Protein Family IF00794

Metagenome Metatranscriptome Isolate
169 Members
58 Samples
164 Scaffolds
149.28 Avg Length

🧬 Representative Sequence

ID
3300002462|JGI24702J35022_10018457|JGI24702J35022_100184572
Length
154 aa
Sequence
VKVATKAYGLIDVDERQKIVFPQGLFGFEKLKDYLLLDAERQPFYWLQSMDVEQVAFVLVNPFLFRPDYEVNIGNEEMAEIGIYSPEKALIFSIVTIPNDNGPMTANLQGPLIISRDTRTGKQAVLTDIRWKTKHDIMAELSSPAESAGTGNS*

📊 Sample Types

Isolate 3.0%
Metagenome 95.3%
MAG 0.0%
Metatranscriptome 1.8%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 50.9%
Kalotermitidae 25.5%
Unclassified 12.7%
Rhinotermitidae 5.5%
Termopsidae 5.5%

🌳 Taxonomy

Archaea 3
Bacteria 159
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125683 Treponema sp. Lab288P1bin34 Isolate Unclassified
2 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
3 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
4 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
8 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
9 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
10 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
11 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
12 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
13 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
14 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
15 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
16 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
17 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
18 3300021235 Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA Metatranscriptome
19 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
20 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
21 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
22 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
23 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
24 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
25 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
26 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
27 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
28 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
29 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
30 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
31 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
32 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
33 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
34 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
35 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
36 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
37 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
38 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
39 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
40 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
41 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
42 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
43 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
44 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
45 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
46 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
