Protein Family IF00800

Metagenome Isolate
168 Members
78 Samples
132 Scaffolds
96.99 Avg Length

🧬 Representative Sequence

ID
3300002462|JGI24702J35022_10030614|JGI24702J35022_100306145
Length
101 aa
Sequence
MKTRTAYDIVIKPVISEQSMDAAANEVKKYTFKVSLDANKTEVKSALEEIFGISIKKVNIMNVRGKKIRMGRNVGHASSSKKAIVTLTSKSKEIEFFQGL*

📊 Sample Types

Isolate 21.4%
Metagenome 78.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Drosophilidae 23.3%
Unclassified 21.9%
Termitidae 21.9%
Kalotermitidae 13.7%
Rhinotermitidae 4.1%
Passalidae 4.1%
Termopsidae 4.1%
Tenebrionidae 2.7%
Blattidae 1.4%
Hodotermitidae 1.4%
Apidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 163
Eukaryota 0
Viruses 1
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940228231 Anaerovoracaceae bacterium PM5-7 Isolate Blattidae
2 2964778705 Lactiplantibacillus plantarum DietG20.2.2_EE Isolate Unclassified
3 2597490293 Lactiplantibacillus plantarum DmCS_001 Isolate Drosophilidae
4 2718218475 Lactiplantibacillus plantarum KP Isolate Drosophilidae
5 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
6 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
7 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
8 2970225615 Lactiplantibacillus plantarum FlyG8.1.1 Isolate Drosophilidae
9 2977628635 Lactiplantibacillus plantarum FlyG3.1.8 Isolate Drosophilidae
10 2977653127 Lactiplantibacillus plantarum FlyG10.1.5 Isolate Drosophilidae
11 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
12 2821322763 Unclassified Actinobacteria Cu122P5bin19 Isolate Unclassified
13 2964775400 Lactiplantibacillus plantarum FlyG2.1.8 Isolate Unclassified
14 2728369362 Lactiplantibacillus plantarum DF Isolate Drosophilidae
15 2820353569 Unclassified Firmicutes Nt197P3bin28 Isolate Unclassified
16 2820593525 Unclassified Firmicutes Emb289P1bin7 Isolate Unclassified
17 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
18 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
19 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
20 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
21 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
22 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
23 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
24 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
25 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
26 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
27 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
28 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
29 2970199020 Lactiplantibacillus plantarum FlyG8.1.2 Isolate Drosophilidae
30 2977635137 Lactiplantibacillus plantarum DietG20.1.2 Isolate Unclassified
31 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
32 2820942695 Unclassified Actinobacteria Cu122P5bin37 Isolate Unclassified
33 2964739456 Lactiplantibacillus plantarum FlyG10.1.9 Isolate Drosophilidae
34 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
35 2690315820 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
36 2820314258 Unclassified Firmicutes Nt197P4bin16 Isolate Unclassified
37 2820340373 Unclassified Firmicutes Nt197P3bin67 Isolate Unclassified
38 2820357977 Unclassified Firmicutes Nt197P3bin136 Isolate Unclassified
39 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
40 2960772748 Lactiplantibacillus plantarum MHO2.9 Isolate
41 2964765680 Lactiplantibacillus plantarum MHO2.5 Isolate
42 2937236879 Lactiplantibacillus plantarum MHO2.4 Isolate
43 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
44 2576861670 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
45 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
46 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
47 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
48 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
49 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
50 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
51 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
