Protein Family IF00822

Metagenome Isolate
148 Members
52 Samples
144 Scaffolds
208.64 Avg Length

🧬 Representative Sequence

ID
3300002462|JGI24702J35022_10170618|JGI24702J35022_101706182
Length
235 aa
Sequence
MKISKKTFVAIAVILFILVLDQIIKILVKTNFTLGEDKQITSWFYIRFIENEGMAMGIKVFGKLFLTVFRLVASIAIAYYLYLLIRNNFKLSYIILVSMIFAGAVGNIIDSVFYGVIFSESAYTQVAVLFPEGGGYNGWLHGNVVDMFYFPLFSFNWPSWIPWIGGSNFEFFRYIFNIADSSISVGIVVLLLFFRKTLSLSFEKQEVESXSNRYGCFFDISFHCMQQSSFIYPF*

πŸ“Š Sample Types

Isolate 2.7%
Metagenome 97.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 33.3%
Kalotermitidae 27.5%
Unclassified 9.8%
Termopsidae 7.8%
Rhinotermitidae 5.9%
Armadillidiidae 5.9%
Blattidae 3.9%
Passalidae 3.9%
Culicidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 142
Eukaryota 0
Viruses 0
Unclassified 6

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
2 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
3 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
4 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
8 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
9 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
10 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
11 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
12 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
13 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
14 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
15 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
16 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
17 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
18 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
19 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
20 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
21 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
22 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
23 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
24 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
25 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
26 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
27 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
28 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
29 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
30 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
31 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
32 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
33 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
34 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
35 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
36 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
37 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
38 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
39 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
40 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
41 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
42 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
43 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
44 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
45 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
46 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
