Protein Family IF00771

Metagenome Isolate
171 Members
80 Samples
150 Scaffolds
313.09 Avg Length

🧬 Representative Sequence

ID
3300002462|JGI24702J35022_10006875|JGI24702J35022_100068752
Length
375 aa
Sequence
VSESDALNESIAKPVNLIGNADISPTYTGEPAGSPDGRVGRAPSSFTIALNDSVSSGQASSGSAPILISLVVPCYNEQEAIPLLYDEACAVLKDMKQKNIVGEFVFIDDGSVDKTLEVIDRLSKKDDRVHYLSFSRNFGKEAALLAGMQKSRGQFVVTLDVDGQDPPRMIPDMLKPVYSGEFDCACSRRVTRKGEPAIRSFFARIFYKIMGILSDIEIVDGARDFRLMSRAYVDCILSLPESNRFSKGIFPWIGFRTKWFEYENVKRVAGETKWSFVKLFRYSIDGILAFSAKPLAIASVLGVLFFIGSIALIXVVAVRRIMFGDPVAGWASTVCIILFCSGIQLFTTGILGAYLSKAYTEVKQRPRYLVKIEK*

📊 Sample Types

Isolate 12.3%
Metagenome 87.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 41.9%
Unclassified 17.6%
Kalotermitidae 14.9%
Termopsidae 5.4%
Tenebrionidae 5.4%
Drosophilidae 4.1%
Rhinotermitidae 2.7%
Apidae 1.4%
Bombycidae 1.4%
Vespidae 1.4%
Hodotermitidae 1.4%
Passalidae 1.4%
Hydrophilidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 158
Eukaryota 0
Viruses 0
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
2 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
3 8018750880 Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 Isolate
4 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
5 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
6 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
7 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
8 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
9 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
10 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
11 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
12 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
13 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
14 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
15 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
16 8017458139 Lactobacillus johnsonii CRL1647 Isolate Apidae
17 8017489919 Lactobacillus brevis EF Isolate Unclassified
18 2820507989 Unclassified Firmicutes Lab288P1bin41 Isolate Unclassified
19 2825804107 Enterococcus durans BDGP3 Isolate Drosophilidae
20 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
21 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
22 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
23 2820582954 Unclassified Firmicutes Emb289P3bin119 Isolate Unclassified
24 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
25 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
26 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
27 8108568626 Enterococcus sp. DIV1094 Isolate
28 2900804455 Listeria sp. PSOL-1 Marseille-P4284 Isolate Unclassified
29 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
30 3300007767 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut Metagenome Drosophilidae
31 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
32 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
33 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
34 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
35 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
36 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
37 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
38 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
39 2718218026 Phaeobacter porticola P97 Isolate Unclassified
40 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
41 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
42 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
43 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