47 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
48 2781125686 Treponema sp. Lab288P4bin22 Isolate Unclassified
49 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
50 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
51 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
52 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
53 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
54 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
55 2772190978 Treponema sp. Nt197P3bin57 Isolate Unclassified
56 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
57 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
58 3300022815 Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA Metatranscriptome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_013636 3300042656 Bacteria 2595
2 Ga0466731_373685 3300042622 Bacteria 6073
3 Ga0466703_017123 3300042636 Bacteria 35631
4 Ga0466704_223677 3300042643 Bacteria 60624
5 Ga0466712_124295 3300042614 Archaea 4890
6 Ga0466718_006770 3300042617 Bacteria 8586
7 Ga0466718_073737 3300042617 Bacteria 2562
8 Ga0466723_163368 3300042618 Bacteria 10632
9 Ga0466720_158102 3300042607 Bacteria 24079
10 Ga0466722_252778 3300042609 Unclassified 1319
11 Ga0255786_1019489 3300022815 Bacteria 1163
12 Ga0415639_079066 3300038395 Bacteria 5635
13 Ga0466692_013015 3300042591 Bacteria 22521
14 Ga0466699_057782 3300042597 Bacteria 4143
15 JGI24695J34938_10056180 3300002450 Bacteria 1698
16 Ga0466732_016257 3300042656 Bacteria 1480
17 Ga0466733_093021 3300042659 Bacteria 3523
18 Ga0466702_225123 3300042635 Bacteria 1530
19 Ga0466702_361540 3300042635 Bacteria 12897
20 Ga0466702_429871 3300042635 Bacteria 4826
21 Ga0466703_076898 3300042636 Bacteria 76177
22 Ga0466703_107854 3300042636 Bacteria 2048
23 Ga0123357_10674019 3300009784 Bacteria 754
24 Ga0466715_021799 3300042616 Bacteria 20987
25 Ga0466715_534170 3300042616 Bacteria 5148
26 Ga0466723_113343 3300042618 Bacteria 4611
27 Ga0466723_347993 3300042618 Bacteria 25507
28 Ga0466726_110194 3300042619 Bacteria 1519
29 Ga0466717_233010 3300042604 Bacteria 4877
30 Ga0466719_055250 3300042606 Bacteria 2093
31 Ga0466722_082964 3300042609 Bacteria 56291
32 Ga0415639_062647 3300038395 Bacteria 5551
33 Ga0466690_232841 3300042590 Bacteria 1051
34 Ga0466691_082912 3300042593 Bacteria 11098
35 Ga0466696_437756 3300042596 Bacteria 21554
36 Ga0466699_116249 3300042597 Bacteria 1495
37 Ga0466699_189632 3300042597 Bacteria 1312
38 AustNasuHG_c1006871 3300000089 Bacteria 4055
39 AustNasuHG_c1019366 3300000089 Bacteria 2234
40 JGI24698J34947_10016695 3300002449 Bacteria 3983
41 JGI24698J34947_10152179 3300002449 Bacteria 959
42 Ga0072941_1001996 3300005201 Bacteria 50262
43 Ga0466705_194967 3300042612 Bacteria 17387
44 Ga0466734_017353 3300042623 Archaea 1692
45 Ga0466708_226192 3300042652 Bacteria 21675
46 Ga0466727_104113 3300042655 Bacteria 1132
47 Ga0466727_187777 3300042655 Bacteria 1456
48 Ga0123356_10015636 3300010049 Bacteria 7269
49 Ga0466712_062478 3300042614 Bacteria 1665
50 Ga0466711_150674 3300042615 Bacteria 1504
51 Ga0466715_156670 3300042616 Bacteria 2563
52 Ga0466718_047698 3300042617 Bacteria 18884
53 Ga0466718_058094 3300042617 Bacteria 1483
