Protein Family IF00808

Metagenome Isolate
152 Members
73 Samples
124 Scaffolds
251.39 Avg Length

🧬 Representative Sequence

ID
3300002462|JGI24702J35022_10051644|JGI24702J35022_100516442
Length
275 aa
Sequence
LLGRKKKLSCREXKSIMRLYMKFFSMHLKSQMQYKTSFFLTMFGQFLVSFTAFLGVYFMFSRFDAVEGYAFEQALLCYAVVLVAFSTAEMLGRGFDLFPRMIQSGEFDRVLVRPKNVIFQVLASKMDFTRLGRLFQATVVFCYAIPNSGVNWTPDKILTLCLMVVCGSLIFFGLFLVYAAFSFFTIEGLEFMNVFTDGGREFGRYPFSVYGKNILMFLTFVIPLALFQYYPLLYLLDREQSVFFMFLPLVGLLFLVPSYVFFRVGLRRYTSTGS*

📊 Sample Types

Isolate 18.4%
Metagenome 81.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 38.6%
Termitidae 34.3%
Kalotermitidae 12.9%
Tenebrionidae 4.3%
Rhinotermitidae 4.3%
Passalidae 2.9%
Vespidae 1.4%
Scarabaeidae 1.4%

🌳 Taxonomy

Archaea 1
Bacteria 145
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820854745 Unclassified Actinobacteria Lab288P3bin234 Isolate Unclassified
2 2881375749 Vagococcus entomophilus DSM 24756 Isolate Vespidae
3 2585428085 Sporobacter termitidis DSM 10068 Isolate Termitidae
4 2820227065 Unclassified Firmicutes Th196P4bin44 Isolate Unclassified
5 2820495292 Unclassified Firmicutes Lab288P1bin59 Isolate Unclassified
6 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
7 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
8 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
9 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
10 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
11 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
12 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
13 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
14 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
15 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
16 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
17 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
18 2775507073 Enterococcus sp. CR-Ec1 Isolate Unclassified
19 2820282995 Unclassified Firmicutes Th196P3bin147 Isolate Unclassified
20 2820362221 Unclassified Firmicutes Nt197P3bin116 Isolate Unclassified
21 2820573558 Unclassified Firmicutes Emb289P3bin140 Isolate Unclassified
22 2820576413 Unclassified Firmicutes Emb289P3bin136 Isolate Unclassified
23 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
24 2820800812 Unclassified Actinobacteria Th196P4bin28 Isolate Unclassified
25 2820246658 Unclassified Firmicutes Th196P3bin70 Isolate Unclassified
26 2820336130 Unclassified Firmicutes Nt197P3bin70 Isolate Unclassified
27 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
28 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
29 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
30 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
31 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
32 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
33 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
34 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
35 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
36 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
37 2820371985 Unclassified Firmicutes Nt197P3bin100 Isolate Unclassified
38 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
39 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
40 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
41 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