44 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
45 8018754795 Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 Isolate
46 8038268975 Enterococcus mundtii EM01 Isolate Bombycidae
47 2778260937 Unclassified Fibrobacteres Co191P3bin40 Isolate Unclassified
48 2881375749 Vagococcus entomophilus DSM 24756 Isolate Vespidae
49 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
50 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
51 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
52 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
53 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
54 2820041270 Unclassified Saccharibacteria Co191P4bin22 Isolate Unclassified
55 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
56 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
57 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
58 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
59 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
60 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
61 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
62 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
63 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
64 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
65 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
66 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
67 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
68 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
69 2873581347 Vagococcus hydrophili HDW17B Isolate Hydrophilidae
70 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
71 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
72 2820411483 Unclassified Firmicutes Lab288P4bin76 Isolate Unclassified
73 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
74 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
75 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
76 8114555646 Enterococcus sp. DIV1094 Isolate
77 2820464928 Unclassified Firmicutes Lab288P3bin121 Isolate Unclassified
78 2820950349 Unclassified Acidobacteria Lab288P3bin89 Isolate Unclassified
79 2896843662 Levilactobacillus brevis BDGP6 Isolate Drosophilidae
80 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 JGI24698J34947_10027126 3300002449 Bacteria 3040
2 JGI24697J35500_11269480 3300002507 Unclassified 4000
3 Ga0068302_10041155 3300005071 Bacteria 17191
4 Ga0072940_1000715 3300005200 Bacteria 46979
5 Ga0530661_003783 3300056564 Bacteria 4813
6 Ga0562377_1951 3300056842 Bacteria 17901
7 Ga0123353_10189914 3300010167 Bacteria 3244
8 Ga0123353_10325360 3300010167 Bacteria 2331
9 Ga0466719_358703 3300042606 Bacteria 3551
10 Ga0466691_044053 3300042593 Bacteria 1779
11 Ga0466703_208350 3300042636 Bacteria 2271
12 Ga0466712_126935 3300042614 Unclassified 6599
13 Ga0466715_205637 3300042616 Bacteria 9696
14 Ga0466728_077148 3300042620 Unclassified 4165
15 Ga0466728_083471 3300042620 Bacteria 56340
16 JGI24698J34947_10001496 3300002449 Bacteria 12356
17 JGI24698J34947_10037898 3300002449 Bacteria 2503
18 JGI24697J35500_11222185 3300002507 Bacteria 1902
19 JGI24699J35502_11132259 3300002509 Bacteria 6603
20 Ga0466732_111831 3300042656 Bacteria 1194
21 Ga0562377_0115 3300056842 Bacteria 253215
22 Ga0123357_10129472 3300009784 Bacteria 3149
23 Ga0123356_10003226 3300010049 Bacteria 17138
24 Ga0123356_10451244 3300010049 Bacteria 1434
25 Ga0123354_10000973 3300010882 Bacteria 32464
26 Ga0123354_10005735 3300010882 Bacteria 18172
27 Ga0466717_031800 3300042604 Bacteria 5561
