Protein Family IF00784

Metagenome Isolate
121 Members
54 Samples
101 Scaffolds
422.35 Avg Length

🧬 Representative Sequence

ID
3300002462|JGI24702J35022_10011770|JGI24702J35022_100117704
Length
469 aa
Sequence
MKPWDTNVTALNESSNNHLSLLELHTMIRETLQGTFPDTYWVRAEMSDLRVNAASGHCYLEFIEKDEKTGQTVAKARGTIWARTFHLLKPYFEKETKQAFTSGLKVLVNVSVEFHELYGYSLRVCDIDPSYTVGDLVRKRAEIVRRLQEEGIFNLNRELSFPVLPQRIAVITSPTAAGYEDFVRQLADNEYGFSFYIKLFPAIMQGDKTEESVIAAFDRIFLHSLHFDVVVLIRGGGSTAELSCFDSYLLAANCAQFPLPVITGIGHERDDTIVDMVAHTRMKTPTAVAAFLIERMTREAALIQEFEKAIYENVMKGLQQKKAVLQTLTARLPLTVSKHIEXHRKQLNKVTAFISTLPQWLYRCSEKLNELPPRLQRATDVMTLKHTTWLTEMRVRLLHAYQTTSSKAQQALELNEQFMKMVSPDYVLKRGYSLTYKQNKIVKYAKELTAGDEIMIKFTDGEKEGIIK*

📊 Sample Types

Isolate 16.5%
Metagenome 83.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 35.2%
Kalotermitidae 25.9%
Termitidae 16.7%
Unclassified 7.4%
Termopsidae 5.6%
Passalidae 3.7%
Rhinotermitidae 3.7%
Hodotermitidae 1.9%

