Protein Family IF00781

Metagenome Metatranscriptome Isolate
156 Members
70 Samples
136 Scaffolds
207.8 Avg Length

🧬 Representative Sequence

ID
3300002462|JGI24702J35022_10010267|JGI24702J35022_100102671
Length
233 aa
Sequence
MDAVRRNAEEFDGAVEMARYTGPVCKLCRREMQPLMLKGQRCMTEKCPLKEGASNTKTKKYPPGPPRKRRTKMSDYAVQLREKQKIKRSYCLLEKQFRRTFDEANRMKGVTGDNMLSLLERRLENVIYRMGFATSRNQARQLVFHKHVMVNGKTVDIPSFLVKENMEVMIAENFRQNPFLEGSIMLTKASESVPEWLEVDFDNKSGKIIRLPIRSDVVADFNEQLVVELYSK*

πŸ“Š Sample Types

Isolate 12.8%
Metagenome 85.9%
MAG 0.0%
Metatranscriptome 1.3%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 41.8%
Unclassified 32.8%
Kalotermitidae 19.4%
Termopsidae 3.0%
Rhinotermitidae 1.5%
Hodotermitidae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 143
Eukaryota 0
Viruses 0
Unclassified 13

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820263778 Unclassified Firmicutes Th196P3bin37 Isolate Unclassified
2 2820462123 Unclassified Firmicutes Lab288P3bin129 Isolate Unclassified
3 2820611732 Unclassified Firmicutes Emb289P1bin19 Isolate Unclassified
4 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
5 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
6 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
7 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
8 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
9 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
10 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
11 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
12 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
13 2820010479 Unclassified Spirochaetes Th196P4bin55 Isolate Unclassified
14 2820669764 Unclassified Firmicutes Co191P3bin30 Isolate Unclassified
15 2820680340 Unclassified Firmicutes Co191P1bin89 Isolate Unclassified
16 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
17 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
18 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
19 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
20 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
21 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
22 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
23 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
24 2820510699 Unclassified Firmicutes Lab288P1bin40 Isolate Unclassified
25 2820526825 Unclassified Firmicutes Lab288P1bin16 Isolate Unclassified
26 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
27 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
28 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
29 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
30 2820400448 Unclassified Firmicutes Nc150Mbin1 Isolate Unclassified
31 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
32 2820497731 Unclassified Firmicutes Lab288P1bin55 Isolate Unclassified
33 2820556368 Unclassified Firmicutes Emb289P3bin92 Isolate Unclassified
34 2820572885 Unclassified Firmicutes Emb289P3bin161 Isolate Unclassified
35 2820947865 Unclassified Acidobacteria Nt197P3bin133 Isolate Unclassified
36 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
37 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
38 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
39 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
40 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
41 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
42 2819998259 Unclassified Spirochaetes Nc150P4bin23 Isolate Unclassified
43 2820396902 Unclassified Firmicutes Nc150P1bin3 Isolate Unclassified