28 Ga0264413_107337 3300024493 Bacteria 7523
29 Ga0466690_029951 3300042590 Unclassified 1155
30 Ga0466695_275797 3300042595 Bacteria 15069
31 Ga0466734_085678 3300042623 Bacteria 1451
32 Ga0466734_163051 3300042623 Bacteria 7345
33 Ga0466703_377963 3300042636 Bacteria 7428
34 Ga0466705_203766 3300042612 Bacteria 2463
35 Ga0466705_377825 3300042612 Bacteria 346954
36 Ga0466705_476604 3300042612 Bacteria 14000
37 Ga0466712_057263 3300042614 Bacteria 1966
38 Ga0466712_092683 3300042614 Bacteria 8365
39 IMNBL1DRAFT_c0001055 3300000062 Bacteria 21318
40 JGI24702J35022_10001358 3300002462 Bacteria 15188
41 JGI24705J35276_12233379 3300002504 Bacteria 4815
42 Ga0562374_1063 3300057007 Bacteria 35863
43 Ga0123357_10108199 3300009784 Bacteria 3557
44 Ga0123355_10164612 3300009826 Bacteria 3332
45 Ga0123355_10300412 3300009826 Bacteria 2189
46 Ga0123353_10004754 3300010167 Bacteria 17607
47 Ga0466706_204876 3300042599 Bacteria 3063
48 Ga0466700_016731 3300042600 Bacteria 11547
49 Ga0264413_100276 3300024493 Bacteria 6809
50 Ga0466693_293912 3300042592 Bacteria 55262
51 Ga0466731_034302 3300042622 Bacteria 6869
52 Ga0466703_254005 3300042636 Bacteria 2220
53 Ga0466712_124670 3300042614 Bacteria 8688
54 Ga0466715_306311 3300042616 Bacteria 12660
55 JGI24698J34947_10010778 3300002449 Bacteria 5017
56 JGI24698J34947_10116175 3300002449 Bacteria 1171
57 JGI24696J40584_12961685 3300002834 Bacteria 35700
58 Ga0072941_1084115 3300005201 Bacteria 2066
59 Ga0123355_10001735 3300009826 Bacteria 30429
60 Ga0123353_10196289 3300010167 Bacteria 3181
61 Ga0466706_022973 3300042599 Bacteria 3039
62 Ga0466714_167249 3300042603 Bacteria 1361
63 Ga0466721_171206 3300042608 Bacteria 36585
64 Ga0466691_075470 3300042593 Bacteria 14411
65 Ga0466730_098957 3300042625 Unclassified 3273
66 Ga0466703_006403 3300042636 Bacteria 4121
67 Ga0466710_127925 3300042613 Bacteria 32899
68 Ga0466712_285724 3300042614 Unclassified 2123
69 Ga0466715_018998 3300042616 Unclassified 3477
70 Ga0466729_043722 3300042621 Bacteria 2757
71 JGI24698J34947_10015770 3300002449 Bacteria 4109
72 JGI24702J35022_10066558 3300002462 Bacteria 1934
73 Ga0123355_10049117 3300009826 Bacteria 6861
74 Ga0466713_092878 3300042602 Bacteria 86932
75 Ga0466720_179756 3300042607 Bacteria 3388
76 Ga0415639_034451 3300038395 Bacteria 4927
77 Ga0466699_211042 3300042597 Bacteria 1136
78 Ga0466704_560442 3300042643 Bacteria 2576
79 Ga0466712_223389 3300042614 Unclassified 4469
80 Ga0466715_521573 3300042616 Bacteria 35190
81 Ga0466723_071107 3300042618 Unclassified 4243
82 Ga0072940_1116067 3300005200 Bacteria 4774
83 Ga0072940_1308134 3300005200 Bacteria 2017
84 Ga0072940_1433740 3300005200 Bacteria 1185
85 Ga0072941_1059850 3300005201 Bacteria 8040
86 Ga0072941_1177452 3300005201 Bacteria 2531
87 Ga0466732_241474 3300042656 Bacteria 6842
88 Ga0123355_10086996 3300009826 Bacteria 4968
89 Ga0123356_10006646 3300010049 Bacteria 11655
90 Ga0123353_10003606 3300010167 Bacteria 19610
91 Ga0123354_10230706 3300010882 Bacteria 1936
92 Ga0466707_304203 3300042601 Bacteria 4172
93 Ga0264413_100052 3300024493 Bacteria 41072
94 Ga0466696_289622 3300042596 Bacteria 7847
95 Ga0466735_061695 3300042624 Bacteria 9727
96 Ga0466712_083270 3300042614 Bacteria 2211
97 Ga0466712_270394 3300042614 Unclassified 20542
98 Ga0466711_032773 3300042615 Unclassified 1405
99 Ga0466715_387967 3300042616 Bacteria 50352
100 Ga0466715_603008 3300042616 Bacteria 4646
101 JGI24698J34947_10001845 3300002449 Bacteria 11302
102 JGI24698J34947_10028002 3300002449 Bacteria 2986
