Protein Family IF00774

Metagenome Isolate
141 Members
79 Samples
108 Scaffolds
201.27 Avg Length

🧬 Representative Sequence

ID
3300002462|JGI24702J35022_10008518|JGI24702J35022_100085182
Length
233 aa
Sequence
MEKEKTGTVYDIDVMVADESHEKYVDTILETIENSAKVRGTGIAKRSHDYVAQKMREGKVIIALDGDDFAGFTYIESWGNKQYVATSGLIVADKYRNKGLARRIKHASFQLARLRWPKAKIFSLTSGSAVMKLNTELGYFPVTFADLTDDEAFWRGCNGCSNYDVLMRTQRRYCICTAMLFDPADERCLLLEKMCHSFAQKEAKKRKAEVKNGVENSSIIVNQVKKNVLSGN*

📊 Sample Types

Isolate 23.4%
Metagenome 76.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 36.4%
Termitidae 20.8%
Kalotermitidae 18.2%
Rhinotermitidae 7.8%
Unclassified 5.2%
Termopsidae 5.2%
Passalidae 3.9%
Hydrophilidae 1.3%
Hodotermitidae 1.3%

🌳 Taxonomy

Archaea 0
Bacteria 138
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
2 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
3 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
4 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
5 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
6 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
7 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
8 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
9 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
10 3004672520 Bacteroides sp. 51 Isolate Blattidae
11 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
12 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
13 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
14 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
15 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
16 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
17 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
18 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
19 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
20 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
21 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
22 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
23 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
24 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
25 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
26 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
27 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
28 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
29 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
30 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
31 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
32 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
33 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
34 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
35 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
36 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
37 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
38 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
39 3004677695 Bacteroides sp. 214 Isolate Blattidae
40 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
41 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
42 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
43 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
44 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
45 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
46 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
47 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
48 2922326829 Bacteroides sp. 224 Isolate Blattidae
49 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
50 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
51 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
52 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
53 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
54 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
55 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
56 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
57 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
58 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
59 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
60 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
61 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
62 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
63 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
64 2923982719 Parabacteroides sp. 52 Isolate Blattidae
65 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
66 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
67 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
68 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
69 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
70 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
71 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
72 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
73 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
74 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
75 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
76 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
77 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