44 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
45 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
46 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
47 2820014844 Unclassified Spirochaetes Nt197P3bin95 Isolate Unclassified
48 2820506701 Unclassified Firmicutes Lab288P1bin46 Isolate Unclassified
49 2820530071 Unclassified Firmicutes Lab288P1bin142 Isolate Unclassified
50 2820545146 Unclassified Firmicutes Lab288P1bin104 Isolate Unclassified
51 2820558799 Unclassified Firmicutes Emb289P3bin74 Isolate Unclassified
52 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
53 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
54 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
55 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
56 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
57 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
58 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
59 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
60 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
61 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
62 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
63 3300021190 Termite gut microbial communities from nest - French Guiana - 1_3 mRNA 1_3 mRNA SA Metatranscriptome Termitidae
64 3300021237 Termite gut microbial communities from nest from French Guiana -FG16_15_2 mRNA SA Metatranscriptome
65 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
66 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
67 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
68 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
69 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
70 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 JGI24698J34947_10001360 3300002449 Bacteria 12855
2 JGI24695J34938_10019061 3300002450 Bacteria 3411
3 Ga0072941_1008137 3300005201 Bacteria 12136
4 Ga0072941_1688570 3300005201 Bacteria 1016
5 Ga0223675_1000935 3300021237 Bacteria 2692
6 Ga0264413_164033 3300024493 Bacteria 1371
7 Ga0415639_100564 3300038395 Bacteria 1912
8 Ga0466691_209260 3300042593 Bacteria 5285
9 Ga0466699_391419 3300042597 Unclassified 3215
10 Ga0466720_141828 3300042607 Unclassified 1640
11 Ga0123355_10001225 3300009826 Bacteria 35784
12 Ga0123355_10639156 3300009826 Bacteria 1247
13 Ga0123355_10996630 3300009826 Bacteria 891
14 Ga0123356_10057646 3300010049 Bacteria 3621
15 Ga0466712_068494 3300042614 Bacteria 1865
16 Ga0466718_111055 3300042617 Bacteria 1264
17 Ga0466718_116523 3300042617 Unclassified 2114
18 Ga0466734_050334 3300042623 Bacteria 2419
19 Ga0466703_382073 3300042636 Bacteria 3532
20 Ga0466709_130369 3300042648 Bacteria 9653
21 JGI24698J34947_10007438 3300002449 Bacteria 6020
22 JGI24695J34938_10000226 3300002450 Bacteria 53266
23 Ga0466690_208626 3300042590 Bacteria 1807
24 Ga0466690_247599 3300042590 Bacteria 1493
25 Ga0466693_138326 3300042592 Bacteria 1685
26 Ga0466691_191273 3300042593 Bacteria 20272
27 Ga0466694_021830 3300042594 Bacteria 15157
28 Ga0466699_064292 3300042597 Bacteria 4860
29 Ga0466714_062235 3300042603 Bacteria 4909
30 Ga0123353_10006767 3300010167 Unclassified 15359
31 Ga0466705_526881 3300042612 Bacteria 4522
32 Ga0466712_137270 3300042614 Bacteria 3665
33 Ga0466723_344622 3300042618 Bacteria 35563
34 Ga0466703_296238 3300042636 Bacteria 15890
35 Ga0264413_156405 3300024493 Bacteria 2641
36 Ga0466690_054853 3300042590 Bacteria 4045
37 Ga0466695_377735 3300042595 Bacteria 1703
38 Ga0466696_252127 3300042596 Bacteria 17039
39 Ga0466699_381188 3300042597 Bacteria 1763