103 JGI24698J34947_10034742 3300002449 Unclassified 2635
104 JGI24695J34938_10000019 3300002450 Bacteria 113818
105 JGI24695J34938_10000143 3300002450 Bacteria 65111
106 JGI24695J34938_10000494 3300002450 Bacteria 38207
107 Ga0072940_1033915 3300005200 Bacteria 6032
108 Ga0105553_1001864 3300007767 Bacteria 6789
109 Ga0123355_10086584 3300009826 Bacteria 4982
110 Ga0123355_10100758 3300009826 Bacteria 4548
111 Ga0123356_10000497 3300010049 Bacteria 43842
112 Ga0123354_10111851 3300010882 Bacteria 3600
113 Ga0466707_255670 3300042601 Bacteria 5868
114 Ga0466713_083861 3300042602 Bacteria 153241
115 Ga0466717_070224 3300042604 Bacteria 2062
116 Ga0466719_335353 3300042606 Bacteria 8466
117 Ga0466720_030847 3300042607 Bacteria 16885
118 Ga0466720_033071 3300042607 Bacteria 39305
119 Ga0466722_044560 3300042609 Bacteria 1985
120 Ga0466722_217025 3300042609 Bacteria 3301
121 Ga0466722_250924 3300042609 Bacteria 1367
122 Ga0264413_118005 3300024493 Bacteria 7785
123 Ga0466690_008152 3300042590 Bacteria 8252
124 Ga0466695_074130 3300042595 Bacteria 7546
125 Ga0466703_153521 3300042636 Bacteria 25421
126 Ga0466724_53191 3300042649 Bacteria 6132
127 Ga0466712_133436 3300042614 Bacteria 1790
128 Ga0466715_257295 3300042616 Bacteria 129667
129 Ga0466718_051974 3300042617 Bacteria 6971
130 AustNasuHG_c1003231 3300000089 Bacteria 5882
131 JGI24702J35022_10006875 3300002462 Bacteria 6551
132 JGI24696J40584_12932256 3300002834 Bacteria 1499
133 Ga0072941_1029383 3300005201 Bacteria 16244
134 Ga0562375_0037 3300056856 Bacteria 606076
135 Ga0123355_10262449 3300009826 Bacteria 2413
136 Ga0123356_10088656 3300010049 Bacteria 2942
137 Ga0123356_10257666 3300010049 Bacteria 1826
138 Ga0466713_045311 3300042602 Bacteria 10275
139 Ga0466720_223562 3300042607 Bacteria 2413
140 Ga0264413_100275 3300024493 Bacteria 6993
141 Ga0264413_108624 3300024493 Bacteria 6420
142 Ga0264413_131865 3300024493 Unclassified 2524
143 Ga0264413_136733 3300024493 Bacteria 3515
144 Ga0466699_038142 3300042597 Bacteria 1166
145 Ga0466704_542684 3300042643 Bacteria 2520
146 Ga0466727_323246 3300042655 Bacteria 13797
147 Ga0466705_054861 3300042612 Bacteria 3370
148 Ga0466705_365605 3300042612 Bacteria 4055
149 Ga0466715_582288 3300042616 Bacteria 10954
150 Ga0466726_357621 3300042619 Bacteria 4962

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042590 Ga0466690_029951 Ga0466690_029951_349_1119 256
2 3300005200 Ga0072940_1116067 Ga0072940_11160672 272
3 3300038395 Ga0415639_034451 Ga0415639_034451_2343_3302 282
4 3300042601 Ga0466707_255670 Ga0466707_255670_4439_5392 287
5 3300002450 JGI24695J34938_10000019 JGI24695J34938_1000001910 289
6 3300042614 Ga0466712_126935 Ga0466712_126935_3409_4314 289
7 3300009826 Ga0123355_10100758 Ga0123355_101007581 290
8 3300042595 Ga0466695_275797 Ga0466695_275797_4926_5861 290
9 3300009826 Ga0123355_10049117 Ga0123355_100491176 291
10 3300042609 Ga0466722_044560 Ga0466722_044560_671_1642 293
11 3300042614 Ga0466712_285724 Ga0466712_285724_342_1247 294
12 3300042609 Ga0466722_250924 Ga0466722_250924_120_1049 296
13 3300042616 Ga0466715_018998 Ga0466715_018998_1265_2158 297
14 3300002449 JGI24698J34947_10001845 JGI24698J34947_100018455 299
15 3300042592 Ga0466693_293912 Ga0466693_293912_13644_14573 300
16 3300042614 Ga0466712_133436 Ga0466712_133436_233_1135 300
17 3300002449 JGI24698J34947_10010778 JGI24698J34947_100107781 301
18 3300042612 Ga0466705_054861 Ga0466705_054861_435_1427 301
19 3300042614 Ga0466712_083270 Ga0466712_083270_448_1353 301