78 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
79 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123356_10013145 3300010049 Bacteria 8004
2 Ga0466705_448736 3300042612 Bacteria 6019
3 Ga0466711_137330 3300042615 Bacteria 35994
4 Ga0466715_208835 3300042616 Bacteria 4662
5 Ga0466723_199824 3300042618 Bacteria 5378
6 Ga0466728_165817 3300042620 Bacteria 1312
7 Ga0466708_014247 3300042652 Bacteria 21773
8 Ga0466708_330262 3300042652 Bacteria 27220
9 Ga0466727_190108 3300042655 Bacteria 14426
10 IMNBL1DRAFT_c0078531 3300000062 Bacteria 931
11 Ga0466722_263608 3300042609 Bacteria 34147
12 Ga0466705_133625 3300042612 Bacteria 4588
13 Ga0466733_124204 3300042659 Bacteria 2991
14 Ga0466728_306748 3300042620 Bacteria 24885
15 Ga0466728_356489 3300042620 Bacteria 10989
16 Ga0466729_051045 3300042621 Bacteria 12078
17 Ga0466691_010037 3300042593 Bacteria 10367
18 Ga0466696_353529 3300042596 Bacteria 7911
19 Ga0466729_266607 3300042621 Bacteria 8002
20 JGI24702J35022_10024443 3300002462 Bacteria 3265
21 Ga0466706_133932 3300042599 Bacteria 8463
22 Ga0466707_277030 3300042601 Bacteria 3684
23 Ga0466707_347425 3300042601 Bacteria 8354
24 Ga0466716_333412 3300042605 Bacteria 3747
25 Ga0466705_185186 3300042612 Unclassified 1411
26 Ga0466732_087706 3300042656 Bacteria 1655
27 Ga0466733_132399 3300042659 Bacteria 35400
28 Ga0466690_013306 3300042590 Bacteria 11978
29 Ga0466731_136611 3300042622 Bacteria 2645
30 Ga0466730_093313 3300042625 Unclassified 2507
31 Ga0466703_114450 3300042636 Bacteria 5480
32 Ga0466704_200286 3300042643 Bacteria 8231
33 2227496580 2225789004 Unclassified 3916
34 IMNBL1DRAFT_c0017621 3300000062 Bacteria 2998
35 Ga0068305_10020971 3300005083 Bacteria 33055
36 Ga0466719_176856 3300042606 Bacteria 5125
37 Ga0466719_376968 3300042606 Bacteria 2454
38 Ga0123354_10001081 3300010882 Bacteria 31466
39 Ga0466715_613283 3300042616 Bacteria 7780
40 Ga0466726_091824 3300042619 Bacteria 1628
41 Ga0466729_123324 3300042621 Bacteria 7053
42 Ga0466691_108850 3300042593 Bacteria 6164
43 Ga0466703_135243 3300042636 Bacteria 1977
44 Ga0466704_505823 3300042643 Bacteria 19480
45 Ga0466708_349535 3300042652 Bacteria 6314
46 JGI24702J35022_10008518 3300002462 Bacteria 5804
47 JGI24702J35022_10011567 3300002462 Bacteria 4917
48 Ga0466733_024711 3300042659 Bacteria 63451
49 Ga0466711_161163 3300042615 Bacteria 17839
50 Ga0466711_231558 3300042615 Bacteria 14810
51 Ga0265387_1003556 3300024582 Bacteria 2143
52 Ga0466656_028563 3300042550 Bacteria 16060
53 Ga0466690_180282 3300042590 Bacteria 25954
54 Ga0466690_336420 3300042590 Bacteria 10674
55 Ga0466704_486621 3300042643 Bacteria 6328
56 Ga0466727_188460 3300042655 Bacteria 6030
57 IMNBL1DRAFT_c0000168 3300000062 Bacteria 58839
58 JGI24702J35022_10000615 3300002462 Bacteria 21682
59 Ga0068305_10032167 3300005083 Bacteria 15858
60 Ga0072941_1317022 3300005201 Bacteria 1081
61 Ga0123357_10002062 3300009784 Bacteria 22044
62 Ga0466701_074493 3300042598 Bacteria 3597
63 Ga0466707_354392 3300042601 Bacteria 12097
64 Ga0466716_441587 3300042605 Bacteria 5758
65 Ga0123356_10702570 3300010049 Bacteria 1180
66 Ga0123353_10354202 3300010167 Bacteria 2210
67 Ga0466723_108082 3300042618 Bacteria 9241
68 Ga0466726_170449 3300042619 Bacteria 3008
69 Ga0466728_325649 3300042620 Bacteria 7234
70 Ga0466692_009647 3300042591 Bacteria 10786
71 Ga0466735_138101 3300042624 Bacteria 2154
72 Ga0466703_393730 3300042636 Bacteria 3938
73 Ga0466709_011326 3300042648 Bacteria 23746
74 2226991485 2225789003 Bacteria 7193
75 IMNBL1DRAFT_c0002288 3300000062 Bacteria 13463
76 JGI24698J34947_10030403 3300002449 Bacteria 2848
77 Ga0466713_077725 3300042602 Bacteria 10308
78 Ga0466719_209125 3300042606 Bacteria 3289
79 Ga0466722_043264 3300042609 Bacteria 4667
80 Ga0466722_187170 3300042609 Bacteria 3410
81 Ga0466715_019255 3300042616 Bacteria 20255
82 Ga0466690_079211 3300042590 Bacteria 4025
83 Ga0466695_241634 3300042595 Bacteria 1904
84 Ga0466696_031717 3300042596 Bacteria 4905
85 Ga0466696_100380 3300042596 Bacteria 2778
86 Ga0466703_198609 3300042636 Bacteria 8838
87 Ga0466703_422052 3300042636 Bacteria 8727
88 Ga0466708_224946 3300042652 Bacteria 22929
89 Ga0466727_108549 3300042655 Bacteria 17021
90 JGI24705J35276_12238515 3300002504 Bacteria 24729
91 Ga0068305_10415446 3300005083 Bacteria 1778
92 Ga0466713_077783 3300042602 Bacteria 8388
93 Ga0466713_081773 3300042602 Bacteria 94516
94 Ga0466719_525073 3300042606 Bacteria 16045
95 Ga0466705_317509 3300042612 Bacteria 8974
96 Ga0466733_093307 3300042659 Bacteria 1444
97 Ga0466711_111925 3300042615 Bacteria 13247
98 Ga0466715_044469 3300042616 Bacteria 20161
99 Ga0466726_271607 3300042619 Bacteria 3044
100 Ga0466690_141500 3300042590 Bacteria 4349
101 Ga0466693_296298 3300042592 Bacteria 1402
102 Ga0466703_103094 3300042636 Bacteria 14416
103 Ga0466727_119042 3300042655 Bacteria 8803
104 JGI24702J35022_10000190 3300002462 Bacteria 32930
105 Ga0068302_10035131 3300005071 Bacteria 6636
106 Ga0466713_041042 3300042602 Bacteria 19187
107 Ga0466714_082006 3300042603 Bacteria 191145
108 Ga0466716_224142 3300042605 Bacteria 1365