47 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
48 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
49 3004677695 Bacteroides sp. 214 Isolate Blattidae
50 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
51 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
52 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_093779 3300042611 Bacteria 1377
2 Ga0466697_213337 3300042611 Bacteria 1862
3 Ga0123356_10008036 3300010049 Bacteria 10500
4 Ga0123356_10867752 3300010049 Bacteria 1074
5 Ga0466711_043128 3300042615 Bacteria 56831
6 Ga0466711_174702 3300042615 Bacteria 14756
7 Ga0466690_190597 3300042590 Bacteria 6928
8 Ga0466690_250711 3300042590 Bacteria 19853
9 Ga0466692_114301 3300042591 Bacteria 28842
10 Ga0466691_207003 3300042593 Bacteria 4291
11 Ga0466704_108246 3300042643 Bacteria 8570
12 Ga0466704_205716 3300042643 Unclassified 5160
13 Ga0466727_121775 3300042655 Bacteria 4232
14 Ga0466701_033084 3300042598 Bacteria 19683
15 Ga0466713_082523 3300042602 Bacteria 11972
16 Ga0466714_073904 3300042603 Bacteria 61298
17 Ga0466719_370029 3300042606 Bacteria 2594
18 Ga0466722_065958 3300042609 Bacteria 2171
19 JGI24705J35276_12221365 3300002504 Bacteria 2335
20 JGI24696J40584_12936906 3300002834 Bacteria 1590
21 Ga0068302_10153414 3300005071 Unclassified 3291
22 Ga0466728_275974 3300042620 Bacteria 7986
23 Ga0160445_100325 3300012847 Bacteria 28697
24 Ga0466692_178598 3300042591 Bacteria 2512
25 Ga0466735_060672 3300042624 Bacteria 1314
26 Ga0466727_289011 3300042655 Bacteria 5317
27 Ga0466700_056183 3300042600 Bacteria 19305
28 Ga0466700_228000 3300042600 Bacteria 2030
29 Ga0466707_358553 3300042601 Bacteria 17333
30 Ga0466713_035478 3300042602 Bacteria 46123
31 Ga0466714_026681 3300042603 Bacteria 1447
32 2227563832 2225789004 Bacteria 2692
33 JGI24702J35022_10002132 3300002462 Bacteria 12212
34 JGI24702J35022_10040936 3300002462 Bacteria 2471
35 JGI24705J35276_12219900 3300002504 Bacteria 2233
36 JGI24699J35502_11134208 3300002509 Bacteria 58698
37 Ga0068302_10382562 3300005071 Bacteria 1769
38 Ga0123356_10830830 3300010049 Bacteria 1095
39 Ga0123354_10004244 3300010882 Bacteria 20226
40 Ga0466715_375411 3300042616 Bacteria 15689
41 Ga0466715_518236 3300042616 Unclassified 1267
42 Ga0466726_006129 3300042619 Bacteria 11303
43 Ga0466690_046892 3300042590 Bacteria 11669
44 Ga0466692_075152 3300042591 Bacteria 13452
45 Ga0466734_037653 3300042623 Bacteria 2068
46 Ga0466709_172128 3300042648 Bacteria 26267
47 Ga0466707_385618 3300042601 Bacteria 6163
48 Ga0466719_188005 3300042606 Bacteria 4597
49 Ga0466719_515918 3300042606 Bacteria 12958
50 Ga0466698_328289 3300042610 Bacteria 1555
51 2227634353 2225789004 Unclassified 2100
52 JGI24702J35022_10010921 3300002462 Bacteria 5067
53 JGI24699J35502_11134105 3300002509 Bacteria 31307
54 Ga0123357_10051745 3300009784 Bacteria 5550
55 Ga0466715_359091 3300042616 Bacteria 16012
56 Ga0466726_481309 3300042619 Bacteria 2093
57 Ga0466696_374988 3300042596 Bacteria 2904
58 Ga0466729_261605 3300042621 Bacteria 23426
59 Ga0466735_011826 3300042624 Bacteria 3600
60 Ga0466735_066106 3300042624 Bacteria 1082
61 Ga0466735_100631 3300042624 Bacteria 4241
62 Ga0466703_246726 3300042636 Bacteria 23563
63 Ga0466700_256070 3300042600 Bacteria 1121
64 Ga0466707_167694 3300042601 Bacteria 22180