20 3300042614 Ga0466712_223389 Ga0466712_223389_3124_4029 301
21 3300042656 Ga0466732_241474 Ga0466732_241474_4443_5348 301
22 3300009784 Ga0123357_10129472 Ga0123357_101294722 302
23 3300009826 Ga0123355_10001735 Ga0123355_1000173513 302
24 3300010049 Ga0123356_10088656 Ga0123356_100886562 302
25 3300024493 Ga0264413_108624 Ga0264413_1086246 302
26 3300024493 Ga0264413_118005 Ga0264413_1180056 302
27 3300042607 Ga0466720_179756 Ga0466720_179756_660_1604 302
28 3300002449 JGI24698J34947_10037898 JGI24698J34947_100378983 304
29 3300005201 Ga0072941_1177452 Ga0072941_11774522 304
30 3300002449 JGI24698J34947_10001496 JGI24698J34947_100014966 305
31 3300002449 JGI24698J34947_10028002 JGI24698J34947_100280023 305
32 3300002449 JGI24698J34947_10116175 JGI24698J34947_101161751 305
33 3300009826 Ga0123355_10262449 Ga0123355_102624492 305
34 iso_pr_bacteria 2778260937 2778347673 305
35 3300002450 JGI24695J34938_10000494 JGI24695J34938_1000049421 306
36 3300002507 JGI24697J35500_11269480 JGI24697J35500_112694801 306
37 3300005200 Ga0072940_1000715 Ga0072940_10007153 306
38 3300024493 Ga0264413_131865 Ga0264413_1318652 306
39 3300024493 Ga0264413_136733 Ga0264413_1367332 306
40 3300042599 Ga0466706_022973 Ga0466706_022973_1298_2239 306
41 3300042614 Ga0466712_270394 Ga0466712_270394_4459_5379 306
42 3300042622 Ga0466731_034302 Ga0466731_034302_2835_3779 306
43 3300042656 Ga0466732_111831 Ga0466732_111831_144_1139 306
44 3300009826 Ga0123355_10086584 Ga0123355_100865842 307
45 3300024493 Ga0264413_100052 Ga0264413_10005216 307
46 3300042614 Ga0466712_092683 Ga0466712_092683_4049_4972 307
47 3300042617 Ga0466718_051974 Ga0466718_051974_4436_5386 307
48 iso_pr_bacteria 2820411483 2820411572 307
49 iso_pr_bacteria 2967483437 2967483519 307
50 3300002449 JGI24698J34947_10015770 JGI24698J34947_100157702 308
51 3300002449 JGI24698J34947_10034742 JGI24698J34947_100347422 308
52 3300010882 Ga0123354_10005735 Ga0123354_100057352 308
53 3300042599 Ga0466706_204876 Ga0466706_204876_326_1252 308
54 3300000062 IMNBL1DRAFT_c0001055 IMNBL1DRAFT_00010554 309
55 3300042590 Ga0466690_008152 Ga0466690_008152_5734_6663 309
56 3300042593 Ga0466691_044053 Ga0466691_044053_802_1731 309
57 3300042593 Ga0466691_075470 Ga0466691_075470_4306_5235 309
58 3300042602 Ga0466713_045311 Ga0466713_045311_4722_5651 309
59 3300042604 Ga0466717_031800 Ga0466717_031800_2103_3032 309
60 3300042604 Ga0466717_070224 Ga0466717_070224_570_1499 309
61 3300042614 Ga0466712_124670 Ga0466712_124670_7367_8296 309
62 3300042615 Ga0466711_032773 Ga0466711_032773_353_1282 309
63 3300042616 Ga0466715_387967 Ga0466715_387967_8301_9230 309
64 3300042620 Ga0466728_083471 Ga0466728_083471_39005_39934 309
65 3300042636 Ga0466703_153521 Ga0466703_153521_20383_21312 309
66 iso_pr_bacteria 2820507989 2820508196 309
67 3300042603 Ga0466714_167249 Ga0466714_167249_407_1339 310
68 3300042612 Ga0466705_365605 Ga0466705_365605_1487_2482 310
69 3300042621 Ga0466729_043722 Ga0466729_043722_1110_2042 310
70 3300056564 Ga0530661_003783 Ga0530661_003783_2178_3110 310
71 3300056842 Ga0562377_0115 Ga0562377_0115_120070_121002 310
72 3300056842 Ga0562377_1951 Ga0562377_1951_13505_14437 310
73 iso_pr_bacteria 8017458139 8017458742 310
74 iso_pr_bacteria 8018750880 8018751411 310
75 iso_pr_bacteria 8018754795 8018756961 310
76 3300005201 Ga0072941_1059850 Ga0072941_10598509 311
77 3300010167 Ga0123353_10003606 Ga0123353_1000360611 311
78 3300042616 Ga0466715_306311 Ga0466715_306311_7448_8383 311
79 3300042655 Ga0466727_323246 Ga0466727_323246_1548_2483 311