🌳 Taxonomy

Archaea 0
Bacteria 118
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
2 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
3 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
4 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
5 2923982719 Parabacteroides sp. 52 Isolate Blattidae
6 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
7 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
8 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
9 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
10 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
11 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
12 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
13 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
14 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
15 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
16 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
17 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
18 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
19 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
20 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
21 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
22 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
23 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
24 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
25 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
26 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
27 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
28 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
29 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
30 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
31 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
32 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
33 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
34 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
35 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
36 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
37 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
38 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
39 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
40 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
41 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
42 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
43 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
44 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
45 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
46 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
47 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
48 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
49 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
50 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
51 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
52 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
53 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
54 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_194140 3300042659 Bacteria 44568
2 Ga0466711_031881 3300042615 Bacteria 12261
3 Ga0466711_381735 3300042615 Bacteria 12649
4 Ga0466728_120728 3300042620 Bacteria 2904
5 Ga0466716_331478 3300042605 Bacteria 9034
6 Ga0466716_392237 3300042605 Bacteria 10815
7 Ga0466720_176997 3300042607 Bacteria 1973
8 Ga0068305_10048759 3300005083 Bacteria 12061
9 Ga0466703_143736 3300042636 Bacteria 14178
10 Ga0466696_059472 3300042596 Bacteria 8337
11 Ga0466733_000466 3300042659 Bacteria 4155
12 Ga0466733_000712 3300042659 Bacteria 18066
13 Ga0466711_073420 3300042615 Bacteria 7522
14 Ga0466723_228039 3300042618 Bacteria 5009
15 Ga0466706_174920 3300042599 Bacteria 12699
16 JGI24702J35022_10003876 3300002462 Bacteria 8973
17 JGI24702J35022_10008441 3300002462 Bacteria 5828