65 Ga0466707_239589 3300042601 Bacteria 5144
66 Ga0466707_240264 3300042601 Bacteria 18653
67 Ga0466713_039611 3300042602 Bacteria 4717
68 Ga0466716_183039 3300042605 Bacteria 1312
69 2227613510 2225789004 Bacteria 11995
70 IMNBL1DRAFT_c0000159 3300000062 Bacteria 59691
71 Ga0466732_330297 3300042656 Bacteria 1301
72 Ga0123357_10010217 3300009784 Bacteria 11921
73 Ga0123357_10019828 3300009784 Bacteria 8976
74 Ga0123354_10011256 3300010882 Bacteria 13806
75 Ga0123354_10218471 3300010882 Unclassified 2034
76 Ga0466726_046595 3300042619 Bacteria 30556
77 Ga0466726_122689 3300042619 Bacteria 1506
78 Ga0466694_232656 3300042594 Bacteria 4739
79 Ga0466735_065370 3300042624 Bacteria 13419
80 Ga0466735_128070 3300042624 Bacteria 1866
81 Ga0466708_208881 3300042652 Bacteria 10918
82 Ga0466727_085133 3300042655 Bacteria 23683
83 Ga0466727_267134 3300042655 Bacteria 6610
84 Ga0466707_346472 3300042601 Bacteria 30724
85 Ga0466713_003715 3300042602 Bacteria 18997
86 Ga0466716_026639 3300042605 Bacteria 5692
87 Ga0466719_325919 3300042606 Bacteria 1976
88 Ga0466722_082196 3300042609 Bacteria 3646
89 Ga0466697_002421 3300042611 Bacteria 1863
90 IMNBL1DRAFT_c0001537 3300000062 Bacteria 17207
91 Ga0068305_10491341 3300005083 Bacteria 2060
92 Ga0123356_10857096 3300010049 Bacteria 1080
93 Ga0123354_10003206 3300010882 Bacteria 22421
94 Ga0123354_10037503 3300010882 Bacteria 7544
95 Ga0466715_130115 3300042616 Bacteria 7059
96 Ga0466723_004427 3300042618 Bacteria 15159
97 Ga0466726_149979 3300042619 Bacteria 2128
98 Ga0160468_100077 3300012819 Unclassified 126012
99 Ga0160458_100063 3300012832 Bacteria 137674
100 Ga0466690_122795 3300042590 Bacteria 25617
101 Ga0466729_202842 3300042621 Bacteria 11367
102 Ga0466735_123530 3300042624 Bacteria 2550
103 Ga0466727_022653 3300042655 Bacteria 7496
104 Ga0466707_318681 3300042601 Bacteria 32106
105 Ga0466716_145341 3300042605 Bacteria 4659
106 Ga0466722_193568 3300042609 Bacteria 1896
107 Ga0466722_252821 3300042609 Bacteria 235840
108 IMNBL1DRAFT_c0008818 3300000062 Bacteria 5081
109 Ga0068305_10019085 3300005083 Bacteria 2610
110 Ga0072941_1046359 3300005201 Bacteria 3377
111 Ga0123353_10089641 3300010167 Bacteria 4952
112 Ga0466728_405850 3300042620 Bacteria 1827
113 Ga0466692_011147 3300042591 Bacteria 45326
114 Ga0466704_271613 3300042643 Bacteria 9548
115 Ga0466719_080785 3300042606 Bacteria 5310
116 Ga0466719_355698 3300042606 Bacteria 7294
117 IMNBL1DRAFT_c0000956 3300000062 Bacteria 22304
118 JGI24695J34938_10047424 3300002450 Bacteria 1897
119 JGI24695J34938_10077948 3300002450 Bacteria 1373
120 JGI24705J35276_12091913 3300002504 Bacteria 997
121 Ga0123357_10001102 3300009784 Bacteria 27997
122 Ga0466705_213893 3300042612 Bacteria 15470
123 Ga0123357_10024211 3300009784 Bacteria 8168
124 Ga0123356_11216877 3300010049 Bacteria 919
125 Ga0123353_10110308 3300010167 Bacteria 4433
126 Ga0123354_10058528 3300010882 Bacteria 5725
127 Ga0123354_10089802 3300010882 Bacteria 4261
128 Ga0466715_430756 3300042616 Bacteria 3506
129 Ga0466726_025334 3300042619 Bacteria 3129
130 Ga0466726_356717 3300042619 Bacteria 2747
131 Ga0160457_1005456 3300012858 Bacteria 1938
132 Ga0466696_340642 3300042596 Bacteria 2114
133 Ga0466734_144871 3300042623 Bacteria 1879
