722_193568_721_1332 | 203 |
| 21 | 3300042612 | Ga0466705_213893 | Ga0466705_213893_3813_4424 | 203 |
| 22 | 3300042616 | Ga0466715_359091 | Ga0466715_359091_9762_10373 | 203 |
| 23 | 3300042619 | Ga0466726_006129 | Ga0466726_006129_2981_3610 | 203 |
| 24 | 3300042619 | Ga0466726_122689 | Ga0466726_122689_208_819 | 203 |
| 25 | 3300042623 | Ga0466734_144871 | Ga0466734_144871_371_982 | 203 |
| 26 | 3300042643 | Ga0466704_000365 | Ga0466704_000365_1878_2489 | 203 |
| 27 | 3300042643 | Ga0466704_108246 | Ga0466704_108246_6320_6931 | 203 |
| 28 | 3300042656 | Ga0466732_330297 | Ga0466732_330297_573_1184 | 203 |
| 29 | 3300002462 | JGI24702J35022_10040936 | JGI24702J35022_100409363 | 204 |
| 30 | 3300005071 | Ga0068302_10153414 | Ga0068302_101534143 | 204 |
| 31 | 3300009784 | Ga0123357_10001102 | Ga0123357_1000110213 | 204 |
| 32 | 3300010049 | Ga0123356_11216877 | Ga0123356_112168772 | 204 |
| 33 | 3300042590 | Ga0466690_250711 | Ga0466690_250711_18079_18693 | 204 |
| 34 | 3300042593 | Ga0466691_207003 | Ga0466691_207003_76_690 | 204 |
| 35 | 3300042600 | Ga0466700_103161 | Ga0466700_103161_447_1061 | 204 |
| 36 | 3300042600 | Ga0466700_113459 | Ga0466700_113459_11385_11999 | 204 |
| 37 | 3300042600 | Ga0466700_228000 | Ga0466700_228000_801_1415 | 204 |
| 38 | 3300042609 | Ga0466722_252821 | Ga0466722_252821_111564_112178 | 204 |
| 39 | 3300042611 | Ga0466697_093779 | Ga0466697_093779_340_954 | 204 |
| 40 | 3300042619 | Ga0466726_481309 | Ga0466726_481309_934_1548 | 204 |
| 41 | 3300042655 | Ga0466727_121775 | Ga0466727_121775_3034_3648 | 204 |
| 42 | 3300042590 | Ga0466690_046892 | Ga0466690_046892_9425_10042 | 205 |
| 43 | 3300042596 | Ga0466696_374988 | Ga0466696_374988_1497_2114 | 205 |
| 44 | 3300042602 | Ga0466713_003715 | Ga0466713_003715_1778_2395 | 205 |
| 45 | 3300042616 | Ga0466715_430756 | Ga0466715_430756_317_934 | 205 |
| 46 | 3300042655 | Ga0466727_089104 | Ga0466727_089104_1323_1940 | 205 |
| 47 | 3300010882 | Ga0123354_10089802 | Ga0123354_100898023 | 206 |
| 48 | 3300042603 | Ga0466714_073904 | Ga0466714_073904_52318_52938 | 206 |
| 49 | 3300042611 | Ga0466697_213337 | Ga0466697_213337_560_1180 | 206 |
| 50 | 3300009784 | Ga0123357_10010217 | Ga0123357_1001021711 | 207 |
| 51 | 3300042602 | Ga0466713_082523 | Ga0466713_082523_4245_4868 | 207 |
| 52 | 3300042624 | Ga0466735_065370 | Ga0466735_065370_10106_10729 | 207 |
| 53 | 3300042643 | Ga0466704_271613 | Ga0466704_271613_6943_7566 | 207 |
| 54 | iso_pr_bacteria | 2967483437 | 2967487073 | 207 |
| 55 | 3300005083 | Ga0068305_10019085 | Ga0068305_100190852 | 208 |
| 56 | 3300042601 | Ga0466707_059850 | Ga0466707_059850_1762_2388 | 208 |
| 57 | 3300042609 | Ga0466722_065958 | Ga0466722_065958_903_1529 | 208 |
| 58 | 3300042616 | Ga0466715_518236 | Ga0466715_518236_474_1100 | 208 |
| 59 | 3300042621 | Ga0466729_261605 | Ga0466729_261605_4065_4691 | 208 |
| 60 | 3300042648 | Ga0466709_172128 | Ga0466709_172128_24311_24955 | 208 |
| 61 | 2225789004 | 2227563832 | 2228104048 | 209 |
| 62 | 2225789004 | 2227613510 | 2228186927 | 209 |
| 63 | 2225789004 | 2227634353 | 2228220322 | 209 |
| 64 | 3300042591 | Ga0466692_075152 | Ga0466692_075152_8984_9613 | 209 |