52 2967825073 Lactiplantibacillus plantarum FlyG9.1.4 Isolate Drosophilidae
53 2970254690 Lactiplantibacillus plantarum FlyG9.2.5 Isolate Drosophilidae
54 2977596371 Lactiplantibacillus plantarum FlyG11.2.6 Isolate Drosophilidae
55 2977622177 Lactiplantibacillus plantarum FlyG20.2.6 Isolate Drosophilidae
56 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
57 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
58 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
59 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
60 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
61 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
62 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
63 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
64 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
65 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
66 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
67 2957623355 Lactiplantibacillus plantarum FlyG11.1.2 Isolate Drosophilidae
68 2820223845 Unclassified Firmicutes Th196P4bin57 Isolate Unclassified
69 2967802344 Lactiplantibacillus plantarum FlyG11.1.6 Isolate Drosophilidae
70 2977592972 Lactiplantibacillus plantarum FlyG7.1.6 Isolate Drosophilidae
71 2770939318 Lactiplantibacillus plantarum plantarum LP2 Isolate Apidae
72 2820234266 Unclassified Firmicutes Th196P3bin99 Isolate Unclassified
73 2820324456 Unclassified Firmicutes Nt197P3bin80 Isolate Unclassified
74 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
75 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
76 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
77 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
78 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0415639_042237 3300038395 Bacteria 3821
2 Ga0415639_222587 3300038395 Bacteria 1055
3 Ga0466694_152665 3300042594 Bacteria 1927
4 Ga0466706_067390 3300042599 Bacteria 55994
5 Ga0466707_102772 3300042601 Bacteria 10357
6 Ga0466707_184562 3300042601 Bacteria 1849
7 Ga0466707_233622 3300042601 Bacteria 11636
8 Ga0466713_025156 3300042602 Bacteria 41607
9 Ga0466716_326577 3300042605 Bacteria 1455
10 Ga0466708_053951 3300042652 Bacteria 19818
11 Ga0123356_10186151 3300010049 Bacteria 2103
12 Ga0123356_11309821 3300010049 Bacteria 887
13 Ga0123353_10011361 3300010167 Bacteria 12538
14 Ga0123353_10656134 3300010167 Bacteria 1484
15 Ga0123353_12652607 3300010167 Bacteria 591
16 JGI24702J35022_10092637 3300002462 Bacteria 1646
17 Ga0466705_357809 3300042612 Bacteria 37083
18 Ga0466733_177539 3300042659 Bacteria 3760
19 Ga0466714_074567 3300042603 Bacteria 3607
20 Ga0466704_504531 3300042643 Bacteria 2725
21 Ga0466727_125041 3300042655 Bacteria 24880
22 Ga0466727_173213 3300042655 Bacteria 5438
23 Ga0123356_10074722 3300010049 Bacteria 3190
24 Ga0123356_13701311 3300010049 Bacteria 529
25 Ga0123353_10661432 3300010167 Unclassified 1476
26 Ga0123353_10904059 3300010167 Bacteria 1201
27 Ga0123354_10329739 3300010882 Bacteria 1393
28 Ga0123354_10548931 3300010882 Bacteria 872
29 2226997878 2225789003 Bacteria 1393
30 Ga0068305_10053891 3300005083 Bacteria 797
31 Ga0466707_334939 3300042601 Bacteria 1924
32 Ga0466703_432779 3300042636 Bacteria 1158
33 Ga0466727_238242 3300042655 Bacteria 4231
34 Ga0123357_10008010 3300009784 Bacteria 13145
35 Ga0123357_10177510 3300009784 Bacteria 2499
36 Ga0123356_10208283 3300010049 Bacteria 2001
37 Ga0123353_10288314 3300010167 Bacteria 2515
38 Ga0123353_11205274 3300010167 Bacteria 993
39 Ga0123353_12002438 3300010167 Bacteria 709
40 Ga0072941_1802557 3300005201 Bacteria 593
41 Ga0466715_430157 3300042616 Bacteria 1768
42 Ga0466726_380315 3300042619 Bacteria 17436
43 Ga0466726_490577 3300042619 Bacteria 1991
44 Ga0562378_0008 3300056814 Bacteria 1370151
45 Ga0562374_0010 3300057007 Bacteria 1930599
46 Ga0466692_196296 3300042591 Bacteria 21527
47 Ga0466696_410938 3300042596 Bacteria 3488
48 Ga0466703_069285 3300042636 Bacteria 1762
49 Ga0466724_60490 3300042649 Bacteria 1347
50 Ga0123357_10419738 3300009784 Bacteria 1195