134 Ga0466703_097097 3300042636 Bacteria 8839
135 Ga0466703_105273 3300042636 Bacteria 20412
136 Ga0466704_000365 3300042643 Bacteria 8573
137 Ga0466704_430903 3300042643 Bacteria 5394
138 Ga0466727_089104 3300042655 Bacteria 2419
139 Ga0466700_103161 3300042600 Bacteria 2122
140 Ga0466700_113459 3300042600 Bacteria 15018
141 Ga0466707_059850 3300042601 Bacteria 22773
142 Ga0466707_319143 3300042601 Bacteria 7548
143 Ga0466713_011830 3300042602 Bacteria 4040
144 JGI24702J35022_10170618 3300002462 Bacteria 1230

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300012819 Ga0160468_100077 Ga0160468_10007728 189
2 3300010167 Ga0123353_10089641 Ga0123353_100896413 197
3 3300042591 Ga0466692_178598 Ga0466692_178598_1150_1776 198
4 3300042601 Ga0466707_318681 Ga0466707_318681_20910_21506 198
5 3300042606 Ga0466719_080785 Ga0466719_080785_1970_2587 198
6 3300042620 Ga0466728_405850 Ga0466728_405850_195_821 198
7 3300002450 JGI24695J34938_10047424 JGI24695J34938_100474243 199
8 3300042603 Ga0466714_026681 Ga0466714_026681_831_1433 200
9 3300042636 Ga0466703_105273 Ga0466703_105273_2952_3557 201
10 3300042621 Ga0466729_202842 Ga0466729_202842_926_1534 202
11 3300042624 Ga0466735_060672 Ga0466735_060672_164_772 202
12 3300042591 Ga0466692_011147 Ga0466692_011147_29927_30538 203
13 3300042598 Ga0466701_033084 Ga0466701_033084_18018_18629 203
14 3300042601 Ga0466707_167694 Ga0466707_167694_20595_21206 203
15 3300042601 Ga0466707_385618 Ga0466707_385618_4867_5478 203
16 3300042605 Ga0466716_026639 Ga0466716_026639_4379_4990 203
17 3300042605 Ga0466716_183039 Ga0466716_183039_478_1089 203
18 3300042606 Ga0466719_355698 Ga0466719_355698_3974_4585 203
19 3300042606 Ga0466719_370029 Ga0466719_370029_451_1062 203
20 3300042609 Ga0466722_193568 Ga0466722_193568_721_1332 203
21 3300042612 Ga0466705_213893 Ga0466705_213893_3813_4424 203
22 3300042616 Ga0466715_359091 Ga0466715_359091_9762_10373 203
23 3300042619 Ga0466726_006129 Ga0466726_006129_2981_3610 203
24 3300042619 Ga0466726_122689 Ga0466726_122689_208_819 203
25 3300042623 Ga0466734_144871 Ga0466734_144871_371_982 203
26 3300042643 Ga0466704_000365 Ga0466704_000365_1878_2489 203
27 3300042643 Ga0466704_108246 Ga0466704_108246_6320_6931 203
28 3300042656 Ga0466732_330297 Ga0466732_330297_573_1184 203
29 3300002462 JGI24702J35022_10040936 JGI24702J35022_100409363 204
30 3300005071 Ga0068302_10153414 Ga0068302_101534143 204
31 3300009784 Ga0123357_10001102 Ga0123357_1000110213 204
32 3300010049 Ga0123356_11216877 Ga0123356_112168772 204
33 3300042590 Ga0466690_250711 Ga0466690_250711_18079_18693 204
34 3300042593 Ga0466691_207003 Ga0466691_207003_76_690 204
35 3300042600 Ga0466700_103161 Ga0466700_103161_447_1061 204
36 3300042600 Ga0466700_113459 Ga0466700_113459_11385_11999 204
37 3300042600 Ga0466700_228000 Ga0466700_228000_801_1415 204
38 3300042609 Ga0466722_252821 Ga0466722_252821_111564_112178 204
39 3300042611 Ga0466697_093779 Ga0466697_093779_340_954 204
40 3300042619 Ga0466726_481309 Ga0466726_481309_934_1548 204
41 3300042655 Ga0466727_121775 Ga0466727_121775_3034_3648 204
42 3300042590 Ga0466690_046892 Ga0466690_046892_9425_10042 205
43 3300042596 Ga0466696_374988 Ga0466696_374988_1497_2114 205
44 3300042602 Ga0466713_003715 Ga0466713_003715_1778_2395 205