| 65 | 3300042594 | Ga0466694_232656 | Ga0466694_232656_1726_2355 | 209 |
| 66 | 3300042606 | Ga0466719_515918 | Ga0466719_515918_6067_6696 | 209 |
| 67 | 3300042610 | Ga0466698_328289 | Ga0466698_328289_141_770 | 209 |
| 68 | 3300042616 | Ga0466715_375411 | Ga0466715_375411_12381_13010 | 209 |
| 69 | 3300042619 | Ga0466726_149979 | Ga0466726_149979_898_1527 | 209 |
| 70 | 3300042623 | Ga0466734_037653 | Ga0466734_037653_68_697 | 209 |
| 71 | 3300042624 | Ga0466735_100631 | Ga0466735_100631_1607_2236 | 209 |
| 72 | 3300042624 | Ga0466735_123530 | Ga0466735_123530_599_1228 | 209 |
| 73 | 3300042636 | Ga0466703_246726 | Ga0466703_246726_4276_4905 | 209 |
| 74 | 3300042655 | Ga0466727_267134 | Ga0466727_267134_1656_2285 | 209 |
| 75 | iso_pr_bacteria | 2820759988 | 2820762304 | 209 |
| 76 | 3300000062 | IMNBL1DRAFT_c0000956 | IMNBL1DRAFT_00009567 | 210 |
| 77 | 3300000062 | IMNBL1DRAFT_c0001537 | IMNBL1DRAFT_000153711 | 210 |
| 78 | 3300002462 | JGI24702J35022_10010921 | JGI24702J35022_100109213 | 210 |
| 79 | 3300002504 | JGI24705J35276_12091913 | JGI24705J35276_120919132 | 210 |
| 80 | 3300002504 | JGI24705J35276_12219900 | JGI24705J35276_122199002 | 210 |
| 81 | 3300002504 | JGI24705J35276_12221365 | JGI24705J35276_122213651 | 210 |
| 82 | 3300002509 | JGI24699J35502_11134208 | JGI24699J35502_1113420828 | 210 |
| 83 | 3300005201 | Ga0072941_1046359 | Ga0072941_10463593 | 210 |
| 84 | 3300009784 | Ga0123357_10019828 | Ga0123357_100198283 | 210 |
| 85 | 3300009784 | Ga0123357_10051745 | Ga0123357_100517455 | 210 |
| 86 | 3300010049 | Ga0123356_10008036 | Ga0123356_100080366 | 210 |
| 87 | 3300010049 | Ga0123356_10857096 | Ga0123356_108570961 | 210 |
| 88 | 3300010882 | Ga0123354_10003206 | Ga0123354_1000320610 | 210 |
| 89 | 3300010882 | Ga0123354_10004244 | Ga0123354_100042444 | 210 |
| 90 | 3300010882 | Ga0123354_10011256 | Ga0123354_1001125612 | 210 |
| 91 | 3300010882 | Ga0123354_10058528 | Ga0123354_100585284 | 210 |
| 92 | 3300042590 | Ga0466690_122795 | Ga0466690_122795_21990_22622 | 210 |
| 93 | 3300042590 | Ga0466690_190597 | Ga0466690_190597_2100_2732 | 210 |
| 94 | 3300042600 | Ga0466700_056183 | Ga0466700_056183_11582_12214 | 210 |
| 95 | 3300042601 | Ga0466707_239589 | Ga0466707_239589_1387_2019 | 210 |
| 96 | 3300042601 | Ga0466707_240264 | Ga0466707_240264_16893_17525 | 210 |
| 97 | 3300042601 | Ga0466707_346472 | Ga0466707_346472_28966_29598 | 210 |
| 98 | 3300042601 | Ga0466707_358553 | Ga0466707_358553_9561_10193 | 210 |
| 99 | 3300042602 | Ga0466713_011830 | Ga0466713_011830_1565_2197 | 210 |
| 100 | 3300042606 | Ga0466719_325919 | Ga0466719_325919_213_845 | 210 |
| 101 | 3300042611 | Ga0466697_002421 | Ga0466697_002421_525_1157 | 210 |
| 102 | 3300042616 | Ga0466715_130115 | Ga0466715_130115_1162_1794 | 210 |
| 103 | 3300042620 | Ga0466728_275974 | Ga0466728_275974_5029_5661 | 210 |
| 104 | 3300042624 | Ga0466735_066106 | Ga0466735_066106_33_665 | 210 |
| 105 | 3300042655 | Ga0466727_085133 | Ga0466727_085133_17249_17881 | 210 |
| 106 | 3300000062 | IMNBL1DRAFT_c0000159 | IMNBL1DRAFT_000015919 | 211 |
| 107 | 3300002462 | JGI24702J35022_10002132 | JGI24702J35022_100021325 | 211 |
| 108 | 3300002834 | JGI24696J40584_12936906 | JGI24696J40584_129369062 | 211 |
