Protein Family IF00777

Metagenome Isolate
139 Members
50 Samples
134 Scaffolds
186.44 Avg Length

🧬 Representative Sequence

ID
3300002462|JGI24702J35022_10009111|JGI24702J35022_100091113
Length
206 aa
Sequence
LRRFFQFELYSCKVIKLVAMFDFVDSYPWLLPVIIYFGRICDVTLGTMRIIFVSKGEKSKAPIVGFFEVLIWVVVISQIFSHATNIVAYLAYAAGYATGNFIGLLVENKIGFGYQLFRIYSKKDGVELTKLLNQHGFGSTLIRGEGAIAEVSIIETVVRRRACKSVVEILSDFDPDTFYLIEDVRSKQKGIFAYSSAAGAPRLGK*

📊 Sample Types

Isolate 3.6%
Metagenome 96.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 42.9%
Kalotermitidae 28.6%
Unclassified 10.2%
Blattidae 6.1%
Termopsidae 6.1%
Passalidae 4.1%
Rhinotermitidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 136
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
2 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
3 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
4 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
5 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
6 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
7 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
8 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
9 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
10 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
11 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
12 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
13 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
14 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
15 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
16 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
17 3004677695 Bacteroides sp. 214 Isolate Blattidae
18 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
19 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
20 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
21 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
22 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
23 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
24 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
25 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
26 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
27 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
28 2820741847 Unclassified Bacteroidetes Th196P3bin71 Isolate Unclassified
29 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
30 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
31 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
32 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
33 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
34 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
35 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
36 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
37 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
38 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
39 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
40 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
41 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
42 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
43 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
44 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
45 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
46 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
47 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
48 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
49 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
50 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_007017 3300042659 Bacteria 9587
2 Ga0466703_252316 3300042636 Bacteria 9130
3 Ga0466704_018434 3300042643 Bacteria 4952
4 Ga0466690_057895 3300042590 Bacteria 3144