51 Ga0123356_10173666 3300010049 Bacteria 2169
52 Ga0123356_12126340 3300010049 Unclassified 701
53 Ga0123356_12361247 3300010049 Bacteria 665
54 Ga0123356_13128353 3300010049 Bacteria 577
55 Ga0123353_10242048 3300010167 Bacteria 2802
56 Ga0123353_11849754 3300010167 Bacteria 748
57 2227292754 2225789004 Bacteria 1237
58 2227484594 2225789004 Bacteria 826
59 JGI24705J35276_12238163 3300002504 Bacteria 16705
60 Ga0466728_056079 3300042620 Bacteria 1820
61 Ga0466728_286502 3300042620 Bacteria 4876
62 Ga0466733_155293 3300042659 Bacteria 1129
63 Ga0466696_351559 3300042596 Bacteria 3144
64 Ga0466707_132787 3300042601 Bacteria 13579
65 Ga0466713_003867 3300042602 Bacteria 2180
66 Ga0466713_019517 3300042602 Bacteria 68401
67 Ga0466719_192219 3300042606 Bacteria 3159
68 Ga0466697_011595 3300042611 Bacteria 1679
69 Ga0466697_045709 3300042611 Bacteria 2838
70 Ga0466729_318294 3300042621 Bacteria 2165
71 Ga0466703_178525 3300042636 Bacteria 4000
72 Ga0123357_10293523 3300009784 Bacteria 1656
73 Ga0123353_10418931 3300010167 Bacteria 1985
74 Ga0123353_12104570 3300010167 Bacteria 687
75 Ga0123353_13436567 3300010167 Unclassified 502
76 Ga0123354_10804061 3300010882 Bacteria 633
77 JGI24702J35022_10030614 3300002462 Bacteria 2887
78 JGI24702J35022_10088061 3300002462 Bacteria 1687
79 Ga0466723_045923 3300042618 Bacteria 2017
80 Ga0466705_328934 3300042612 Bacteria 14345
81 Ga0415639_003419 3300038395 Bacteria 52955
82 Ga0466693_280489 3300042592 Bacteria 6424
83 Ga0466696_107424 3300042596 Bacteria 4481
84 Ga0466696_366705 3300042596 Bacteria 1619
85 Ga0466706_197359 3300042599 Bacteria 1299
86 Ga0466707_164538 3300042601 Bacteria 30398
87 Ga0466713_020962 3300042602 Bacteria 8387
88 Ga0466719_576574 3300042606 Bacteria 2864
89 Ga0466722_227979 3300042609 Bacteria 1882
90 Ga0466703_007544 3300042636 Bacteria 5013
91 Ga0123357_10682380 3300009784 Viruses 745
92 Ga0123356_10357426 3300010049 Bacteria 1586
93 Ga0123353_10301274 3300010167 Bacteria 2447
94 Ga0123354_10337808 3300010882 Bacteria 1362
95 2227263586 2225789004 Unclassified 1293
96 IMNBL1DRAFT_c0011650 3300000062 Bacteria 4091
97 JGI24702J35022_10310123 3300002462 Bacteria 933
98 JGI24703J35330_10989483 3300002501 Bacteria 626
99 Ga0068305_10001103 3300005083 Bacteria 12271
100 Ga0466718_092693 3300042617 Bacteria 1776
101 Ga0466726_134894 3300042619 Bacteria 3883
102 Ga0466733_188130 3300042659 Bacteria 1258
103 Ga0466713_128565 3300042602 Bacteria 50941
104 Ga0466719_154671 3300042606 Bacteria 7680
105 Ga0466703_190990 3300042636 Bacteria 1926
106 Ga0466727_309610 3300042655 Bacteria 3880
107 Ga0123357_10007340 3300009784 Bacteria 13611
108 Ga0123356_10612935 3300010049 Bacteria 1254
109 Ga0123353_10738359 3300010167 Bacteria 1373
110 Ga0123353_12306790 3300010167 Bacteria 647
111 Ga0123354_10276353 3300010882 Bacteria 1641
112 2227466613 2225789004 Bacteria 5110
113 IMNBL1DRAFT_c0000333 3300000062 Bacteria 40018
114 IMNBL1DRAFT_c0013785 3300000062 Bacteria 3602
115 Ga0068302_10659312 3300005071 Bacteria 549
116 Ga0068305_10398524 3300005083 Bacteria 1211
117 Ga0466726_069136 3300042619 Bacteria 3824
118 Ga0466696_108488 3300042596 Bacteria 3212
119 Ga0466700_249443 3300042600 Bacteria 1121
120 Ga0466707_179833 3300042601 Bacteria 4599
121 Ga0466704_031146 3300042643 Bacteria 38318
122 Ga0123357_10261271 3300009784 Bacteria 1830
123 Ga0123356_10233182 3300010049 Bacteria 1906
124 Ga0123356_10585212 3300010049 Bacteria 1280
125 Ga0123353_10241410 3300010167 Bacteria 2807
126 Ga0123354_10102511 3300010882 Bacteria 3856
127 Ga0123354_10344819 3300010882 Bacteria 1337
128 FGTW_GHRKC7402J1X4E 2065487013 Bacteria 522
129 JGI24705J35276_12200086 3300002504 Bacteria 1596
130 Ga0466726_060368 3300042619 Bacteria 11472
131 Ga0466726_364461 3300042619 Bacteria 33247
132 Ga0466728_082463 3300042620 Bacteria 32980

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00276 Ribosomal_L23 Ribosomal protein L23 8 92 0.93

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.