42 2820353569 Unclassified Firmicutes Nt197P3bin28 Isolate Unclassified
43 2820661146 Unclassified Firmicutes Co191P3bin61 Isolate Unclassified
44 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
45 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
46 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
47 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
48 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
49 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
50 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
51 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
52 2820690275 Unclassified Firmicutes Co191P1bin72 Isolate Unclassified
53 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
54 2820238527 Unclassified Firmicutes Th196P3bin90 Isolate Unclassified
55 2820422691 Unclassified Firmicutes Lab288P3bin58 Isolate Unclassified
56 2820594669 Unclassified Firmicutes Emb289P1bin61 Isolate Unclassified
57 2820072841 Unclassified Proteobacteria Nt197P3bin127 Isolate Unclassified
58 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
59 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
60 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
61 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
62 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
63 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
64 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
65 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
66 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
67 2820916033 Unclassified Actinobacteria Emb289P3bin63 Isolate Unclassified
68 2820414148 Unclassified Firmicutes Lab288P3bin93 Isolate Unclassified
69 2820547636 Unclassified Firmicutes Lab288P1bin10 Isolate Unclassified
70 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
71 8002299145 Vagococcus allomyrinae BWB3-3 Isolate Scarabaeidae
72 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
73 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562379_0092 3300056790 Bacteria 317609
2 Ga0466693_443998 3300042592 Bacteria 1545
3 Ga0466699_196405 3300042597 Bacteria 3566
4 Ga0466718_169460 3300042617 Bacteria 1435
5 Ga0466729_013325 3300042621 Bacteria 2184
6 Ga0466700_226234 3300042600 Bacteria 1642
7 Ga0466700_469769 3300042600 Bacteria 1570
8 JGI24695J34938_10048506 3300002450 Bacteria 1870
9 JGI24702J35022_10009084 3300002462 Bacteria 5599
10 JGI24702J35022_10030735 3300002462 Bacteria 2881
11 JGI24702J35022_10064942 3300002462 Bacteria 1958
12 Ga0068305_10002300 3300005083 Bacteria 37253
13 Ga0072941_1000468 3300005201 Bacteria 5957
14 Ga0072941_1000469 3300005201 Unclassified 3061
15 Ga0466704_020045 3300042643 Bacteria 3477
16 Ga0466704_526762 3300042643 Bacteria 2883
17 Ga0123355_10163441 3300009826 Bacteria 3347
18 Ga0123355_10380446 3300009826 Bacteria 1840
19 Ga0123356_10761253 3300010049 Bacteria 1139
20 Ga0123353_10023044 3300010167 Bacteria 9414
21 Ga0123353_10506783 3300010167 Bacteria 1756
22 Ga0466693_402206 3300042592 Bacteria 20058
23 Ga0466713_122316 3300042602 Bacteria 7595
24 Ga0466714_060578 3300042603 Bacteria 1194
25 Ga0466722_102990 3300042609 Bacteria 2797
26 IMNBL1DRAFT_c0000021 3300000062 Bacteria 148886
27 Ga0072941_1033578 3300005201 Bacteria 4583
28 Ga0466734_075402 3300042623 Bacteria 1187
29 Ga0466708_443532 3300042652 Bacteria 3666