40 Ga0466706_111604 3300042599 Bacteria 1126
41 Ga0466719_546615 3300042606 Bacteria 1806
42 Ga0466720_020310 3300042607 Bacteria 2437
43 Ga0123355_10005105 3300009826 Bacteria 19144
44 Ga0123355_10164349 3300009826 Bacteria 3335
45 Ga0123355_10246231 3300009826 Bacteria 2524
46 Ga0123353_10569930 3300010167 Unclassified 1628
47 Ga0466715_120862 3300042616 Bacteria 8032
48 Ga0466715_487463 3300042616 Bacteria 4243
49 Ga0466718_161218 3300042617 Bacteria 19936
50 Ga0466723_038419 3300042618 Bacteria 31685
51 Ga0466723_094930 3300042618 Bacteria 2380
52 Ga0466723_336515 3300042618 Bacteria 5641
53 Ga0466728_342992 3300042620 Bacteria 1872
54 Ga0466728_347766 3300042620 Bacteria 6561
55 Ga0466705_285307 3300042612 Bacteria 25130
56 Ga0466705_325997 3300042612 Bacteria 31796
57 Ga0466732_067770 3300042656 Unclassified 5179
58 Ga0466694_204704 3300042594 Unclassified 1985
59 Ga0466695_222321 3300042595 Bacteria 9388
60 Ga0466707_163801 3300042601 Bacteria 828024
61 Ga0466717_204856 3300042604 Unclassified 2264
62 Ga0466716_475582 3300042605 Bacteria 3106
63 Ga0466719_077181 3300042606 Bacteria 4295
64 Ga0123355_10019163 3300009826 Bacteria 10887
65 Ga0123356_10076076 3300010049 Bacteria 3163
66 Ga0123353_10021043 3300010167 Bacteria 9773
67 Ga0466710_168260 3300042613 Bacteria 1768
68 Ga0466711_269482 3300042615 Bacteria 3211
69 Ga0466715_128043 3300042616 Bacteria 6375
70 Ga0466723_019869 3300042618 Bacteria 35706
71 Ga0466703_340956 3300042636 Bacteria 1930
72 Ga0466708_201489 3300042652 Bacteria 43335
73 JGI24702J35022_10030285 3300002462 Unclassified 2903
74 Ga0072940_1007047 3300005200 Unclassified 8578
75 Ga0415639_025040 3300038395 Bacteria 32469
76 Ga0466690_281913 3300042590 Bacteria 36067
77 Ga0466694_183723 3300042594 Bacteria 21712
78 Ga0466700_253842 3300042600 Bacteria 1359
79 Ga0466719_228707 3300042606 Bacteria 5858
80 Ga0123355_10000012 3300009826 Bacteria 181780
81 Ga0123355_10004905 3300009826 Bacteria 19468
82 Ga0123355_10748547 3300009826 Bacteria 1106
83 Ga0123353_10023712 3300010167 Bacteria 9297
84 Ga0466715_069772 3300042616 Bacteria 32177
85 Ga0466718_030844 3300042617 Bacteria 2871
86 Ga0466723_192342 3300042618 Bacteria 20312
87 Ga0466723_232062 3300042618 Bacteria 62764
88 Ga0466703_311388 3300042636 Bacteria 3401
89 Ga0466709_409548 3300042648 Unclassified 2019
90 Ga0466708_054591 3300042652 Bacteria 89967
91 Ga0466727_034911 3300042655 Bacteria 1466
92 Ga0466705_354103 3300042612 Bacteria 9789
93 JGI24702J35022_10010267 3300002462 Bacteria 5237
94 Ga0222431_1010041 3300021190 Bacteria 3557
95 Ga0466714_080112 3300042603 Bacteria 6977
96 Ga0123353_10712800 3300010167 Bacteria 1405
97 Ga0466715_085223 3300042616 Bacteria 5212
98 Ga0466715_131933 3300042616 Bacteria 43814
99 Ga0466718_085948 3300042617 Bacteria 9068
100 Ga0466726_031948 3300042619 Bacteria 19088
101 Ga0466729_003595 3300042621 Bacteria 5199
102 Ga0466731_065936 3300042622 Bacteria 20008
103 Ga0466702_157150 3300042635 Bacteria 1813
104 Ga0466727_012226 3300042655 Bacteria 1486
105 Ga0466705_160225 3300042612 Bacteria 45310
106 Ga0072941_1250356 3300005201 Unclassified 2633
107 Ga0466699_202468 3300042597 Bacteria 7425
108 Ga0466706_091777 3300042599 Bacteria 59128
109 Ga0466717_203571 3300042604 Bacteria 2095
110 Ga0123357_10303845 3300009784 Bacteria 1606
111 Ga0123357_10517058 3300009784 Bacteria 978
112 Ga0123355_10697779 3300009826 Bacteria 1167
113 Ga0123353_10075720 3300010167 Bacteria 5407
114 Ga0123354_10035483 3300010882 Bacteria 7785
115 Ga0466711_202977 3300042615 Bacteria 8125
116 Ga0466711_328250 3300042615 Bacteria 50562