54 Ga0466700_373484 3300042600 Bacteria 3894
55 Ga0466722_240551 3300042609 Bacteria 5200
56 Ga0466698_055106 3300042610 Bacteria 1167
57 Ga0415639_066280 3300038395 Bacteria 6955
58 Ga0466699_150851 3300042597 Bacteria 1619
59 Ga0466699_280197 3300042597 Bacteria 29264
60 JGI24698J34947_10011845 3300002449 Bacteria 4790
61 JGI24698J34947_10058940 3300002449 Unclassified 1899
62 JGI24695J34938_10000097 3300002450 Bacteria 77191
63 Ga0072940_1261790 3300005200 Bacteria 1035
64 Ga0072941_1007276 3300005201 Bacteria 15345
65 Ga0072941_1076578 3300005201 Archaea 3392
66 Ga0466732_220202 3300042656 Bacteria 16700
67 Ga0466729_222096 3300042621 Bacteria 1208
68 Ga0466731_383280 3300042622 Bacteria 1550
69 Ga0466703_398003 3300042636 Bacteria 19717
70 Ga0123356_12142938 3300010049 Bacteria 698
71 Ga0466718_004842 3300042617 Bacteria 5578
72 Ga0466723_046084 3300042618 Bacteria 2846
73 Ga0466700_069688 3300042600 Bacteria 1289
74 Ga0466716_022043 3300042605 Bacteria 17765
75 Ga0466720_028491 3300042607 Bacteria 76920
76 Ga0466720_081792 3300042607 Unclassified 1087
77 Ga0466720_160270 3300042607 Bacteria 11001
78 Ga0255786_1022676 3300022815 Bacteria 1460
79 Ga0466691_038919 3300042593 Bacteria 7674
80 Ga0466695_139683 3300042595 Bacteria 7187
81 AustNasuHG_c1003723 3300000089 Bacteria 5501
82 JGI24698J34947_10115554 3300002449 Bacteria 1175
83 Ga0072941_1007278 3300005201 Bacteria 12191
84 Ga0466705_122560 3300042612 Bacteria 12586
85 Ga0466705_135090 3300042612 Bacteria 5840
86 Ga0466731_321802 3300042622 Bacteria 2248
87 Ga0466735_040594 3300042624 Bacteria 1559
88 Ga0466709_037852 3300042648 Bacteria 1023
89 Ga0466708_174074 3300042652 Bacteria 3104
90 Ga0466715_203763 3300042616 Bacteria 11123
91 Ga0466718_008845 3300042617 Bacteria 21310
92 Ga0466718_109290 3300042617 Bacteria 5048
93 Ga0466718_167744 3300042617 Bacteria 22582
94 Ga0466723_242806 3300042618 Bacteria 2206
95 Ga0466726_172836 3300042619 Bacteria 1599
96 Ga0466717_278120 3300042604 Bacteria 1488
97 Ga0466720_171676 3300042607 Bacteria 6340
98 Ga0466690_157350 3300042590 Bacteria 22224
99 Ga0466693_050847 3300042592 Bacteria 28647
100 AustNasuHG_c1006711 3300000089 Bacteria 4103
101 JGI24698J34947_10015062 3300002449 Bacteria 4212
102 JGI24698J34947_10051793 3300002449 Bacteria 2063
103 JGI24698J34947_10120883 3300002449 Bacteria 1137
104 JGI24695J34938_10242578 3300002450 Bacteria 762
105 Ga0072940_1007819 3300005200 Bacteria 4449
106 Ga0072940_1016297 3300005200 Bacteria 1701
107 Ga0072940_1105793 3300005200 Bacteria 2399
108 Ga0072941_1009885 3300005201 Bacteria 5272
109 Ga0466709_350218 3300042648 Bacteria 8916
110 Ga0466712_027757 3300042614 Bacteria 8219
111 Ga0466712_073702 3300042614 Bacteria 60864
112 Ga0466712_118083 3300042614 Bacteria 55745
113 Ga0466712_226326 3300042614 Bacteria 1666
114 Ga0466718_015379 3300042617 Bacteria 1830
115 Ga0466718_146821 3300042617 Bacteria 2622
116 Ga0466716_451875 3300042605 Bacteria 3348
117 Ga0466719_002364 3300042606 Bacteria 1415
118 Ga0466719_059689 3300042606 Bacteria 1115
119 Ga0466694_111332 3300042594 Bacteria 3935
120 Ga0466694_161348 3300042594 Bacteria 1132
121 JGI24698J34947_10092502 3300002449 Unclassified 1383