18 Ga0068305_10282459 3300005083 Unclassified 1870
19 Ga0466709_036310 3300042648 Bacteria 4450
20 Ga0466727_182627 3300042655 Bacteria 3706
21 Ga0466656_339094 3300042550 Bacteria 13117
22 Ga0466690_223492 3300042590 Bacteria 14225
23 Ga0466705_007402 3300042612 Bacteria 4863
24 Ga0466733_209304 3300042659 Bacteria 1691
25 Ga0466712_023627 3300042614 Bacteria 2591
26 Ga0466728_189190 3300042620 Bacteria 66661
27 Ga0123353_10463752 3300010167 Bacteria 1860
28 Ga0466707_377418 3300042601 Bacteria 7096
29 Ga0466719_156620 3300042606 Bacteria 5700
30 Ga0466722_062983 3300042609 Unclassified 7607
31 IMNBL1DRAFT_c0007521 3300000062 Bacteria 5710
32 JGI24702J35022_10011770 3300002462 Bacteria 4875
33 Ga0068305_10000296 3300005083 Unclassified 17259
34 Ga0466703_295854 3300042636 Bacteria 17375
35 Ga0466704_214585 3300042643 Bacteria 2709
36 Ga0466704_232589 3300042643 Bacteria 9781
37 Ga0466704_483426 3300042643 Bacteria 8574
38 Ga0466727_032457 3300042655 Bacteria 13166
39 Ga0466690_062941 3300042590 Bacteria 2231
40 Ga0466713_120182 3300042602 Bacteria 54854
41 Ga0466716_096367 3300042605 Bacteria 17699
42 Ga0466722_114407 3300042609 Bacteria 3271
43 Ga0466703_048088 3300042636 Bacteria 40180
44 Ga0466704_108124 3300042643 Bacteria 8750
45 Ga0466704_131513 3300042643 Bacteria 17215
46 Ga0466691_135250 3300042593 Bacteria 7136
47 Ga0466723_128730 3300042618 Bacteria 22067
48 Ga0466728_044780 3300042620 Bacteria 82368
49 Ga0466728_112903 3300042620 Bacteria 9717
50 Ga0466729_123526 3300042621 Bacteria 33019
51 Ga0466713_094149 3300042602 Bacteria 1817
52 Ga0466719_159624 3300042606 Bacteria 6957
53 IMNBL1DRAFT_c0003075 3300000062 Bacteria 11018
54 Ga0466735_008871 3300042624 Bacteria 3523
55 Ga0466708_196047 3300042652 Bacteria 23939
56 Ga0466708_202391 3300042652 Bacteria 24700
57 Ga0466696_058256 3300042596 Bacteria 6544
58 Ga0466711_104743 3300042615 Bacteria 2026
59 Ga0466711_451160 3300042615 Bacteria 3426
60 Ga0466715_056991 3300042616 Bacteria 24202
61 Ga0466715_087431 3300042616 Bacteria 8159
62 Ga0466715_440141 3300042616 Bacteria 22634
63 Ga0466728_030496 3300042620 Bacteria 10948
64 Ga0123356_10249370 3300010049 Bacteria 1852
65 Ga0123353_10175965 3300010167 Bacteria 3393
66 Ga0466713_070515 3300042602 Bacteria 21153
67 Ga0466716_416693 3300042605 Bacteria 14814
68 Ga0466704_577676 3300042643 Bacteria 22511
69 Ga0466704_605655 3300042643 Bacteria 6545
70 Ga0466727_051328 3300042655 Bacteria 9580
71 Ga0466727_217856 3300042655 Bacteria 11593
72 Ga0466691_023060 3300042593 Bacteria 9157
73 Ga0466705_102389 3300042612 Bacteria 3544
74 Ga0466705_347674 3300042612 Bacteria 29568
75 Ga0466715_079603 3300042616 Bacteria 222305
76 Ga0466726_136002 3300042619 Bacteria 6598
77 Ga0466728_404970 3300042620 Bacteria 46041
78 Ga0466713_003458 3300042602 Bacteria 44331
79 Ga0466713_039571 3300042602 Bacteria 6046
80 Ga0466713_083739 3300042602 Bacteria 12418
81 Ga0466713_131755 3300042602 Bacteria 1433
82 Ga0466719_121598 3300042606 Bacteria 4993
83 2227494083 2225789004 Bacteria 20109
84 Ga0466703_208583 3300042636 Bacteria 4891
85 Ga0466704_357167 3300042643 Bacteria 10119
86 Ga0466704_477462 3300042643 Bacteria 10469
87 Ga0466691_172619 3300042593 Bacteria 7130
88 Ga0466696_001911 3300042596 Bacteria 82336
89 Ga0466696_011367 3300042596 Bacteria 10462
90 Ga0466733_180514 3300042659 Bacteria 51608
91 Ga0466711_133415 3300042615 Bacteria 7335
92 Ga0466728_479085 3300042620 Bacteria 2148
93 Ga0123356_10165976 3300010049 Bacteria 2212
94 Ga0466707_408573 3300042601 Bacteria 4228
95 Ga0466713_148662 3300042602 Bacteria 25209
96 Ga0466716_311338 3300042605 Bacteria 24204
97 JGI24705J35276_12233842 3300002504 Bacteria 5106
98 JGI24699J35502_11133945 3300002509 Bacteria 20602
99 Ga0466704_338129 3300042643 Bacteria 3160
100 Ga0466708_235488 3300042652 Bacteria 24641
101 Ga0466690_402356 3300042590 Bacteria 64397