45 3300042616 Ga0466715_430756 Ga0466715_430756_317_934 205
46 3300042655 Ga0466727_089104 Ga0466727_089104_1323_1940 205
47 3300010882 Ga0123354_10089802 Ga0123354_100898023 206
48 3300042603 Ga0466714_073904 Ga0466714_073904_52318_52938 206
49 3300042611 Ga0466697_213337 Ga0466697_213337_560_1180 206
50 3300009784 Ga0123357_10010217 Ga0123357_1001021711 207
51 3300042602 Ga0466713_082523 Ga0466713_082523_4245_4868 207
52 3300042624 Ga0466735_065370 Ga0466735_065370_10106_10729 207
53 3300042643 Ga0466704_271613 Ga0466704_271613_6943_7566 207
54 iso_pr_bacteria 2967483437 2967487073 207
55 3300005083 Ga0068305_10019085 Ga0068305_100190852 208
56 3300042601 Ga0466707_059850 Ga0466707_059850_1762_2388 208
57 3300042609 Ga0466722_065958 Ga0466722_065958_903_1529 208
58 3300042616 Ga0466715_518236 Ga0466715_518236_474_1100 208
59 3300042621 Ga0466729_261605 Ga0466729_261605_4065_4691 208
60 3300042648 Ga0466709_172128 Ga0466709_172128_24311_24955 208
61 2225789004 2227563832 2228104048 209
62 2225789004 2227613510 2228186927 209
63 2225789004 2227634353 2228220322 209
64 3300042591 Ga0466692_075152 Ga0466692_075152_8984_9613 209
65 3300042594 Ga0466694_232656 Ga0466694_232656_1726_2355 209
66 3300042606 Ga0466719_515918 Ga0466719_515918_6067_6696 209
67 3300042610 Ga0466698_328289 Ga0466698_328289_141_770 209
68 3300042616 Ga0466715_375411 Ga0466715_375411_12381_13010 209
69 3300042619 Ga0466726_149979 Ga0466726_149979_898_1527 209
70 3300042623 Ga0466734_037653 Ga0466734_037653_68_697 209
71 3300042624 Ga0466735_100631 Ga0466735_100631_1607_2236 209
72 3300042624 Ga0466735_123530 Ga0466735_123530_599_1228 209
73 3300042636 Ga0466703_246726 Ga0466703_246726_4276_4905 209
74 3300042655 Ga0466727_267134 Ga0466727_267134_1656_2285 209
75 iso_pr_bacteria 2820759988 2820762304 209
76 3300000062 IMNBL1DRAFT_c0000956 IMNBL1DRAFT_00009567 210
77 3300000062 IMNBL1DRAFT_c0001537 IMNBL1DRAFT_000153711 210
78 3300002462 JGI24702J35022_10010921 JGI24702J35022_100109213 210
79 3300002504 JGI24705J35276_12091913 JGI24705J35276_120919132 210
80 3300002504 JGI24705J35276_12219900 JGI24705J35276_122199002 210
81 3300002504 JGI24705J35276_12221365 JGI24705J35276_122213651 210
82 3300002509 JGI24699J35502_11134208 JGI24699J35502_1113420828 210
83 3300005201 Ga0072941_1046359 Ga0072941_10463593 210
84 3300009784 Ga0123357_10019828 Ga0123357_100198283 210
85 3300009784 Ga0123357_10051745 Ga0123357_100517455 210
86 3300010049 Ga0123356_10008036 Ga0123356_100080366 210
87 3300010049 Ga0123356_10857096 Ga0123356_108570961 210
88 3300010882 Ga0123354_10003206 Ga0123354_1000320610 210
89 3300010882 Ga0123354_10004244 Ga0123354_100042444 210
90 3300010882 Ga0123354_10011256 Ga0123354_1001125612 210
91 3300010882 Ga0123354_10058528 Ga0123354_100585284 210
92 3300042590 Ga0466690_122795 Ga0466690_122795_21990_22622 210
93 3300042590 Ga0466690_190597 Ga0466690_190597_2100_2732 210
94 3300042600 Ga0466700_056183 Ga0466700_056183_11582_12214 210
95 3300042601 Ga0466707_239589 Ga0466707_239589_1387_2019 210
96 3300042601 Ga0466707_240264 Ga0466707_240264_16893_17525 210
97 3300042601 Ga0466707_346472 Ga0466707_346472_28966_29598 210
98 3300042601 Ga0466707_358553 Ga0466707_358553_9561_10193 210
99 3300042602 Ga0466713_011830 Ga0466713_011830_1565_2197 210