122 Ga0072941_1017600 3300005201 Bacteria 10304
123 Ga0074263_113797 3300005485 Bacteria 982
124 Ga0466731_386095 3300042622 Bacteria 1078
125 Ga0466704_469298 3300042643 Bacteria 3261
126 Ga0466709_335377 3300042648 Bacteria 5719
127 Ga0466708_375935 3300042652 Bacteria 3764
128 Ga0123353_10033662 3300010167 Bacteria 7983
129 Ga0123353_10668217 3300010167 Bacteria 1466
130 Ga0123354_10138275 3300010882 Bacteria 3031
131 Ga0466715_616117 3300042616 Bacteria 6784
132 Ga0466718_134911 3300042617 Bacteria 1533
133 Ga0466726_252686 3300042619 Bacteria 1268
134 Ga0466728_052793 3300042620 Bacteria 9831
135 Ga0466707_138789 3300042601 Bacteria 4348
136 Ga0466720_054851 3300042607 Bacteria 12122
137 Ga0466720_144373 3300042607 Bacteria 2288
138 Ga0466722_035337 3300042609 Bacteria 4158
139 Ga0466691_072184 3300042593 Bacteria 1898
140 Ga0466699_060836 3300042597 Bacteria 1262
141 JGI24695J34938_10005114 3300002450 Bacteria 8316
142 JGI24702J35022_10018457 3300002462 Bacteria 3804
143 Ga0072941_1002436 3300005201 Bacteria 26455
144 Ga0072941_1076224 3300005201 Bacteria 647
145 Ga0072941_1076225 3300005201 Bacteria 944
146 Ga0466704_174279 3300042643 Bacteria 23732
147 Ga0466704_289368 3300042643 Bacteria 1239
148 Ga0466709_151475 3300042648 Bacteria 1822
149 Ga0466712_113449 3300042614 Bacteria 20871
150 Ga0466712_127790 3300042614 Bacteria 1852
151 Ga0466712_300803 3300042614 Bacteria 1140
152 Ga0466713_071673 3300042602 Bacteria 11531
153 Ga0466719_011211 3300042606 Bacteria 1911
154 Ga0466720_076925 3300042607 Bacteria 14944
155 Ga0466721_353194 3300042608 Bacteria 2602
156 Ga0223674_1003478 3300021235 Bacteria 2924
157 Ga0264413_102342 3300024493 Unclassified 2468
158 Ga0466695_262369 3300042595 Bacteria 61208
159 AustNasuHG_c1000346 3300000089 Bacteria 16163
160 JGI24698J34947_10031311 3300002449 Bacteria 2801
161 JGI24698J34947_10047081 3300002449 Unclassified 2191
162 JGI24698J34947_10062493 3300002449 Bacteria 1828
163 JGI24698J34947_10307199 3300002449 Unclassified 569
164 Ga0074263_106301 3300005485 Bacteria 1895

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300024493 Ga0264413_102342 Ga0264413_1023423 124
2 3300042659 Ga0466733_093021 Ga0466733_093021_238_657 139
3 3300005200 Ga0072940_1016297 Ga0072940_10162972 141
4 3300042600 Ga0466700_373484 Ga0466700_373484_2874_3359 144
5 3300038395 Ga0415639_066280 Ga0415639_066280_2702_3139 145
6 3300038395 Ga0415639_079066 Ga0415639_079066_868_1305 145
7 3300042592 Ga0466693_050847 Ga0466693_050847_18230_18667 145
8 3300042597 Ga0466699_057782 Ga0466699_057782_969_1475 145
9 3300042606 Ga0466719_002364 Ga0466719_002364_543_980 145
10 3300042610 Ga0466698_055106 Ga0466698_055106_346_783 145
11 3300042635 Ga0466702_225123 Ga0466702_225123_896_1333 145
12 3300042635 Ga0466702_361540 Ga0466702_361540_9751_10188 145
13 3300042635 Ga0466702_429871 Ga0466702_429871_909_1346 145
14 3300021235 Ga0223674_1003478 Ga0223674_10034783 146
15 3300022815 Ga0255786_1019489 Ga0255786_10194892 146
16 3300042590 Ga0466690_157350 Ga0466690_157350_4287_4727 146
17 3300042595 Ga0466695_139683 Ga0466695_139683_6207_6647 146
18 3300042597 Ga0466699_060836 Ga0466699_060836_718_1158 146