80 iso_pr_bacteria 2820582954 2820582982 311
81 iso_pr_bacteria 2900804455 2900806272 311
82 3300009826 Ga0123355_10086996 Ga0123355_100869963 312
83 3300009826 Ga0123355_10300412 Ga0123355_103004123 312
84 3300010049 Ga0123356_10006646 Ga0123356_1000664611 312
85 3300010049 Ga0123356_10257666 Ga0123356_102576662 312
86 3300010167 Ga0123353_10325360 Ga0123353_103253602 312
87 3300010882 Ga0123354_10111851 Ga0123354_101118512 312
88 3300057007 Ga0562374_1063 Ga0562374_1063_26111_27049 312
89 3300010049 Ga0123356_10003226 Ga0123356_1000322616 313
90 3300042607 Ga0466720_223562 Ga0466720_223562_639_1580 313
91 3300042616 Ga0466715_205637 Ga0466715_205637_293_1234 313
92 3300042619 Ga0466726_357621 Ga0466726_357621_2488_3495 313
93 3300042643 Ga0466704_542684 Ga0466704_542684_1054_1995 313
94 3300056856 Ga0562375_0037 Ga0562375_0037_466166_467107 313
95 iso_pr_bacteria 2896843662 2896844835 313
96 iso_pr_bacteria 8017489919 8017492354 313
97 3300009826 Ga0123355_10164612 Ga0123355_101646122 314
98 3300010049 Ga0123356_10000497 Ga0123356_1000049723 314
99 3300042625 Ga0466730_098957 Ga0466730_098957_74_1018 314
100 3300042636 Ga0466703_006403 Ga0466703_006403_2809_3753 314
101 3300042636 Ga0466703_254005 Ga0466703_254005_838_1782 314
102 3300042649 Ga0466724_53191 Ga0466724_53191_341_1285 314
103 3300005201 Ga0072941_1029383 Ga0072941_102938311 315
104 iso_pr_bacteria 2825804107 2825805646 315
105 3300024493 Ga0264413_100276 Ga0264413_1002762 316
106 3300024493 Ga0264413_107337 Ga0264413_1073378 316
107 3300042596 Ga0466696_289622 Ga0466696_289622_4299_5321 316
108 3300042597 Ga0466699_211042 Ga0466699_211042_51_1001 316
109 3300042602 Ga0466713_083861 Ga0466713_083861_117706_118656 316
110 3300042612 Ga0466705_203766 Ga0466705_203766_1156_2106 316
111 3300042616 Ga0466715_257295 Ga0466715_257295_99495_100445 316
112 3300042620 Ga0466728_077148 Ga0466728_077148_46_996 316
113 3300000089 AustNasuHG_c1003231 AustNasuHG_10032315 317
114 3300002449 JGI24698J34947_10027126 JGI24698J34947_100271262 317
115 3300002507 JGI24697J35500_11222185 JGI24697J35500_112221852 317
116 3300005200 Ga0072940_1033915 Ga0072940_10339157 317
117 3300005200 Ga0072940_1308134 Ga0072940_13081342 317
118 3300042601 Ga0466707_304203 Ga0466707_304203_267_1277 317
119 3300042606 Ga0466719_358703 Ga0466719_358703_1622_2575 317
120 3300042616 Ga0466715_521573 Ga0466715_521573_2233_3186 317
121 3300042618 Ga0466723_071107 Ga0466723_071107_997_1950 317
122 3300042624 Ga0466735_061695 Ga0466735_061695_433_1386 317
123 iso_pr_bacteria 8038268975 8038271182 317
124 iso_pr_bacteria 8108568626 8108569122 317
125 iso_pr_bacteria 8114555646 8114556142 317
126 3300002450 JGI24695J34938_10000143 JGI24695J34938_1000014324 318
127 3300002509 JGI24699J35502_11132259 JGI24699J35502_111322593 318
128 3300010882 Ga0123354_10000973 Ga0123354_1000097311 318
129 iso_pr_bacteria 2873581347 2873583932 318
130 3300009784 Ga0123357_10108199 Ga0123357_101081991 319
131 3300042602 Ga0466713_092878 Ga0466713_092878_13470_14429 319
132 3300042607 Ga0466720_033071 Ga0466720_033071_23113_24072 319
133 iso_pr_bacteria 2881375749 2881375989 319
134 3300005200 Ga0072940_1433740 Ga0072940_14337401 320
135 3300042616 Ga0466715_582288 Ga0466715_582288_2105_3067 320
136 3300042636 Ga0466703_208350 Ga0466703_208350_1165_2127 320
137 3300024493 Ga0264413_100275 Ga0264413_1002754 321
138 3300042607 Ga0466720_030847 Ga0466720_030847_1593_2558 321
139 3300042606 Ga0466719_335353 Ga0466719_335353_5261_6229 322