117 Ga0466715_154133 3300042616 Bacteria 37484
118 Ga0466709_344133 3300042648 Bacteria 3538
119 Ga0466708_410713 3300042652 Bacteria 5655
120 Ga0466732_240040 3300042656 Bacteria 2708
121 JGI24700J35501_10889652 3300002508 Bacteria 2653
122 JGI24696J40584_12894572 3300002834 Bacteria 1149
123 Ga0072941_1330392 3300005201 Bacteria 2555
124 Ga0466696_023405 3300042596 Bacteria 42390
125 Ga0466696_137941 3300042596 Bacteria 25447
126 Ga0466713_018581 3300042602 Bacteria 91213
127 Ga0466714_162069 3300042603 Bacteria 1466
128 Ga0466717_182496 3300042604 Bacteria 1830
129 Ga0466716_238068 3300042605 Bacteria 3613
130 Ga0123355_10021961 3300009826 Unclassified 10227
131 Ga0123356_10000862 3300010049 Bacteria 33705
132 Ga0123356_10045197 3300010049 Bacteria 4098
133 Ga0123353_10062368 3300010167 Bacteria 5979
134 Ga0466715_038082 3300042616 Bacteria 19718
135 Ga0466715_040556 3300042616 Bacteria 48791
136 Ga0466709_345400 3300042648 Bacteria 6688

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042652 Ga0466708_054591 Ga0466708_054591_5554_6078 174
2 3300042655 Ga0466727_012226 Ga0466727_012226_884_1408 174
3 3300042605 Ga0466716_475582 Ga0466716_475582_684_1250 188
4 3300042616 Ga0466715_038082 Ga0466715_038082_10155_10721 188
5 3300042616 Ga0466715_069772 Ga0466715_069772_14262_14828 188
6 3300042636 Ga0466703_340956 Ga0466703_340956_1012_1578 188
7 3300042656 Ga0466732_067770 Ga0466732_067770_4254_4820 188
8 3300042594 Ga0466694_021830 Ga0466694_021830_14188_14766 192
9 3300009784 Ga0123357_10517058 Ga0123357_105170582 193
10 3300042595 Ga0466695_377735 Ga0466695_377735_221_805 194
11 3300042597 Ga0466699_202468 Ga0466699_202468_914_1498 194
12 3300042635 Ga0466702_157150 Ga0466702_157150_1208_1792 194
13 3300042604 Ga0466717_182496 Ga0466717_182496_845_1432 195
14 3300042616 Ga0466715_120862 Ga0466715_120862_3757_4347 196
15 3300042615 Ga0466711_269482 Ga0466711_269482_2176_2796 199
16 iso_pr_bacteria 2820462123 2820462165 204
17 3300010167 Ga0123353_10006767 Ga0123353_1000676712 205
18 3300021190 Ga0222431_1010041 Ga0222431_10100413 206
19 3300038395 Ga0415639_025040 Ga0415639_025040_9067_9687 206
20 3300042594 Ga0466694_183723 Ga0466694_183723_1121_1741 206
21 3300042596 Ga0466696_023405 Ga0466696_023405_11069_11689 206
22 3300042599 Ga0466706_091777 Ga0466706_091777_28582_29202 206
23 3300042599 Ga0466706_111604 Ga0466706_111604_252_872 206
24 3300042600 Ga0466700_253842 Ga0466700_253842_278_898 206
25 3300042601 Ga0466707_163801 Ga0466707_163801_95248_95868 206
26 3300042603 Ga0466714_062235 Ga0466714_062235_3647_4267 206
27 3300042603 Ga0466714_080112 Ga0466714_080112_2259_2879 206
28 3300042603 Ga0466714_162069 Ga0466714_162069_168_788 206
29 3300042612 Ga0466705_160225 Ga0466705_160225_23529_24149 206
30 3300042614 Ga0466712_068494 Ga0466712_068494_1192_1812 206
31 3300042617 Ga0466718_111055 Ga0466718_111055_544_1164 206
32 3300042620 Ga0466728_347766 Ga0466728_347766_3670_4290 206
33 3300042621 Ga0466729_003595 Ga0466729_003595_4353_4973 206
34 3300042622 Ga0466731_065936 Ga0466731_065936_3620_4240 206
35 3300042648 Ga0466709_344133 Ga0466709_344133_624_1244 206
36 3300042656 Ga0466732_240040 Ga0466732_240040_1404_2024 206
37 iso_pr_bacteria 2820263778 2820264539 206
38 iso_pr_bacteria 2820396902 2820397429 206
39 iso_pr_bacteria 2820400448 2820400534 206
40 iso_pr_bacteria 2820506701 2820507195 206
41 iso_pr_bacteria 2820510699 2820511316 206
42 iso_pr_bacteria 2820526825 2820527687 206
43 iso_pr_bacteria 2820530071 2820530544 206