19 3300042597 Ga0466699_116249 Ga0466699_116249_857_1297 146
20 3300042597 Ga0466699_150851 Ga0466699_150851_134_574 146
21 3300042597 Ga0466699_280197 Ga0466699_280197_13260_13700 146
22 3300042612 Ga0466705_135090 Ga0466705_135090_560_1000 146
23 3300042614 Ga0466712_027757 Ga0466712_027757_753_1193 146
24 3300042614 Ga0466712_062478 Ga0466712_062478_414_854 146
25 3300042614 Ga0466712_073702 Ga0466712_073702_59854_60294 146
26 3300042614 Ga0466712_113449 Ga0466712_113449_16260_16700 146
27 3300042614 Ga0466712_118083 Ga0466712_118083_25293_25733 146
28 3300042614 Ga0466712_226326 Ga0466712_226326_470_910 146
29 3300042616 Ga0466715_616117 Ga0466715_616117_1199_1639 146
30 3300042617 Ga0466718_015379 Ga0466718_015379_56_496 146
31 3300042617 Ga0466718_058094 Ga0466718_058094_809_1249 146
32 3300042617 Ga0466718_146821 Ga0466718_146821_849_1289 146
33 3300042623 Ga0466734_017353 Ga0466734_017353_1128_1568 146
34 3300042636 Ga0466703_017123 Ga0466703_017123_12885_13325 146
35 3300042643 Ga0466704_223677 Ga0466704_223677_31111_31551 146
36 3300042643 Ga0466704_289368 Ga0466704_289368_124_564 146
37 3300042648 Ga0466709_037852 Ga0466709_037852_526_966 146
38 3300042656 Ga0466732_013636 Ga0466732_013636_2109_2549 146
39 iso_pr_bacteria 2781125634 2781275385 146
40 iso_pr_bacteria 2781125686 2781419317 146
41 3300000089 AustNasuHG_c1006711 AustNasuHG_10067114 147
42 3300000089 AustNasuHG_c1006871 AustNasuHG_10068713 147
43 3300002449 JGI24698J34947_10011845 JGI24698J34947_100118453 147
44 3300002449 JGI24698J34947_10015062 JGI24698J34947_100150623 147
45 3300002449 JGI24698J34947_10016695 JGI24698J34947_100166953 147
46 3300002449 JGI24698J34947_10031311 JGI24698J34947_100313112 147
47 3300002449 JGI24698J34947_10092502 JGI24698J34947_100925023 147
48 3300002449 JGI24698J34947_10115554 JGI24698J34947_101155543 147
49 3300002450 JGI24695J34938_10000097 JGI24695J34938_1000009733 147
50 3300002450 JGI24695J34938_10005114 JGI24695J34938_100051145 147
51 3300002450 JGI24695J34938_10056180 JGI24695J34938_100561802 147
52 3300005200 Ga0072940_1007819 Ga0072940_10078193 147
53 3300005201 Ga0072941_1002436 Ga0072941_100243615 147
54 3300005201 Ga0072941_1017600 Ga0072941_10176005 147
55 3300005201 Ga0072941_1076224 Ga0072941_10762242 147
56 3300005201 Ga0072941_1076225 Ga0072941_10762252 147
57 3300009784 Ga0123357_10674019 Ga0123357_106740192 147
58 3300010049 Ga0123356_10015636 Ga0123356_100156363 147
59 3300010882 Ga0123354_10138275 Ga0123354_101382753 147
60 3300022815 Ga0255786_1022676 Ga0255786_10226762 147
61 3300038395 Ga0415639_062647 Ga0415639_062647_341_784 147
62 3300042595 Ga0466695_262369 Ga0466695_262369_606_1049 147
63 3300042604 Ga0466717_233010 Ga0466717_233010_478_921 147
64 3300042604 Ga0466717_278120 Ga0466717_278120_225_668 147
65 3300042607 Ga0466720_028491 Ga0466720_028491_63054_63497 147
66 3300042607 Ga0466720_054851 Ga0466720_054851_432_875 147
67 3300042607 Ga0466720_076925 Ga0466720_076925_11261_11704 147
68 3300042607 Ga0466720_081792 Ga0466720_081792_276_719 147
69 3300042607 Ga0466720_144373 Ga0466720_144373_1593_2036 147
70 3300042607 Ga0466720_158102 Ga0466720_158102_2433_2876 147