30 Ga0123357_10037814 3300009784 Bacteria 6570
31 Ga0123355_10016922 3300009826 Bacteria 11503
32 Ga0123356_10000262 3300010049 Bacteria 60769
33 Ga0123356_10264490 3300010049 Bacteria 1806
34 Ga0123353_10001599 3300010167 Bacteria 27891
35 Ga0123353_10154773 3300010167 Bacteria 3656
36 Ga0123353_10179356 3300010167 Bacteria 3355
37 Ga0123353_10384437 3300010167 Bacteria 2098
38 Ga0562378_0193 3300056814 Bacteria 149270
39 Ga0415639_072191 3300038395 Bacteria 1903
40 Ga0466696_314208 3300042596 Bacteria 1576
41 Ga0466707_304216 3300042601 Bacteria 12242
42 Ga0466714_032719 3300042603 Bacteria 4212
43 Ga0466714_132839 3300042603 Bacteria 4250
44 Ga0466717_204066 3300042604 Bacteria 2545
45 Ga0466721_168866 3300042608 Bacteria 2482
46 JGI24695J34938_10004699 3300002450 Bacteria 8848
47 Ga0466703_145380 3300042636 Bacteria 7606
48 Ga0466709_240899 3300042648 Bacteria 33424
49 Ga0466724_56697 3300042649 Bacteria 2511
50 Ga0123356_10035636 3300010049 Bacteria 4647
51 Ga0123353_10064671 3300010167 Bacteria 5871
52 Ga0123353_10415073 3300010167 Bacteria 1997
53 Ga0466733_008715 3300042659 Bacteria 1297
54 Ga0466729_087762 3300042621 Bacteria 1260
55 Ga0466713_065300 3300042602 Bacteria 1174
56 Ga0466714_053105 3300042603 Bacteria 1892
57 2227588797 2225789004 Bacteria 2442
58 Ga0072941_1044882 3300005201 Bacteria 2125
59 Ga0466724_23477 3300042649 Bacteria 4222
60 Ga0123356_10017513 3300010049 Bacteria 6816
61 Ga0123356_10050902 3300010049 Bacteria 3853
62 Ga0123356_10199345 3300010049 Bacteria 2040
63 Ga0123356_10206550 3300010049 Unclassified 2008
64 Ga0123356_10310209 3300010049 Bacteria 1686
65 Ga0123353_10632799 3300010167 Unclassified 1520
66 Ga0415639_059900 3300038395 Bacteria 7859
67 Ga0466705_421583 3300042612 Bacteria 20644
68 Ga0466715_295640 3300042616 Unclassified 169413
69 Ga0466714_118974 3300042603 Bacteria 3358
70 Ga0466722_136743 3300042609 Bacteria 57023
71 JGI24695J34938_10000701 3300002450 Bacteria 31525
72 JGI24702J35022_10016178 3300002462 Bacteria 4093
73 Ga0466704_551580 3300042643 Bacteria 1539
74 Ga0123355_10344149 3300009826 Bacteria 1983
75 Ga0123353_10136036 3300010167 Bacteria 3941
76 Ga0123353_10797981 3300010167 Unclassified 1304
77 Ga0466697_073743 3300042611 Bacteria 1057
78 Ga0466705_306648 3300042612 Bacteria 5175
79 Ga0562375_3733 3300056856 Bacteria 13445
80 Ga0466656_371573 3300042550 Bacteria 1759
81 Ga0466718_029414 3300042617 Archaea 1504
82 Ga0466713_059062 3300042602 Bacteria 88440
83 Ga0466719_226791 3300042606 Bacteria 6608
84 2227191897 2225789004 Bacteria 34717
85 2227657958 2225789004 Bacteria 10578
86 JGI24695J34938_10066246 3300002450 Bacteria 1523
87 JGI24702J35022_10000169 3300002462 Bacteria 34308
88 JGI24702J35022_10051644 3300002462 Bacteria 2191
89 Ga0072941_1045122 3300005201 Bacteria 7766
90 Ga0123357_10421814 3300009784 Bacteria 1189
91 Ga0123355_10000537 3300009826 Bacteria 50831
92 Ga0123355_10122270 3300009826 Bacteria 4034
93 Ga0123356_10054334 3300010049 Bacteria 3730
94 Ga0123356_10283279 3300010049 Bacteria 1754
95 Ga0123353_11564932 3300010167 Bacteria 835
96 Ga0123354_10481548 3300010882 Bacteria 981
97 Ga0160441_100316 3300012825 Bacteria 43612
98 Ga0466692_101006 3300042591 Bacteria 1471
99 Ga0466694_405209 3300042594 Bacteria 5468
100 Ga0466714_026296 3300042603 Bacteria 18081
101 Ga0466697_004429 3300042611 Bacteria 2971