5 Ga0466691_221190 3300042593 Bacteria 20946
6 Ga0466723_261566 3300042618 Bacteria 1254
7 Ga0466701_072379 3300042598 Bacteria 1070
8 Ga0466707_329503 3300042601 Bacteria 5122
9 Ga0466716_223334 3300042605 Bacteria 4469
10 2227466327 2225789004 Unclassified 5129
11 2227507127 2225789004 Bacteria 3646
12 IMNBL1DRAFT_c0002307 3300000062 Bacteria 13392
13 IMNBL1DRAFT_c0003002 3300000062 Bacteria 11180
14 Ga0466733_132962 3300042659 Bacteria 36267
15 Ga0466703_246601 3300042636 Bacteria 4801
16 Ga0466704_227004 3300042643 Bacteria 2865
17 Ga0466709_246760 3300042648 Bacteria 12601
18 Ga0466708_154691 3300042652 Bacteria 17111
19 Ga0466725_249421 3300042654 Bacteria 18843
20 Ga0466693_395579 3300042592 Bacteria 6295
21 Ga0466696_440264 3300042596 Bacteria 2517
22 Ga0466696_484122 3300042596 Bacteria 3823
23 Ga0466710_241371 3300042613 Bacteria 5967
24 Ga0466712_204758 3300042614 Bacteria 1440
25 Ga0466700_364074 3300042600 Bacteria 2226
26 Ga0466707_400473 3300042601 Bacteria 9253
27 Ga0466716_530989 3300042605 Bacteria 3105
28 Ga0466698_226554 3300042610 Bacteria 2083
29 IMNBL1DRAFT_c0030961 3300000062 Bacteria 1953
30 JGI24702J35022_10076442 3300002462 Bacteria 1809
31 JGI24705J35276_12232819 3300002504 Bacteria 4530
32 Ga0466735_090434 3300042624 Bacteria 4006
33 Ga0466703_358563 3300042636 Bacteria 5540
34 Ga0466709_199995 3300042648 Bacteria 19280
35 Ga0466709_221860 3300042648 Bacteria 264751
36 Ga0466727_335439 3300042655 Bacteria 18470
37 Ga0123355_10011693 3300009826 Bacteria 13551
38 Ga0123354_10055837 3300010882 Bacteria 5903
39 Ga0466656_127395 3300042550 Bacteria 1111
40 Ga0466690_101782 3300042590 Bacteria 2896
41 Ga0466693_029626 3300042592 Bacteria 1601
42 Ga0466711_145131 3300042615 Bacteria 39663
43 Ga0466715_108797 3300042616 Bacteria 5158
44 Ga0466715_602253 3300042616 Bacteria 6704
45 2227591285 2225789004 Bacteria 47849
46 JGI24702J35022_10040904 3300002462 Bacteria 2472
47 JGI24702J35022_10124026 3300002462 Bacteria 1429
48 Ga0068305_10229185 3300005083 Unclassified 1259
49 Ga0072940_1115683 3300005200 Bacteria 1111
50 Ga0072940_1151613 3300005200 Bacteria 935
51 Ga0466705_268839 3300042612 Bacteria 5511
52 Ga0466705_347937 3300042612 Bacteria 6495
53 Ga0466733_115242 3300042659 Bacteria 220013
54 Ga0466735_012808 3300042624 Bacteria 3211
55 Ga0466703_047583 3300042636 Bacteria 1899
56 Ga0466704_260993 3300042643 Bacteria 2364
57 Ga0466727_061500 3300042655 Bacteria 10269
58 Ga0466727_275224 3300042655 Bacteria 5076
59 Ga0123353_10093170 3300010167 Bacteria 4854
60 Ga0123353_10368666 3300010167 Bacteria 2154
61 Ga0466691_058071 3300042593 Bacteria 16864
62 Ga0466691_117369 3300042593 Bacteria 22050
63 Ga0466696_152000 3300042596 Bacteria 9405
64 Ga0466710_058619 3300042613 Bacteria 5593
65 Ga0466718_077751 3300042617 Bacteria 1201
66 Ga0466723_095121 3300042618 Bacteria 177949
67 Ga0466726_156533 3300042619 Bacteria 4413
68 Ga0466728_213038 3300042620 Bacteria 10370
69 Ga0466716_017857 3300042605 Bacteria 3449
70 Ga0466716_309564 3300042605 Bacteria 24840
71 Ga0466719_041040 3300042606 Bacteria 6856
72 Ga0466719_282200 3300042606 Bacteria 8657
73 Ga0466698_013729 3300042610 Bacteria 1113
74 JGI24702J35022_10220515 3300002462 Bacteria 1093
75 Ga0466709_330364 3300042648 Bacteria 1525
76 Ga0466696_270387 3300042596 Bacteria 17241
77 Ga0466723_218758 3300042618 Bacteria 10546
78 Ga0466707_321078 3300042601 Bacteria 3346
79 Ga0466719_361408 3300042606 Bacteria 1567
80 Ga0466719_562631 3300042606 Bacteria 16686
81 Ga0466722_259634 3300042609 Bacteria 4757
82 Ga0466698_448009 3300042610 Bacteria 1637
83 2227203024 2225789004 Bacteria 7741
84 2227277212 2225789004 Bacteria 1266