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042596 Ga0466696_058256 Ga0466696_058256_2072_3460 372
2 3300042602 Ga0466713_094149 Ga0466713_094149_53_1369 372
3 3300042643 Ga0466704_214585 Ga0466704_214585_468_1727 372
4 3300042590 Ga0466690_402356 Ga0466690_402356_20237_21496 375
5 3300042624 Ga0466735_008871 Ga0466735_008871_1323_2669 375
6 3300042643 Ga0466704_108124 Ga0466704_108124_2811_4070 375
7 3300042615 Ga0466711_031881 Ga0466711_031881_4732_5985 376
8 3300042659 Ga0466733_194140 Ga0466733_194140_18509_19912 378
9 3300042621 Ga0466729_123526 Ga0466729_123526_25971_27335 380
10 3300042615 Ga0466711_104743 Ga0466711_104743_23_1183 386
11 3300042612 Ga0466705_007402 Ga0466705_007402_1188_2525 387
12 3300042614 Ga0466712_023627 Ga0466712_023627_1073_2491 387
13 3300042620 Ga0466728_189190 Ga0466728_189190_9634_10956 387
14 3300042615 Ga0466711_073420 Ga0466711_073420_1539_2792 388
15 3300042605 Ga0466716_096367 Ga0466716_096367_10950_12284 390
16 3300042605 Ga0466716_416693 Ga0466716_416693_7702_9033 390
17 3300042620 Ga0466728_404970 Ga0466728_404970_44361_45686 390
18 3300042615 Ga0466711_451160 Ga0466711_451160_395_1714 391
19 3300042620 Ga0466728_112903 Ga0466728_112903_8040_9362 391
20 3300042599 Ga0466706_174920 Ga0466706_174920_5217_6554 392
21 3300042615 Ga0466711_133415 Ga0466711_133415_4730_6067 392
22 3300042648 Ga0466709_036310 Ga0466709_036310_1808_3130 392
23 3300042636 Ga0466703_048088 Ga0466703_048088_5396_6580 394
24 3300042643 Ga0466704_477462 Ga0466704_477462_9068_10327 395
25 3300042618 Ga0466723_228039 Ga0466723_228039_1747_3066 396
26 3300042620 Ga0466728_044780 Ga0466728_044780_10000_11322 396
27 3300042643 Ga0466704_357167 Ga0466704_357167_5011_6369 399
28 3300042659 Ga0466733_000466 Ga0466733_000466_228_1463 399
29 3300042616 Ga0466715_056991 Ga0466715_056991_3558_4817 400
30 3300042643 Ga0466704_232589 Ga0466704_232589_6525_7784 402
31 3300042602 Ga0466713_083739 Ga0466713_083739_4076_5383 403
32 3300042616 Ga0466715_440141 Ga0466715_440141_13044_14363 403
33 3300042602 Ga0466713_131755 Ga0466713_131755_53_1369 404
34 3300005083 Ga0068305_10282459 Ga0068305_102824592 406
35 3300042593 Ga0466691_172619 Ga0466691_172619_3338_4741 407
36 3300042620 Ga0466728_030496 Ga0466728_030496_4759_6018 407
37 3300042643 Ga0466704_605655 Ga0466704_605655_2812_4074 407
38 3300005083 Ga0068305_10000296 Ga0068305_100002965 411
39 3300042593 Ga0466691_135250 Ga0466691_135250_412_1671 411
40 3300042602 Ga0466713_148662 Ga0466713_148662_2526_3764 412
41 3300042590 Ga0466690_062941 Ga0466690_062941_606_1925 414
42 3300042596 Ga0466696_001911 Ga0466696_001911_63879_65201 414
43 3300042601 Ga0466707_408573 Ga0466707_408573_2395_3645 416
44 3300042616 Ga0466715_079603 Ga0466715_079603_92677_93930 417
45 3300042659 Ga0466733_209304 Ga0466733_209304_423_1679 418
46 3300042602 Ga0466713_003458 Ga0466713_003458_13633_14892 419
47 3300042636 Ga0466703_143736 Ga0466703_143736_4535_5794 419
48 3300042643 Ga0466704_131513 Ga0466704_131513_12516_13775 419
49 3300042590 Ga0466690_223492 Ga0466690_223492_7148_8410 420
50 3300042605 Ga0466716_392237 Ga0466716_392237_2678_4018 420
51 3300042605 Ga0466716_311338 Ga0466716_311338_14813_16078 421
52 3300042643 Ga0466704_577676 Ga0466704_577676_17899_19227 421
53 iso_pr_bacteria 2820757377 2820758052 422
54 3300002509 JGI24699J35502_11133945 JGI24699J35502_111339454 423
55 3300042652 Ga0466708_196047 Ga0466708_196047_13775_15046 423
56 3300042620 Ga0466728_479085 Ga0466728_479085_435_1709 424
57 3300042655 Ga0466727_032457 Ga0466727_032457_7823_9145 424
58 3300042659 Ga0466733_000712 Ga0466733_000712_10229_11503 424
59 3300042652 Ga0466708_235488 Ga0466708_235488_14940_16262 426
60 3300042602 Ga0466713_070515 Ga0466713_070515_14270_15553 427
61 3300042619 Ga0466726_136002 Ga0466726_136002_2467_3837 427