44 iso_pr_bacteria 2820545146 2820545205 206
45 iso_pr_bacteria 2820572885 2820573454 206
46 iso_pr_bacteria 2820611732 2820613000 206
47 iso_pr_bacteria 2820680340 2820680881 206
48 3300002450 JGI24695J34938_10019061 JGI24695J34938_100190616 207
49 3300002508 JGI24700J35501_10889652 JGI24700J35501_108896521 207
50 3300002834 JGI24696J40584_12894572 JGI24696J40584_128945722 207
51 3300005201 Ga0072941_1688570 Ga0072941_16885701 207
52 3300009784 Ga0123357_10303845 Ga0123357_103038452 207
53 3300009826 Ga0123355_10000012 Ga0123355_10000012146 207
54 3300009826 Ga0123355_10001225 Ga0123355_1000122529 207
55 3300009826 Ga0123355_10004905 Ga0123355_1000490517 207
56 3300009826 Ga0123355_10019163 Ga0123355_1001916316 207
57 3300009826 Ga0123355_10021961 Ga0123355_100219619 207
58 3300009826 Ga0123355_10246231 Ga0123355_102462311 207
59 3300009826 Ga0123355_10639156 Ga0123355_106391562 207
60 3300009826 Ga0123355_10697779 Ga0123355_106977793 207
61 3300009826 Ga0123355_10748547 Ga0123355_107485472 207
62 3300009826 Ga0123355_10996630 Ga0123355_109966302 207
63 3300010049 Ga0123356_10076076 Ga0123356_100760765 207
64 3300010167 Ga0123353_10021043 Ga0123353_100210432 207
65 3300010167 Ga0123353_10023712 Ga0123353_100237125 207
66 3300010167 Ga0123353_10062368 Ga0123353_100623684 207
67 3300010167 Ga0123353_10075720 Ga0123353_100757201 207
68 3300010882 Ga0123354_10035483 Ga0123354_100354835 207
69 3300042590 Ga0466690_281913 Ga0466690_281913_29620_30243 207
70 3300042612 Ga0466705_526881 Ga0466705_526881_1240_1863 207
71 3300042617 Ga0466718_161218 Ga0466718_161218_1757_2380 207
72 3300042618 Ga0466723_344622 Ga0466723_344622_32091_32714 207
73 iso_pr_bacteria 2820497731 2820498501 207
74 iso_pr_bacteria 2820558799 2820559141 207
75 iso_pr_bacteria 2820669764 2820669771 207
76 3300002450 JGI24695J34938_10000226 JGI24695J34938_100002266 208
77 3300042590 Ga0466690_208626 Ga0466690_208626_1103_1729 208
78 3300042590 Ga0466690_247599 Ga0466690_247599_267_893 208
79 3300042593 Ga0466691_191273 Ga0466691_191273_9086_9712 208
80 3300042596 Ga0466696_137941 Ga0466696_137941_14903_15529 208
81 3300042602 Ga0466713_018581 Ga0466713_018581_59702_60328 208
82 3300042605 Ga0466716_238068 Ga0466716_238068_2192_2818 208
83 3300042606 Ga0466719_077181 Ga0466719_077181_3598_4239 208
84 3300042606 Ga0466719_228707 Ga0466719_228707_3856_4482 208
85 3300042606 Ga0466719_546615 Ga0466719_546615_134_760 208
86 3300042612 Ga0466705_285307 Ga0466705_285307_11330_11956 208
87 3300042612 Ga0466705_325997 Ga0466705_325997_13422_14048 208
88 3300042612 Ga0466705_354103 Ga0466705_354103_4641_5267 208
89 3300042615 Ga0466711_202977 Ga0466711_202977_2221_2847 208
90 3300042615 Ga0466711_328250 Ga0466711_328250_19084_19710 208
91 3300042616 Ga0466715_040556 Ga0466715_040556_36076_36702 208
92 3300042616 Ga0466715_085223 Ga0466715_085223_927_1553 208
93 3300042616 Ga0466715_128043 Ga0466715_128043_1292_1918 208
94 3300042616 Ga0466715_131933 Ga0466715_131933_16431_17057 208
95 3300042616 Ga0466715_154133 Ga0466715_154133_22684_23310 208
96 3300042616 Ga0466715_487463 Ga0466715_487463_1073_1699 208
97 3300042618 Ga0466723_019869 Ga0466723_019869_21387_22013 208
98 3300042618 Ga0466723_094930 Ga0466723_094930_511_1137 208
99 3300042618 Ga0466723_192342 Ga0466723_192342_5901_6527 208
100 3300042618 Ga0466723_232062 Ga0466723_232062_27184_27810 208
101 3300042618 Ga0466723_336515 Ga0466723_336515_2412_3038 208
102 3300042620 Ga0466728_342992 Ga0466728_342992_1033_1659 208
103 3300042636 Ga0466703_296238 Ga0466703_296238_4695_5321 208