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042619 Ga0466726_271607 Ga0466726_271607_1852_2415 187
2 3300042655 Ga0466727_119042 Ga0466727_119042_3268_3831 187
3 3300042590 Ga0466690_013306 Ga0466690_013306_8710_9276 188
4 3300042620 Ga0466728_306748 Ga0466728_306748_19118_19684 188
5 3300042621 Ga0466729_051045 Ga0466729_051045_10707_11273 188
6 3300042621 Ga0466729_123324 Ga0466729_123324_1276_1842 188
7 3300042652 Ga0466708_330262 Ga0466708_330262_16570_17136 188
8 3300042656 Ga0466732_087706 Ga0466732_087706_268_834 188
9 3300042659 Ga0466733_132399 Ga0466733_132399_31733_32299 188
10 3300042609 Ga0466722_043264 Ga0466722_043264_532_1101 189
11 3300042591 Ga0466692_009647 Ga0466692_009647_929_1501 190
12 3300042620 Ga0466728_356489 Ga0466728_356489_6671_7243 190
13 3300002462 JGI24702J35022_10011567 JGI24702J35022_100115676 191
14 3300009784 Ga0123357_10002062 Ga0123357_100020625 191
15 3300042592 Ga0466693_296298 Ga0466693_296298_611_1186 191
16 3300042609 Ga0466722_263608 Ga0466722_263608_19205_19780 191
17 3300042620 Ga0466728_325649 Ga0466728_325649_2607_3182 191
18 3300042636 Ga0466703_114450 Ga0466703_114450_3490_4065 191
19 3300042643 Ga0466704_200286 Ga0466704_200286_3201_3776 191
20 3300042643 Ga0466704_486621 Ga0466704_486621_4324_4899 191
21 3300042590 Ga0466690_079211 Ga0466690_079211_524_1102 192
22 3300042590 Ga0466690_141500 Ga0466690_141500_2796_3374 192
23 3300042590 Ga0466690_180282 Ga0466690_180282_13917_14495 192
24 3300042593 Ga0466691_108850 Ga0466691_108850_3575_4153 192
25 3300042601 Ga0466707_277030 Ga0466707_277030_2834_3412 192
26 iso_pr_bacteria 2609459943 2610742676 192
27 iso_pr_bacteria 2923982719 2923984843 192
28 iso_pr_bacteria 2940371297 2940372592 192
29 3300005071 Ga0068302_10035131 Ga0068302_100351314 193
30 3300042599 Ga0466706_133932 Ga0466706_133932_647_1228 193
31 3300042602 Ga0466713_081773 Ga0466713_081773_66048_66683 193
32 3300042605 Ga0466716_441587 Ga0466716_441587_4053_4634 193
33 3300042612 Ga0466705_133625 Ga0466705_133625_3040_3675 193
34 3300042612 Ga0466705_185186 Ga0466705_185186_452_1087 193
35 3300042625 Ga0466730_093313 Ga0466730_093313_1845_2480 193
36 3300042636 Ga0466703_393730 Ga0466703_393730_3190_3825 193
37 3300024582 Ga0265387_1003556 Ga0265387_10035562 194
38 3300042612 Ga0466705_317509 Ga0466705_317509_6404_6988 194
39 3300042616 Ga0466715_044469 Ga0466715_044469_8306_8890 194
40 3300042636 Ga0466703_135243 Ga0466703_135243_171_755 194
41 iso_pr_bacteria 2940202316 2940203846 194
42 3300042595 Ga0466695_241634 Ga0466695_241634_216_851 195
43 3300042606 Ga0466719_209125 Ga0466719_209125_999_1586 195
44 3300042652 Ga0466708_014247 Ga0466708_014247_3599_4186 195
45 3300042655 Ga0466727_108549 Ga0466727_108549_12375_12962 195