62 3300042659 Ga0466733_180514 Ga0466733_180514_2616_4004 428
63 3300042612 Ga0466705_347674 Ga0466705_347674_21709_22998 429
64 3300042643 Ga0466704_483426 Ga0466704_483426_5096_6487 429
65 3300010049 Ga0123356_10249370 Ga0123356_102493701 431
66 3300010167 Ga0123353_10463752 Ga0123353_104637522 431
67 3300042602 Ga0466713_039571 Ga0466713_039571_1294_2646 436
68 3300042655 Ga0466727_217856 Ga0466727_217856_7031_8404 436
69 iso_pr_bacteria 2940205530 2940206024 439
70 iso_pr_bacteria 2940212447 2940212939 439
71 iso_pr_bacteria 2940298504 2940298996 439
72 iso_pr_bacteria 2940302308 2940302932 439
73 iso_pr_bacteria 2940306115 2940306342 439
74 iso_pr_bacteria 2940309933 2940310027 439
75 iso_pr_bacteria 2940313741 2940313835 439
76 iso_pr_bacteria 2940317558 2940317783 439
77 iso_pr_bacteria 2940321370 2940321464 439
78 iso_pr_bacteria 2940325180 2940325804 439
79 iso_pr_bacteria 2940328985 2940329610 439
80 iso_pr_bacteria 2940332795 2940333022 439
81 3300005083 Ga0068305_10048759 Ga0068305_100487596 440
82 3300042550 Ga0466656_339094 Ga0466656_339094_5457_6779 440
83 3300042596 Ga0466696_059472 Ga0466696_059472_3413_4822 440
84 3300042601 Ga0466707_377418 Ga0466707_377418_5250_6572 440
85 3300042609 Ga0466722_062983 Ga0466722_062983_4048_5370 440
86 3300042612 Ga0466705_102389 Ga0466705_102389_12_1334 440
87 3300042636 Ga0466703_295854 Ga0466703_295854_7216_8538 440
88 3300042643 Ga0466704_338129 Ga0466704_338129_287_1609 440
89 3300042655 Ga0466727_182627 Ga0466727_182627_2182_3504 440
90 3300002462 JGI24702J35022_10003876 JGI24702J35022_100038763 441
91 3300002462 JGI24702J35022_10008441 JGI24702J35022_100084412 441
92 3300042605 Ga0466716_331478 Ga0466716_331478_2422_3747 441
93 3300042606 Ga0466719_156620 Ga0466719_156620_2422_3747 441
94 3300042609 Ga0466722_114407 Ga0466722_114407_1757_3082 441
95 3300042620 Ga0466728_120728 Ga0466728_120728_1331_2656 441
96 3300042636 Ga0466703_208583 Ga0466703_208583_1958_3283 441
97 3300042652 Ga0466708_202391 Ga0466708_202391_4744_6069 441
98 3300010049 Ga0123356_10165976 Ga0123356_101659761 442
99 3300010167 Ga0123353_10175965 Ga0123353_101759652 442
100 3300042607 Ga0466720_176997 Ga0466720_176997_375_1703 442
101 3300042615 Ga0466711_381735 Ga0466711_381735_4532_5863 443
102 iso_pr_bacteria 2923982719 2923983351 444
103 iso_pr_bacteria 2940195863 2940197089 444
104 iso_pr_bacteria 2940371297 2940372647 444
105 3300042602 Ga0466713_120182 Ga0466713_120182_43642_44982 446
106 3300042606 Ga0466719_121598 Ga0466719_121598_2375_3715 446
107 3300000062 IMNBL1DRAFT_c0007521 IMNBL1DRAFT_00075214 448
108 2225789004 2227494083 2227969506 449
109 3300042593 Ga0466691_023060 Ga0466691_023060_368_1717 449
110 3300042616 Ga0466715_087431 Ga0466715_087431_3013_4362 449
111 iso_pr_bacteria 2940199050 2940199224 449
112 iso_pr_bacteria 2940209341 2940210284 449
113 iso_pr_bacteria 2940346213 2940346286 449
114 3300000062 IMNBL1DRAFT_c0003075 IMNBL1DRAFT_00030753 450
115 3300042606 Ga0466719_159624 Ga0466719_159624_1927_3285 452
116 3300042618 Ga0466723_128730 Ga0466723_128730_16305_17708 454
117 iso_pr_bacteria 2940202316 2940202925 454
118 3300002504 JGI24705J35276_12233842 JGI24705J35276_122338422 457
119 3300042655 Ga0466727_051328 Ga0466727_051328_6015_7400 461
120 3300042596 Ga0466696_011367 Ga0466696_011367_5297_6703 468
121 3300002462 JGI24702J35022_10011770 JGI24702J35022_100117704 469

🧩 MSA Aligner

Download FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02601 Exonuc_VII_L Exonuclease VII, large subunit 152 462 0.94
PF13742 tRNA_anti_2 OB-fold nucleic acid binding domain 20 127 0.9

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02601 GO:0008855 exodeoxyribonuclease VII activity MF
PF13742 GO:0003676 nucleic acid binding MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.