85 2227569072 2225789004 Bacteria 14081
86 IMNBL1DRAFT_c0003650 3300000062 Bacteria 9709
87 JGI24702J35022_10004648 3300002462 Bacteria 8127
88 JGI24702J35022_10284640 3300002462 Bacteria 971
89 JGI24705J35276_12195724 3300002504 Bacteria 1529
90 Ga0466697_131670 3300042611 Bacteria 1263
91 Ga0466705_160540 3300042612 Bacteria 7165
92 Ga0466704_148810 3300042643 Bacteria 4714
93 Ga0466725_233300 3300042654 Bacteria 13777
94 Ga0466725_268082 3300042654 Bacteria 1013
95 Ga0123356_11507053 3300010049 Bacteria 830
96 Ga0466656_336010 3300042550 Bacteria 2569
97 Ga0466696_419265 3300042596 Bacteria 1165
98 Ga0466699_428065 3300042597 Bacteria 1364
99 Ga0466715_083664 3300042616 Bacteria 3486
100 Ga0466715_280804 3300042616 Bacteria 13652
101 Ga0466715_633767 3300042616 Bacteria 40285
102 Ga0466723_074044 3300042618 Bacteria 6440
103 Ga0466713_018109 3300042602 Bacteria 29610
104 Ga0466719_488694 3300042606 Bacteria 2558
105 2227480184 2225789004 Bacteria 78831
106 Ga0466704_346815 3300042643 Bacteria 2933
107 Ga0466709_272331 3300042648 Bacteria 6175
108 Ga0466724_33048 3300042649 Bacteria 5229
109 Ga0466708_431015 3300042652 Bacteria 60350
110 Ga0466727_020679 3300042655 Bacteria 20100
111 Ga0466727_040609 3300042655 Bacteria 2948
112 Ga0123356_11073260 3300010049 Bacteria 974
113 Ga0466728_087702 3300042620 Bacteria 35663
114 Ga0466701_080230 3300042598 Bacteria 1598
115 Ga0466713_023468 3300042602 Bacteria 115789
116 IMNBL1DRAFT_c0129413 3300000062 Bacteria 658
117 JGI24702J35022_10005365 3300002462 Bacteria 7508
118 Ga0072940_1296652 3300005200 Bacteria 737
119 Ga0072941_1239184 3300005201 Bacteria 1817
120 Ga0466733_025416 3300042659 Bacteria 189255
121 Ga0466703_334538 3300042636 Bacteria 14199
122 Ga0466704_325237 3300042643 Bacteria 3176
123 Ga0466709_336893 3300042648 Bacteria 4761
124 Ga0123356_10245675 3300010049 Unclassified 1864
125 Ga0466690_111029 3300042590 Bacteria 12468
126 Ga0466694_078745 3300042594 Bacteria 1349
127 Ga0466696_461997 3300042596 Bacteria 7768
128 Ga0466711_018045 3300042615 Bacteria 12600
129 Ga0466728_270835 3300042620 Bacteria 1306
130 Ga0466713_100016 3300042602 Bacteria 46673
131 IMNBL1DRAFT_c0000519 3300000062 Bacteria 31668
132 IMNBL1DRAFT_c0110284 3300000062 Bacteria 731
133 JGI24702J35022_10009111 3300002462 Bacteria 5590
134 JGI24702J35022_10370481 3300002462 Bacteria 860

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 2225789004 2227466327 2227906010 161
2 3300042619 Ga0466726_156533 Ga0466726_156533_3051_3572 173
3 3300042620 Ga0466728_270835 Ga0466728_270835_701_1222 173
4 3300042655 Ga0466727_061500 Ga0466727_061500_7114_7635 173
5 3300042618 Ga0466723_261566 Ga0466723_261566_587_1114 175
6 3300000062 IMNBL1DRAFT_c0003650 IMNBL1DRAFT_00036503 176
7 3300005200 Ga0072940_1115683 Ga0072940_11156832 177
8 3300042636 Ga0466703_252316 Ga0466703_252316_1499_2068 177
9 3300042602 Ga0466713_023468 Ga0466713_023468_24403_24948 181
10 2225789004 2227569072 2228112676 182
11 3300010049 Ga0123356_11507053 Ga0123356_115070532 182
12 3300000062 IMNBL1DRAFT_c0000519 IMNBL1DRAFT_00005196 183
13 3300042596 Ga0466696_484122 Ga0466696_484122_3069_3620 183
14 3300042659 Ga0466733_025416 Ga0466733_025416_98772_99323 183
15 3300042659 Ga0466733_115242 Ga0466733_115242_61348_61899 183
16 3300042609 Ga0466722_259634 Ga0466722_259634_946_1500 184
17 3300042596 Ga0466696_152000 Ga0466696_152000_2776_3333 185
18 3300042600 Ga0466700_364074 Ga0466700_364074_1281_1838 185
19 3300042601 Ga0466707_321078 Ga0466707_321078_2654_3211 185
20 3300042601 Ga0466707_329503 Ga0466707_329503_4267_4824 185
21 3300042605 Ga0466716_223334 Ga0466716_223334_1354_1911 185
22 3300042606 Ga0466719_282200 Ga0466719_282200_2876_3433 185