46 iso_pr_bacteria 2922326829 2922328706 195
47 iso_pr_bacteria 3004677695 3004680164 195
48 3300002449 JGI24698J34947_10030403 JGI24698J34947_100304032 196
49 3300042605 Ga0466716_333412 Ga0466716_333412_1325_1915 196
50 3300042616 Ga0466715_019255 Ga0466715_019255_13630_14220 196
51 3300042636 Ga0466703_198609 Ga0466703_198609_5581_6171 196
52 3300042659 Ga0466733_124204 Ga0466733_124204_290_880 196
53 iso_pr_bacteria 2910930387 2910930937 196
54 3300042602 Ga0466713_077783 Ga0466713_077783_1521_2114 197
55 3300042620 Ga0466728_165817 Ga0466728_165817_40_633 197
56 3300002504 JGI24705J35276_12238515 JGI24705J35276_1223851510 198
57 3300005083 Ga0068305_10415446 Ga0068305_104154461 198
58 3300042605 Ga0466716_224142 Ga0466716_224142_76_672 198
59 3300042618 Ga0466723_199824 Ga0466723_199824_3796_4392 198
60 3300042648 Ga0466709_011326 Ga0466709_011326_1834_2430 198
61 3300042601 Ga0466707_354392 Ga0466707_354392_4346_4945 199
62 3300042612 Ga0466705_448736 Ga0466705_448736_1127_1726 199
63 3300042615 Ga0466711_231558 Ga0466711_231558_2107_2706 199
64 3300042622 Ga0466731_136611 Ga0466731_136611_603_1202 199
65 3300042636 Ga0466703_422052 Ga0466703_422052_577_1176 199
66 3300042643 Ga0466704_505823 Ga0466704_505823_1395_1994 199
67 iso_pr_bacteria 3004672520 3004674828 199
68 3300042596 Ga0466696_100380 Ga0466696_100380_807_1409 200
69 3300042602 Ga0466713_077725 Ga0466713_077725_1993_2595 200
70 3300042609 Ga0466722_187170 Ga0466722_187170_300_902 200
71 3300042619 Ga0466726_170449 Ga0466726_170449_1535_2137 200
72 3300042624 Ga0466735_138101 Ga0466735_138101_118_720 200
73 3300042655 Ga0466727_190108 Ga0466727_190108_4106_4708 200
74 iso_pr_bacteria 2940216256 2940217818 200
75 3300005083 Ga0068305_10020971 Ga0068305_100209719 201
76 3300042550 Ga0466656_028563 Ga0466656_028563_6726_7331 201
77 3300042615 Ga0466711_137330 Ga0466711_137330_33008_33613 201
78 3300042652 Ga0466708_224946 Ga0466708_224946_4652_5257 201
79 iso_pr_bacteria 2873600114 2873603354 201
80 3300010049 Ga0123356_10702570 Ga0123356_107025702 202
81 3300010882 Ga0123354_10001081 Ga0123354_1000108115 202
82 3300042598 Ga0466701_074493 Ga0466701_074493_2286_2894 202
83 3300042636 Ga0466703_103094 Ga0466703_103094_4533_5141 202
84 iso_pr_bacteria 2940199050 2940202226 202
85 iso_pr_bacteria 2940209341 2940210994 202
86 iso_pr_bacteria 2940346213 2940348377 202
87 3300000062 IMNBL1DRAFT_c0002288 IMNBL1DRAFT_00022887 204
88 3300005201 Ga0072941_1317022 Ga0072941_13170221 204
89 3300010049 Ga0123356_10013145 Ga0123356_100131455 204
90 3300042590 Ga0466690_336420 Ga0466690_336420_6465_7079 204
91 3300042601 Ga0466707_347425 Ga0466707_347425_2430_3044 204
92 3300042603 Ga0466714_082006 Ga0466714_082006_25726_26340 204