71 3300042607 Ga0466720_160270 Ga0466720_160270_8358_8801 147
72 3300042607 Ga0466720_171676 Ga0466720_171676_131_574 147
73 3300042608 Ga0466721_353194 Ga0466721_353194_475_918 147
74 3300042614 Ga0466712_124295 Ga0466712_124295_2633_3076 147
75 3300042617 Ga0466718_004842 Ga0466718_004842_1284_1727 147
76 3300042617 Ga0466718_006770 Ga0466718_006770_992_1435 147
77 3300042617 Ga0466718_008845 Ga0466718_008845_3649_4092 147
78 3300042617 Ga0466718_073737 Ga0466718_073737_48_491 147
79 3300042617 Ga0466718_134911 Ga0466718_134911_371_814 147
80 3300042619 Ga0466726_110194 Ga0466726_110194_264_707 147
81 3300042622 Ga0466731_321802 Ga0466731_321802_26_469 147
82 3300042622 Ga0466731_383280 Ga0466731_383280_924_1367 147
83 3300042655 Ga0466727_104113 Ga0466727_104113_475_918 147
84 3300042656 Ga0466732_220202 Ga0466732_220202_11778_12221 147
85 iso_pr_bacteria 2781125629 2781263870 147
86 3300000089 AustNasuHG_c1003723 AustNasuHG_10037235 148
87 3300000089 AustNasuHG_c1019366 AustNasuHG_10193665 148
88 3300002449 JGI24698J34947_10047081 JGI24698J34947_100470812 148
89 3300002449 JGI24698J34947_10051793 JGI24698J34947_100517934 148
90 3300002449 JGI24698J34947_10058940 JGI24698J34947_100589402 148
91 3300002449 JGI24698J34947_10062493 JGI24698J34947_100624932 148
92 3300002449 JGI24698J34947_10120883 JGI24698J34947_101208832 148
93 3300002449 JGI24698J34947_10152179 JGI24698J34947_101521792 148
94 3300002449 JGI24698J34947_10307199 JGI24698J34947_103071991 148
95 3300005201 Ga0072941_1001996 Ga0072941_100199611 148
96 3300005201 Ga0072941_1007278 Ga0072941_10072785 148
97 3300005201 Ga0072941_1009885 Ga0072941_10098853 148
98 3300005201 Ga0072941_1076578 Ga0072941_10765781 148
99 3300005485 Ga0074263_106301 Ga0074263_1063013 148
100 3300005485 Ga0074263_113797 Ga0074263_1137972 148
101 3300010049 Ga0123356_12142938 Ga0123356_121429382 148
102 3300010167 Ga0123353_10668217 Ga0123353_106682173 148
103 3300042614 Ga0466712_127790 Ga0466712_127790_558_1004 148
104 3300042621 Ga0466729_222096 Ga0466729_222096_520_966 148
105 3300042656 Ga0466732_016257 Ga0466732_016257_990_1436 148
106 3300010167 Ga0123353_10033662 Ga0123353_100336625 149
107 3300042594 Ga0466694_161348 Ga0466694_161348_280_729 149
108 3300042609 Ga0466722_252778 Ga0466722_252778_740_1189 149
109 3300042614 Ga0466712_300803 Ga0466712_300803_105_554 149
110 3300042619 Ga0466726_252686 Ga0466726_252686_99_578 149
111 3300042622 Ga0466731_386095 Ga0466731_386095_138_587 149
112 3300042594 Ga0466694_111332 Ga0466694_111332_1706_2158 150
113 3300042602 Ga0466713_071673 Ga0466713_071673_10679_11131 150
114 3300042609 Ga0466722_082964 Ga0466722_082964_46433_46885 150
115 3300042612 Ga0466705_194967 Ga0466705_194967_12181_12633 150
116 3300042616 Ga0466715_203763 Ga0466715_203763_9489_9941 150
117 3300042616 Ga0466715_534170 Ga0466715_534170_492_944 150
118 3300042618 Ga0466723_347993 Ga0466723_347993_20664_21116 150
119 3300042620 Ga0466728_052793 Ga0466728_052793_956_1408 150
120 3300042622 Ga0466731_373685 Ga0466731_373685_4921_5373 150
121 3300042624 Ga0466735_040594 Ga0466735_040594_458_910 150
122 3300042643 Ga0466704_174279 Ga0466704_174279_18614_19066 150
123 3300042648 Ga0466709_350218 Ga0466709_350218_6286_6738 150