102 JGI24695J34938_10000267 3300002450 Bacteria 50738
103 JGI24702J35022_10010650 3300002462 Bacteria 5137
104 JGI24697J35500_11224257 3300002507 Bacteria 1932
105 Ga0123357_10203112 3300009784 Bacteria 2249
106 Ga0123355_10000607 3300009826 Bacteria 48372
107 Ga0123356_10003321 3300010049 Bacteria 16883
108 Ga0123353_10203808 3300010167 Bacteria 3109
109 Ga0123353_10586241 3300010167 Bacteria 1598
110 Ga0466705_239567 3300042612 Bacteria 3692
111 Ga0466711_233007 3300042615 Bacteria 3925
112 Ga0466715_429206 3300042616 Bacteria 39560
113 Ga0466714_001358 3300042603 Bacteria 1176
114 Ga0466714_045116 3300042603 Bacteria 3700
115 Ga0072941_1050903 3300005201 Unclassified 6249
116 Ga0466731_053035 3300042622 Bacteria 4612
117 Ga0123356_10003381 3300010049 Bacteria 16737
118 Ga0123356_10096126 3300010049 Bacteria 2832
119 Ga0123356_10118905 3300010049 Bacteria 2566
120 Ga0123353_10000925 3300010167 Bacteria 35824
121 Ga0123353_10044079 3300010167 Bacteria 7071
122 Ga0123353_10369088 3300010167 Bacteria 2153
123 Ga0123353_10492989 3300010167 Bacteria 1788
124 Ga0123353_10978524 3300010167 Bacteria 1140

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010049 Ga0123356_10206550 Ga0123356_102065501 186
2 iso_pr_bacteria 2820661146 2820663803 198
3 iso_pr_bacteria 2820690275 2820693093 198
4 3300042592 Ga0466693_443998 Ga0466693_443998_839_1438 199
5 3300010049 Ga0123356_10003381 Ga0123356_100033813 221
6 3300002462 JGI24702J35022_10030735 JGI24702J35022_100307352 223
7 3300010167 Ga0123353_10023044 Ga0123353_100230446 224
8 3300042621 Ga0466729_087762 Ga0466729_087762_332_1108 225
9 3300042659 Ga0466733_008715 Ga0466733_008715_432_1181 226
10 3300009826 Ga0123355_10122270 Ga0123355_101222702 230
11 3300042602 Ga0466713_122316 Ga0466713_122316_5093_5827 231
12 3300009826 Ga0123355_10000607 Ga0123355_1000060715 232
13 3300009826 Ga0123355_10163441 Ga0123355_101634412 232
14 3300042611 Ga0466697_004429 Ga0466697_004429_1883_2614 232
15 3300010049 Ga0123356_10283279 Ga0123356_102832792 233
16 3300042603 Ga0466714_026296 Ga0466714_026296_7256_8005 236
17 3300038395 Ga0415639_072191 Ga0415639_072191_999_1712 237
18 3300002462 JGI24702J35022_10010650 JGI24702J35022_100106503 242
19 3300005201 Ga0072941_1000469 Ga0072941_10004693 242
20 3300002507 JGI24697J35500_11224257 JGI24697J35500_112242572 243
21 3300010167 Ga0123353_10978524 Ga0123353_109785242 243
22 3300042550 Ga0466656_371573 Ga0466656_371573_542_1273 243
23 3300042592 Ga0466693_402206 Ga0466693_402206_12568_13299 243
24 3300042597 Ga0466699_196405 Ga0466699_196405_2038_2769 243
25 3300042602 Ga0466713_065300 Ga0466713_065300_391_1122 243
26 3300042603 Ga0466714_001358 Ga0466714_001358_115_846 243
27 3300042603 Ga0466714_060578 Ga0466714_060578_440_1171 243
28 3300042611 Ga0466697_073743 Ga0466697_073743_116_847 243
29 3300042622 Ga0466731_053035 Ga0466731_053035_3473_4204 243
30 3300042623 Ga0466734_075402 Ga0466734_075402_314_1063 243
31 3300010049 Ga0123356_10035636 Ga0123356_100356362 244
32 3300010049 Ga0123356_10096126 Ga0123356_100961263 244
33 3300010167 Ga0123353_10064671 Ga0123353_100646716 244
34 3300010167 Ga0123353_10492989 Ga0123353_104929892 244
35 3300010167 Ga0123353_11564932 Ga0123353_115649321 244
36 3300042601 Ga0466707_304216 Ga0466707_304216_736_1470 244
37 3300042602 Ga0466713_059062 Ga0466713_059062_43994_44728 244