100 3300042606 Ga0466719_325919 Ga0466719_325919_213_845 210
101 3300042611 Ga0466697_002421 Ga0466697_002421_525_1157 210
102 3300042616 Ga0466715_130115 Ga0466715_130115_1162_1794 210
103 3300042620 Ga0466728_275974 Ga0466728_275974_5029_5661 210
104 3300042624 Ga0466735_066106 Ga0466735_066106_33_665 210
105 3300042655 Ga0466727_085133 Ga0466727_085133_17249_17881 210
106 3300000062 IMNBL1DRAFT_c0000159 IMNBL1DRAFT_000015919 211
107 3300002462 JGI24702J35022_10002132 JGI24702J35022_100021325 211
108 3300002834 JGI24696J40584_12936906 JGI24696J40584_129369062 211
109 3300009784 Ga0123357_10024211 Ga0123357_100242114 211
110 3300042596 Ga0466696_340642 Ga0466696_340642_610_1245 211
111 3300042609 Ga0466722_082196 Ga0466722_082196_2363_2998 211
112 3300042615 Ga0466711_174702 Ga0466711_174702_4978_5649 211
113 3300042618 Ga0466723_004427 Ga0466723_004427_5263_5898 211
114 3300042619 Ga0466726_046595 Ga0466726_046595_25712_26347 211
115 iso_pr_bacteria 2910949487 2910952419 211
116 3300005071 Ga0068302_10382562 Ga0068302_103825622 212
117 3300010882 Ga0123354_10037503 Ga0123354_100375033 212
118 3300042605 Ga0466716_145341 Ga0466716_145341_3048_3686 212
119 3300042619 Ga0466726_356717 Ga0466726_356717_772_1410 212
120 3300042602 Ga0466713_035478 Ga0466713_035478_17543_18184 213
121 3300042615 Ga0466711_043128 Ga0466711_043128_25325_25966 213
122 3300002450 JGI24695J34938_10077948 JGI24695J34938_100779482 214
123 3300002509 JGI24699J35502_11134105 JGI24699J35502_1113410510 214
124 3300010049 Ga0123356_10830830 Ga0123356_108308301 214
125 3300010049 Ga0123356_10867752 Ga0123356_108677522 214
126 3300010167 Ga0123353_10110308 Ga0123353_101103083 214
127 3300010882 Ga0123354_10218471 Ga0123354_102184713 214
128 3300042591 Ga0466692_114301 Ga0466692_114301_21939_22583 214
129 3300042606 Ga0466719_188005 Ga0466719_188005_3831_4475 214
130 3300042636 Ga0466703_097097 Ga0466703_097097_4835_5479 214
131 3300042643 Ga0466704_205716 Ga0466704_205716_4084_4728 214
132 3300042643 Ga0466704_430903 Ga0466704_430903_3942_4586 214
133 3300042652 Ga0466708_208881 Ga0466708_208881_1287_1931 214
134 3300042655 Ga0466727_022653 Ga0466727_022653_3099_3743 214
135 3300042655 Ga0466727_289011 Ga0466727_289011_4534_5178 214
136 iso_pr_bacteria 3004677695 3004680487 214
137 3300000062 IMNBL1DRAFT_c0008818 IMNBL1DRAFT_00088185 215
138 3300042601 Ga0466707_319143 Ga0466707_319143_1509_2156 215
139 3300042602 Ga0466713_039611 Ga0466713_039611_731_1378 215
140 3300042619 Ga0466726_025334 Ga0466726_025334_1407_2054 215
141 3300005083 Ga0068305_10491341 Ga0068305_104913412 216
142 3300012832 Ga0160458_100063 Ga0160458_10006384 217
143 3300012847 Ga0160445_100325 Ga0160445_10032518 217
144 3300012858 Ga0160457_1005456 Ga0160457_10054562 217
145 3300042624 Ga0466735_011826 Ga0466735_011826_1220_1888 222
146 3300042600 Ga0466700_256070 Ga0466700_256070_229_909 226
147 3300042624 Ga0466735_128070 Ga0466735_128070_1069_1755 228
148 3300002462 JGI24702J35022_10170618 JGI24702J35022_101706182 235

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01252 Peptidase_A8 Signal peptidase (SPase) II 13 193 0.88

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.79 0.83 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.