124 3300042652 Ga0466708_226192 Ga0466708_226192_4621_5073 150
125 3300042593 Ga0466691_072184 Ga0466691_072184_1233_1688 151
126 3300042606 Ga0466719_059689 Ga0466719_059689_377_832 151
127 3300042619 Ga0466726_172836 Ga0466726_172836_492_947 151
128 3300042655 Ga0466727_187777 Ga0466727_187777_634_1089 151
129 3300002450 JGI24695J34938_10242578 JGI24695J34938_102425781 152
130 3300042596 Ga0466696_437756 Ga0466696_437756_15510_15968 152
131 3300042601 Ga0466707_138789 Ga0466707_138789_830_1288 152
132 3300042617 Ga0466718_047698 Ga0466718_047698_8601_9059 152
133 3300042617 Ga0466718_109290 Ga0466718_109290_353_811 152
134 3300042636 Ga0466703_076898 Ga0466703_076898_18736_19194 152
135 iso_pr_bacteria 2772190978 2773730555 152
136 3300000089 AustNasuHG_c1000346 AustNasuHG_100034613 153
137 3300005200 Ga0072940_1105793 Ga0072940_11057932 153
138 3300005200 Ga0072940_1261790 Ga0072940_12617903 153
139 3300005201 Ga0072941_1007276 Ga0072941_100727611 153
140 3300042591 Ga0466692_013015 Ga0466692_013015_13582_14043 153
141 3300042597 Ga0466699_189632 Ga0466699_189632_586_1047 153
142 3300042606 Ga0466719_055250 Ga0466719_055250_1456_1917 153
143 3300042618 Ga0466723_163368 Ga0466723_163368_3777_4238 153
144 3300042636 Ga0466703_398003 Ga0466703_398003_12979_13440 153
145 3300002462 JGI24702J35022_10018457 JGI24702J35022_100184572 154
146 3300042593 Ga0466691_082912 Ga0466691_082912_6316_6780 154
147 3300042606 Ga0466719_011211 Ga0466719_011211_494_958 154
148 3300042612 Ga0466705_122560 Ga0466705_122560_10438_10902 154
149 3300042618 Ga0466723_242806 Ga0466723_242806_1434_1898 154
150 3300042652 Ga0466708_174074 Ga0466708_174074_1927_2391 154
151 3300042652 Ga0466708_375935 Ga0466708_375935_2647_3111 154
152 3300042605 Ga0466716_022043 Ga0466716_022043_4526_4993 155
153 3300042605 Ga0466716_451875 Ga0466716_451875_910_1377 155
154 3300042648 Ga0466709_151475 Ga0466709_151475_1165_1632 155
155 3300042593 Ga0466691_038919 Ga0466691_038919_4271_4741 156
156 3300042618 Ga0466723_113343 Ga0466723_113343_1007_1477 156
157 3300042643 Ga0466704_469298 Ga0466704_469298_69_539 156
158 3300042648 Ga0466709_335377 Ga0466709_335377_5043_5513 156
159 3300042609 Ga0466722_035337 Ga0466722_035337_3469_3945 158
160 3300042616 Ga0466715_021799 Ga0466715_021799_3956_4432 158
161 3300042617 Ga0466718_167744 Ga0466718_167744_9526_10002 158
162 3300042600 Ga0466700_069688 Ga0466700_069688_298_810 162
163 3300042615 Ga0466711_150674 Ga0466711_150674_890_1378 162
164 3300042636 Ga0466703_107854 Ga0466703_107854_18_512 164
165 3300042590 Ga0466690_232841 Ga0466690_232841_456_956 166
166 3300042616 Ga0466715_156670 Ga0466715_156670_1702_2205 167
167 3300042618 Ga0466723_046084 Ga0466723_046084_532_1038 168
168 3300042609 Ga0466722_240551 Ga0466722_240551_470_982 170
169 iso_pr_bacteria 2781125683 2781411634 170

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02623 FliW FliW protein 19 137 0.97

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02623 GO:0044780 bacterial-type flagellum assembly BP

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.8 0.85 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.