38 3300042616 Ga0466715_295640 Ga0466715_295640_75826_76560 244
39 3300042648 Ga0466709_240899 Ga0466709_240899_30627_31361 244
40 3300010167 Ga0123353_10506783 Ga0123353_105067832 245
41 3300042594 Ga0466694_405209 Ga0466694_405209_2230_3006 245
42 3300010049 Ga0123356_10054334 Ga0123356_100543342 246
43 3300042606 Ga0466719_226791 Ga0466719_226791_2148_2924 246
44 iso_pr_bacteria 2820282995 2820284430 247
45 3300010049 Ga0123356_10199345 Ga0123356_101993452 248
46 3300042612 Ga0466705_421583 Ga0466705_421583_306_1055 249
47 3300042615 Ga0466711_233007 Ga0466711_233007_2166_2915 249
48 3300042636 Ga0466703_145380 Ga0466703_145380_3642_4391 249
49 3300042643 Ga0466704_551580 Ga0466704_551580_151_900 249
50 3300042652 Ga0466708_443532 Ga0466708_443532_1220_1969 249
51 3300010049 Ga0123356_10000262 Ga0123356_1000026217 250
52 3300010049 Ga0123356_10017513 Ga0123356_100175134 250
53 3300010167 Ga0123353_10000925 Ga0123353_100009258 250
54 3300010167 Ga0123353_10001599 Ga0123353_100015998 250
55 3300010167 Ga0123353_10154773 Ga0123353_101547734 250
56 3300010167 Ga0123353_10369088 Ga0123353_103690882 250
57 3300042608 Ga0466721_168866 Ga0466721_168866_203_967 254
58 3300010167 Ga0123353_10203808 Ga0123353_102038082 255
59 3300005201 Ga0072941_1045122 Ga0072941_10451225 257
60 iso_pr_bacteria 2775507073 2777018662 257
61 iso_pr_bacteria 2820573558 2820573641 257
62 iso_pr_bacteria 8018794549 8018797580 257
63 2225789004 2227191897 2227613633 258
64 2225789004 2227588797 2228145937 258
65 3300002450 JGI24695J34938_10004699 JGI24695J34938_100046992 258
66 3300002450 JGI24695J34938_10066246 JGI24695J34938_100662462 258
67 3300005201 Ga0072941_1050903 Ga0072941_10509037 258
68 3300009784 Ga0123357_10037814 Ga0123357_100378143 258
69 3300038395 Ga0415639_059900 Ga0415639_059900_918_1694 258
70 3300042591 Ga0466692_101006 Ga0466692_101006_302_1078 258
71 3300042596 Ga0466696_314208 Ga0466696_314208_17_793 258
72 3300042600 Ga0466700_226234 Ga0466700_226234_715_1491 258
73 3300042603 Ga0466714_032719 Ga0466714_032719_237_1013 258
74 3300042603 Ga0466714_045116 Ga0466714_045116_2858_3634 258
75 3300042603 Ga0466714_053105 Ga0466714_053105_122_898 258
76 3300042603 Ga0466714_118974 Ga0466714_118974_1286_2062 258
77 3300042603 Ga0466714_132839 Ga0466714_132839_3310_4086 258
78 3300042604 Ga0466717_204066 Ga0466717_204066_983_1759 258
79 3300042609 Ga0466722_102990 Ga0466722_102990_887_1663 258
80 3300042609 Ga0466722_136743 Ga0466722_136743_17897_18673 258
81 3300042612 Ga0466705_239567 Ga0466705_239567_531_1307 258
82 3300042612 Ga0466705_306648 Ga0466705_306648_4297_5073 258
83 3300042616 Ga0466715_429206 Ga0466715_429206_24474_25250 258
84 3300042617 Ga0466718_029414 Ga0466718_029414_155_931 258
85 3300042617 Ga0466718_169460 Ga0466718_169460_598_1374 258
86 3300042621 Ga0466729_013325 Ga0466729_013325_930_1706 258
87 3300042643 Ga0466704_020045 Ga0466704_020045_2553_3329 258
88 3300042643 Ga0466704_526762 Ga0466704_526762_1080_1856 258
89 3300042649 Ga0466724_23477 Ga0466724_23477_1051_1827 258
90 3300056790 Ga0562379_0092 Ga0562379_0092_296171_296947 258
91 iso_pr_bacteria 2585428085 2587833199 258
92 iso_pr_bacteria 2781125694 2781435095 258
93 iso_pr_bacteria 2820072841 2820073593 258
94 iso_pr_bacteria 2820227065 2820228195 258
95 iso_pr_bacteria 2820238527 2820239108 258