23 3300042606 Ga0466719_361408 Ga0466719_361408_239_796 185
24 3300042612 Ga0466705_268839 Ga0466705_268839_1249_1806 185
25 3300042616 Ga0466715_108797 Ga0466715_108797_1271_1828 185
26 3300042624 Ga0466735_012808 Ga0466735_012808_384_941 185
27 3300042643 Ga0466704_346815 Ga0466704_346815_1405_1962 185
28 3300042648 Ga0466709_199995 Ga0466709_199995_9719_10276 185
29 3300042648 Ga0466709_246760 Ga0466709_246760_5522_6079 185
30 3300042652 Ga0466708_431015 Ga0466708_431015_57058_57615 185
31 3300042655 Ga0466727_020679 Ga0466727_020679_16425_16982 185
32 3300042655 Ga0466727_335439 Ga0466727_335439_4671_5228 185
33 2225789004 2227203024 2227629309 186
34 3300042550 Ga0466656_127395 Ga0466656_127395_46_606 186
35 3300042550 Ga0466656_336010 Ga0466656_336010_36_596 186
36 3300042590 Ga0466690_101782 Ga0466690_101782_570_1130 186
37 3300042590 Ga0466690_111029 Ga0466690_111029_974_1534 186
38 3300042592 Ga0466693_395579 Ga0466693_395579_5721_6281 186
39 3300042593 Ga0466691_058071 Ga0466691_058071_39_599 186
40 3300042593 Ga0466691_117369 Ga0466691_117369_7672_8232 186
41 3300042593 Ga0466691_221190 Ga0466691_221190_13600_14160 186
42 3300042594 Ga0466694_078745 Ga0466694_078745_777_1337 186
43 3300042596 Ga0466696_419265 Ga0466696_419265_68_628 186
44 3300042597 Ga0466699_428065 Ga0466699_428065_408_968 186
45 3300042598 Ga0466701_072379 Ga0466701_072379_363_923 186
46 3300042598 Ga0466701_080230 Ga0466701_080230_902_1462 186
47 3300042601 Ga0466707_400473 Ga0466707_400473_4450_5010 186
48 3300042605 Ga0466716_309564 Ga0466716_309564_2343_2903 186
49 3300042605 Ga0466716_530989 Ga0466716_530989_1847_2407 186
50 3300042606 Ga0466719_041040 Ga0466719_041040_299_859 186
51 3300042606 Ga0466719_488694 Ga0466719_488694_297_857 186
52 3300042610 Ga0466698_226554 Ga0466698_226554_895_1455 186
53 3300042611 Ga0466697_131670 Ga0466697_131670_151_711 186
54 3300042612 Ga0466705_160540 Ga0466705_160540_3906_4466 186
55 3300042615 Ga0466711_018045 Ga0466711_018045_11641_12201 186
56 3300042615 Ga0466711_145131 Ga0466711_145131_9001_9561 186
57 3300042616 Ga0466715_280804 Ga0466715_280804_9853_10413 186
58 3300042616 Ga0466715_602253 Ga0466715_602253_2852_3412 186
59 3300042617 Ga0466718_077751 Ga0466718_077751_21_581 186
60 3300042618 Ga0466723_095121 Ga0466723_095121_149361_149921 186
61 3300042618 Ga0466723_218758 Ga0466723_218758_111_671 186
62 3300042620 Ga0466728_087702 Ga0466728_087702_25708_26268 186
63 3300042620 Ga0466728_213038 Ga0466728_213038_7307_7867 186
64 3300042624 Ga0466735_090434 Ga0466735_090434_146_706 186
65 3300042636 Ga0466703_334538 Ga0466703_334538_223_783 186
66 3300042636 Ga0466703_358563 Ga0466703_358563_3728_4288 186
67 3300042643 Ga0466704_148810 Ga0466704_148810_1768_2328 186
68 3300042643 Ga0466704_227004 Ga0466704_227004_1793_2353 186
69 3300042643 Ga0466704_325237 Ga0466704_325237_133_693 186
70 3300042648 Ga0466709_272331 Ga0466709_272331_3837_4397 186
71 3300042648 Ga0466709_336893 Ga0466709_336893_3849_4409 186
72 3300042654 Ga0466725_233300 Ga0466725_233300_3481_4041 186
73 3300042654 Ga0466725_249421 Ga0466725_249421_3474_4034 186
74 3300042655 Ga0466727_040609 Ga0466727_040609_556_1116 186
75 3300042655 Ga0466727_275224 Ga0466727_275224_225_785 186
76 3300042659 Ga0466733_007017 Ga0466733_007017_973_1533 186
77 iso_pr_bacteria 2940195863 2940198465 186
78 iso_pr_bacteria 3004677695 3004680344 186
79 2225789004 2227277212 2227728703 187
80 2225789004 2227480184 2227938981 187
81 2225789004 2227591285 2228150736 187
82 3300000062 IMNBL1DRAFT_c0129413 IMNBL1DRAFT_01294131 187
83 3300002462 JGI24702J35022_10004648 JGI24702J35022_100046487 187
84 3300002462 JGI24702J35022_10005365 JGI24702J35022_100053656 187