93 3300042606 Ga0466719_525073 Ga0466719_525073_3659_4273 204
94 3300042615 Ga0466711_111925 Ga0466711_111925_8355_8969 204
95 3300042618 Ga0466723_108082 Ga0466723_108082_3974_4588 204
96 3300042652 Ga0466708_349535 Ga0466708_349535_139_753 204
97 3300000062 IMNBL1DRAFT_c0078531 IMNBL1DRAFT_00785312 205
98 3300042616 Ga0466715_208835 Ga0466715_208835_3448_4068 206
99 3300042606 Ga0466719_376968 Ga0466719_376968_1546_2169 207
100 3300042655 Ga0466727_188460 Ga0466727_188460_3563_4186 207
101 3300002462 JGI24702J35022_10000615 JGI24702J35022_1000061513 208
102 3300042615 Ga0466711_161163 Ga0466711_161163_8857_9483 208
103 3300042659 Ga0466733_093307 Ga0466733_093307_20_646 208
104 iso_pr_bacteria 2940205530 2940206284 208
105 iso_pr_bacteria 2940212447 2940213442 208
106 iso_pr_bacteria 2940298504 2940299255 208
107 iso_pr_bacteria 2940302308 2940303303 208
108 iso_pr_bacteria 2940306115 2940306800 208
109 iso_pr_bacteria 2940309933 2940310616 208
110 iso_pr_bacteria 2940313741 2940314669 208
111 iso_pr_bacteria 2940317558 2940318484 208
112 iso_pr_bacteria 2940321370 2940322296 208
113 iso_pr_bacteria 2940325180 2940326175 208
114 iso_pr_bacteria 2940328985 2940329738 208
115 iso_pr_bacteria 2940332795 2940333480 208
116 3300042596 Ga0466696_353529 Ga0466696_353529_3422_4051 209
117 3300042619 Ga0466726_091824 Ga0466726_091824_797_1426 209
118 iso_pr_bacteria 8100166142 8100168555 209
119 3300042621 Ga0466729_266607 Ga0466729_266607_5490_6122 210
120 3300042659 Ga0466733_024711 Ga0466733_024711_26836_27468 210
121 iso_pr_bacteria 2695420931 2698110337 211
122 iso_pr_bacteria 2910942425 2910946715 211
123 iso_pr_bacteria 2940244548 2940246105 211
124 iso_pr_bacteria 2940248789 2940249929 211
125 iso_pr_bacteria 2940253009 2940254003 211
126 iso_pr_bacteria 2940257232 2940258171 211
127 3300005083 Ga0068305_10032167 Ga0068305_1003216710 212
128 iso_pr_bacteria 8100157865 8100161149 212
129 2225789003 2226991485 2227341727 213
130 3300042596 Ga0466696_031717 Ga0466696_031717_795_1526 214
131 3300000062 IMNBL1DRAFT_c0000168 IMNBL1DRAFT_000016841 215
132 3300042593 Ga0466691_010037 Ga0466691_010037_3508_4158 216
133 3300042602 Ga0466713_041042 Ga0466713_041042_9603_10256 217
134 2225789004 2227496580 2227974421 218
135 3300042606 Ga0466719_176856 Ga0466719_176856_3850_4509 219
136 3300000062 IMNBL1DRAFT_c0017621 IMNBL1DRAFT_00176212 221
137 3300042616 Ga0466715_613283 Ga0466715_613283_4998_5666 222
138 3300010167 Ga0123353_10354202 Ga0123353_103542023 228
139 3300002462 JGI24702J35022_10000190 JGI24702J35022_1000019012 231
140 3300002462 JGI24702J35022_10024443 JGI24702J35022_100244432 231
141 3300002462 JGI24702J35022_10008518 JGI24702J35022_100085182 233

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.