96 iso_pr_bacteria 2820246658 2820246769 258
97 iso_pr_bacteria 2820336130 2820336820 258
98 iso_pr_bacteria 2820353569 2820356806 258
99 iso_pr_bacteria 2820362221 2820363062 258
100 iso_pr_bacteria 2820414148 2820415520 258
101 iso_pr_bacteria 2820495292 2820496741 258
102 iso_pr_bacteria 2820547636 2820549849 258
103 iso_pr_bacteria 2820576413 2820577538 258
104 iso_pr_bacteria 2820594669 2820595513 258
105 iso_pr_bacteria 2820916033 2820916415 258
106 iso_pr_bacteria 2881375749 2881376538 258
107 iso_pr_bacteria 8002299145 8002304207 258
108 2225789004 2227657958 2228257083 259
109 3300000062 IMNBL1DRAFT_c0000021 IMNBL1DRAFT_0000021116 259
110 3300002462 JGI24702J35022_10000169 JGI24702J35022_100001698 259
111 3300002462 JGI24702J35022_10009084 JGI24702J35022_100090846 259
112 3300002462 JGI24702J35022_10016178 JGI24702J35022_100161785 259
113 3300002462 JGI24702J35022_10064942 JGI24702J35022_100649423 259
114 3300005201 Ga0072941_1000468 Ga0072941_10004685 259
115 3300005201 Ga0072941_1033578 Ga0072941_10335782 259
116 3300005201 Ga0072941_1044882 Ga0072941_10448824 259
117 3300009784 Ga0123357_10203112 Ga0123357_102031123 259
118 3300009784 Ga0123357_10421814 Ga0123357_104218141 259
119 3300009826 Ga0123355_10000537 Ga0123355_1000053742 259
120 3300009826 Ga0123355_10016922 Ga0123355_100169224 259
121 3300009826 Ga0123355_10344149 Ga0123355_103441491 259
122 3300009826 Ga0123355_10380446 Ga0123355_103804462 259
123 3300010049 Ga0123356_10003321 Ga0123356_100033217 259
124 3300010049 Ga0123356_10050902 Ga0123356_100509022 259
125 3300010049 Ga0123356_10118905 Ga0123356_101189054 259
126 3300010049 Ga0123356_10264490 Ga0123356_102644903 259
127 3300010049 Ga0123356_10310209 Ga0123356_103102092 259
128 3300010049 Ga0123356_10761253 Ga0123356_107612532 259
129 3300010167 Ga0123353_10136036 Ga0123353_101360361 259
130 3300010167 Ga0123353_10179356 Ga0123353_101793562 259
131 3300010167 Ga0123353_10384437 Ga0123353_103844371 259
132 3300010167 Ga0123353_10415073 Ga0123353_104150732 259
133 3300010167 Ga0123353_10586241 Ga0123353_105862412 259
134 3300010167 Ga0123353_10632799 Ga0123353_106327992 259
135 3300010167 Ga0123353_10797981 Ga0123353_107979812 259
136 3300010882 Ga0123354_10481548 Ga0123354_104815481 259
137 3300056814 Ga0562378_0193 Ga0562378_0193_26462_27241 259
138 3300056856 Ga0562375_3733 Ga0562375_3733_5581_6360 259
139 iso_pr_bacteria 2820422691 2820423092 259
140 3300042649 Ga0466724_56697 Ga0466724_56697_1492_2274 260
141 3300012825 Ga0160441_100316 Ga0160441_10031627 261
142 3300005083 Ga0068305_10002300 Ga0068305_100023002 262
143 iso_pr_bacteria 2820371985 2820373047 262
144 iso_pr_bacteria 2820854745 2820856445 262
145 3300010167 Ga0123353_10044079 Ga0123353_100440792 263
146 iso_pr_bacteria 2781125650 2781308217 263
147 3300002450 JGI24695J34938_10000267 JGI24695J34938_1000026730 264
148 3300002450 JGI24695J34938_10000701 JGI24695J34938_1000070122 264
149 3300042600 Ga0466700_469769 Ga0466700_469769_580_1374 264
150 3300002450 JGI24695J34938_10048506 JGI24695J34938_100485062 266
151 iso_pr_bacteria 2820800812 2820801828 273
152 3300002462 JGI24702J35022_10051644 JGI24702J35022_100516442 275

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF06182 ABC2_membrane_6 ABC-2 family transporter protein 47 273 0.96

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.