85 3300002462 JGI24702J35022_10040904 JGI24702J35022_100409042 187
86 3300002462 JGI24702J35022_10076442 JGI24702J35022_100764422 187
87 3300002462 JGI24702J35022_10124026 JGI24702J35022_101240262 187
88 3300002462 JGI24702J35022_10220515 JGI24702J35022_102205152 187
89 3300002462 JGI24702J35022_10370481 JGI24702J35022_103704812 187
90 3300002504 JGI24705J35276_12195724 JGI24705J35276_121957242 187
91 3300002504 JGI24705J35276_12232819 JGI24705J35276_122328194 187
92 3300005200 Ga0072940_1151613 Ga0072940_11516131 187
93 3300005200 Ga0072940_1296652 Ga0072940_12966521 187
94 3300005201 Ga0072941_1239184 Ga0072941_12391842 187
95 3300010049 Ga0123356_11073260 Ga0123356_110732601 187
96 3300010167 Ga0123353_10093170 Ga0123353_100931701 187
97 3300010167 Ga0123353_10368666 Ga0123353_103686662 187
98 3300042592 Ga0466693_029626 Ga0466693_029626_96_659 187
99 3300042602 Ga0466713_018109 Ga0466713_018109_28213_28776 187
100 3300042610 Ga0466698_013729 Ga0466698_013729_387_965 187
101 3300042613 Ga0466710_058619 Ga0466710_058619_1528_2091 187
102 3300042613 Ga0466710_241371 Ga0466710_241371_3935_4498 187
103 3300042614 Ga0466712_204758 Ga0466712_204758_760_1323 187
104 3300042616 Ga0466715_083664 Ga0466715_083664_2102_2665 187
105 3300042649 Ga0466724_33048 Ga0466724_33048_4164_4727 187
106 3300042654 Ga0466725_268082 Ga0466725_268082_225_788 187
107 2225789004 2227507127 2227995860 188
108 3300000062 IMNBL1DRAFT_c0002307 IMNBL1DRAFT_00023076 188
109 3300042648 Ga0466709_221860 Ga0466709_221860_24125_24691 188
110 3300042596 Ga0466696_440264 Ga0466696_440264_319_888 189
111 3300042602 Ga0466713_100016 Ga0466713_100016_43004_43573 189
112 iso_pr_bacteria 2695420314 2695470825 189
113 3300000062 IMNBL1DRAFT_c0003002 IMNBL1DRAFT_00030026 190
114 3300005083 Ga0068305_10229185 Ga0068305_102291852 190
115 3300042643 Ga0466704_018434 Ga0466704_018434_3272_3844 190
116 iso_pr_bacteria 2940216256 2940217751 190
117 3300010882 Ga0123354_10055837 Ga0123354_100558374 191
118 3300042590 Ga0466690_057895 Ga0466690_057895_2196_2771 191
119 3300042596 Ga0466696_270387 Ga0466696_270387_3145_3720 191
120 3300042605 Ga0466716_017857 Ga0466716_017857_2293_2868 191
121 3300042606 Ga0466719_562631 Ga0466719_562631_1332_1907 191
122 3300042610 Ga0466698_448009 Ga0466698_448009_968_1543 191
123 3300042612 Ga0466705_347937 Ga0466705_347937_441_1016 191
124 3300042616 Ga0466715_633767 Ga0466715_633767_30188_30763 191
125 3300042618 Ga0466723_074044 Ga0466723_074044_4986_5561 191
126 3300042636 Ga0466703_047583 Ga0466703_047583_593_1168 191
127 3300042636 Ga0466703_246601 Ga0466703_246601_3307_3882 191
128 3300042643 Ga0466704_260993 Ga0466704_260993_203_778 191
129 3300042648 Ga0466709_330364 Ga0466709_330364_124_699 191
130 3300042652 Ga0466708_154691 Ga0466708_154691_515_1090 191
131 3300000062 IMNBL1DRAFT_c0030961 IMNBL1DRAFT_00309612 192
132 3300000062 IMNBL1DRAFT_c0110284 IMNBL1DRAFT_01102841 192
133 3300009826 Ga0123355_10011693 Ga0123355_100116938 193
134 3300010049 Ga0123356_10245675 Ga0123356_102456751 193
135 3300042659 Ga0466733_132962 Ga0466733_132962_31787_32368 193
136 iso_pr_bacteria 2820741847 2820744203 193
137 3300042596 Ga0466696_461997 Ga0466696_461997_5846_6430 194
138 3300002462 JGI24702J35022_10284640 JGI24702J35022_102846401 196
139 3300002462 JGI24702J35022_10009111 JGI24702J35022_100091113 206

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF18955 DUF5698 Domain of unknown function (DUF5698) 47 103 0.99
PF10035 DUF2179 Uncharacterized protein conserved in bacteria (DUF2179) 137 185 0.95

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.55 0.64 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.