104 3300042636 Ga0466703_311388 Ga0466703_311388_1504_2130 208
105 3300042636 Ga0466703_382073 Ga0466703_382073_841_1467 208
106 3300042648 Ga0466709_130369 Ga0466709_130369_6591_7217 208
107 3300042648 Ga0466709_345400 Ga0466709_345400_4329_4955 208
108 3300042648 Ga0466709_409548 Ga0466709_409548_661_1287 208
109 3300042652 Ga0466708_201489 Ga0466708_201489_9001_9627 208
110 3300042652 Ga0466708_410713 Ga0466708_410713_4040_4666 208
111 3300042596 Ga0466696_252127 Ga0466696_252127_13965_14594 209
112 3300042604 Ga0466717_203571 Ga0466717_203571_189_818 209
113 3300021237 Ga0223675_1000935 Ga0223675_10009357 210
114 3300038395 Ga0415639_100564 Ga0415639_100564_411_1043 210
115 3300042593 Ga0466691_209260 Ga0466691_209260_2666_3298 210
116 3300042594 Ga0466694_204704 Ga0466694_204704_1094_1726 210
117 3300042595 Ga0466695_222321 Ga0466695_222321_3033_3665 210
118 3300042597 Ga0466699_064292 Ga0466699_064292_3441_4073 210
119 3300042597 Ga0466699_381188 Ga0466699_381188_781_1413 210
120 3300042607 Ga0466720_020310 Ga0466720_020310_388_1020 210
121 3300042607 Ga0466720_141828 Ga0466720_141828_389_1021 210
122 3300042613 Ga0466710_168260 Ga0466710_168260_887_1519 210
123 3300042614 Ga0466712_137270 Ga0466712_137270_2953_3585 210
124 3300042617 Ga0466718_030844 Ga0466718_030844_1754_2386 210
125 3300042617 Ga0466718_085948 Ga0466718_085948_1573_2205 210
126 3300042617 Ga0466718_116523 Ga0466718_116523_892_1524 210
127 iso_pr_bacteria 2819998259 2819998989 210
128 iso_pr_bacteria 2820010479 2820012915 210
129 iso_pr_bacteria 2820014844 2820015376 210
130 iso_pr_bacteria 2820556368 2820556564 210
131 iso_pr_bacteria 2820947865 2820948463 210
132 3300002449 JGI24698J34947_10001360 JGI24698J34947_1000136014 211
133 3300002449 JGI24698J34947_10007438 JGI24698J34947_1000743810 211
134 3300002462 JGI24702J35022_10030285 JGI24702J35022_100302854 211
135 3300005200 Ga0072940_1007047 Ga0072940_100704714 211
136 3300005201 Ga0072941_1008137 Ga0072941_100813724 211
137 3300005201 Ga0072941_1250356 Ga0072941_12503564 211
138 3300005201 Ga0072941_1330392 Ga0072941_13303921 211
139 3300010049 Ga0123356_10000862 Ga0123356_1000086220 211
140 3300010049 Ga0123356_10045197 Ga0123356_100451972 211
141 3300010049 Ga0123356_10057646 Ga0123356_100576461 211
142 3300010167 Ga0123353_10569930 Ga0123353_105699302 211
143 3300024493 Ga0264413_164033 Ga0264413_1640332 212
144 3300042618 Ga0466723_038419 Ga0466723_038419_24035_24679 214
145 3300009826 Ga0123355_10005105 Ga0123355_100051057 219
146 3300042592 Ga0466693_138326 Ga0466693_138326_497_1174 225
147 3300042597 Ga0466699_391419 Ga0466699_391419_754_1431 225
148 3300042604 Ga0466717_204856 Ga0466717_204856_243_920 225
149 3300042623 Ga0466734_050334 Ga0466734_050334_451_1128 225
150 3300042590 Ga0466690_054853 Ga0466690_054853_1114_1800 228
151 3300009826 Ga0123355_10164349 Ga0123355_101643496 231
152 3300024493 Ga0264413_156405 Ga0264413_1564053 232
153 3300042619 Ga0466726_031948 Ga0466726_031948_1800_2498 232
154 3300042655 Ga0466727_034911 Ga0466727_034911_283_981 232
155 3300002462 JGI24702J35022_10010267 JGI24702J35022_100102671 233
156 3300010167 Ga0123353_10712800 Ga0123353_107128002 245

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01479 S4 S4 domain 121 168 0.98
PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain 19 120 0.98

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01479 GO:0003723 RNA binding MF
PF00163 GO:0019843 rRNA binding MF

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.79 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.