| 109 | 3300009784 | Ga0123357_10024211 | Ga0123357_100242114 | 211 |
| 110 | 3300042596 | Ga0466696_340642 | Ga0466696_340642_610_1245 | 211 |
| 111 | 3300042609 | Ga0466722_082196 | Ga0466722_082196_2363_2998 | 211 |
| 112 | 3300042615 | Ga0466711_174702 | Ga0466711_174702_4978_5649 | 211 |
| 113 | 3300042618 | Ga0466723_004427 | Ga0466723_004427_5263_5898 | 211 |
| 114 | 3300042619 | Ga0466726_046595 | Ga0466726_046595_25712_26347 | 211 |
| 115 | iso_pr_bacteria | 2910949487 | 2910952419 | 211 |
| 116 | 3300005071 | Ga0068302_10382562 | Ga0068302_103825622 | 212 |
| 117 | 3300010882 | Ga0123354_10037503 | Ga0123354_100375033 | 212 |
| 118 | 3300042605 | Ga0466716_145341 | Ga0466716_145341_3048_3686 | 212 |
| 119 | 3300042619 | Ga0466726_356717 | Ga0466726_356717_772_1410 | 212 |
| 120 | 3300042602 | Ga0466713_035478 | Ga0466713_035478_17543_18184 | 213 |
| 121 | 3300042615 | Ga0466711_043128 | Ga0466711_043128_25325_25966 | 213 |
| 122 | 3300002450 | JGI24695J34938_10077948 | JGI24695J34938_100779482 | 214 |
| 123 | 3300002509 | JGI24699J35502_11134105 | JGI24699J35502_1113410510 | 214 |
| 124 | 3300010049 | Ga0123356_10830830 | Ga0123356_108308301 | 214 |
| 125 | 3300010049 | Ga0123356_10867752 | Ga0123356_108677522 | 214 |
| 126 | 3300010167 | Ga0123353_10110308 | Ga0123353_101103083 | 214 |
| 127 | 3300010882 | Ga0123354_10218471 | Ga0123354_102184713 | 214 |
| 128 | 3300042591 | Ga0466692_114301 | Ga0466692_114301_21939_22583 | 214 |
| 129 | 3300042606 | Ga0466719_188005 | Ga0466719_188005_3831_4475 | 214 |
| 130 | 3300042636 | Ga0466703_097097 | Ga0466703_097097_4835_5479 | 214 |
| 131 | 3300042643 | Ga0466704_205716 | Ga0466704_205716_4084_4728 | 214 |
| 132 | 3300042643 | Ga0466704_430903 | Ga0466704_430903_3942_4586 | 214 |
| 133 | 3300042652 | Ga0466708_208881 | Ga0466708_208881_1287_1931 | 214 |
| 134 | 3300042655 | Ga0466727_022653 | Ga0466727_022653_3099_3743 | 214 |
| 135 | 3300042655 | Ga0466727_289011 | Ga0466727_289011_4534_5178 | 214 |
| 136 | iso_pr_bacteria | 3004677695 | 3004680487 | 214 |
| 137 | 3300000062 | IMNBL1DRAFT_c0008818 | IMNBL1DRAFT_00088185 | 215 |
| 138 | 3300042601 | Ga0466707_319143 | Ga0466707_319143_1509_2156 | 215 |
| 139 | 3300042602 | Ga0466713_039611 | Ga0466713_039611_731_1378 | 215 |
| 140 | 3300042619 | Ga0466726_025334 | Ga0466726_025334_1407_2054 | 215 |
| 141 | 3300005083 | Ga0068305_10491341 | Ga0068305_104913412 | 216 |
| 142 | 3300012832 | Ga0160458_100063 | Ga0160458_10006384 | 217 |
| 143 | 3300012847 | Ga0160445_100325 | Ga0160445_10032518 | 217 |
| 144 | 3300012858 | Ga0160457_1005456 | Ga0160457_10054562 | 217 |
| 145 | 3300042624 | Ga0466735_011826 | Ga0466735_011826_1220_1888 | 222 |
| 146 | 3300042600 | Ga0466700_256070 | Ga0466700_256070_229_909 | 226 |
| 147 | 3300042624 | Ga0466735_128070 | Ga0466735_128070_1069_1755 | 228 |
| 148 | 3300002462 | JGI24702J35022_10170618 | JGI24702J35022_101706182 | 235 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01252 | Peptidase_A8 | Signal peptidase (SPase) II | 13 | 193 | 0.88 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.79 | 0.83 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.