140 3300042609 Ga0466722_217025 Ga0466722_217025_953_1921 322
141 3300042643 Ga0466704_560442 Ga0466704_560442_252_1280 323
142 3300002504 JGI24705J35276_12233379 JGI24705J35276_122333792 324
143 3300005071 Ga0068302_10041155 Ga0068302_100411555 324
144 3300042600 Ga0466700_016731 Ga0466700_016731_7583_8557 324
145 3300042623 Ga0466734_163051 Ga0466734_163051_4324_5298 324
146 3300007767 Ga0105553_1001864 Ga0105553_10018645 325
147 3300042614 Ga0466712_057263 Ga0466712_057263_624_1625 326
148 iso_pr_bacteria 2820950349 2820950508 327
149 3300002834 JGI24696J40584_12932256 JGI24696J40584_129322562 328
150 3300010167 Ga0123353_10004754 Ga0123353_1000475412 328
151 3300010882 Ga0123354_10230706 Ga0123354_102307062 328
152 3300042612 Ga0466705_377825 Ga0466705_377825_131610_132596 328
153 iso_pr_bacteria 2820464928 2820465496 328
154 3300005201 Ga0072941_1084115 Ga0072941_10841151 329
155 3300002462 JGI24702J35022_10066558 JGI24702J35022_100665582 330
156 3300042597 Ga0466699_038142 Ga0466699_038142_138_1130 330
157 3300042623 Ga0466734_085678 Ga0466734_085678_125_1117 330
158 3300042636 Ga0466703_377963 Ga0466703_377963_2799_3794 331
159 iso_pr_bacteria 2820041270 2820041873 333
160 3300002462 JGI24702J35022_10001358 JGI24702J35022_100013583 334
161 3300002834 JGI24696J40584_12961685 JGI24696J40584_129616858 334
162 3300042595 Ga0466695_074130 Ga0466695_074130_1680_2684 334
163 3300042613 Ga0466710_127925 Ga0466710_127925_6139_7143 334
164 iso_pr_bacteria 2718218026 2719800317 334
165 3300042608 Ga0466721_171206 Ga0466721_171206_30735_31742 335
166 3300010167 Ga0123353_10196289 Ga0123353_101962891 336
167 3300042612 Ga0466705_476604 Ga0466705_476604_5024_6037 337
168 3300042616 Ga0466715_603008 Ga0466715_603008_3545_4570 341
169 3300010049 Ga0123356_10451244 Ga0123356_104512442 349
170 3300010167 Ga0123353_10189914 Ga0123353_101899142 354
171 3300002462 JGI24702J35022_10006875 JGI24702J35022_100068752 375

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00535 Glycos_transf_2 Glycosyl transferase family 2 69 236 0.96
PF10111 Glyco_tranf_2_2 Glycosyltransferase like family 2 71 175 0.78

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
5ekp-assembly1.cif.gz_A Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) 0.867 61 373
5eke-assembly1.cif.gz_A Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) 0.866 61 373
5eke-assembly1.cif.gz_C Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) 0.836 61 373
5ekp-assembly1.cif.gz_C Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) 0.836 61 374
5ekp-assembly1.cif.gz_B Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) 0.809 61 373
IDDescriptionScoreStartEndSuperfamily
af_P77293_1_188_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9341 66 257 3.90.550.10
af_Q2G2T7_1_208_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9233 66 272 3.90.550.10
af_P9WMX5_1_216_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9205 66 286 3.90.550.10
af_P77757_4_230_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8751 65 291 3.90.550.10
af_Q8WSL9_63_329_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8276 65 290 3.90.550.10
IDDescriptionScoreStartEndGO Terms
AF-A0A7Y6CFG3-F1-model_v4 Uncharacterized/unreviewed 0.9836 68 167
AF-A0A1H4FSV8-F1-model_v4 Uncharacterized/unreviewed 0.9817 66 172
AF-W2D0Y6-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9791 66 180 GO:0005886

🧪 CAZyme Annotation

ClassDescription
GT GlycosylTransferases (GT)

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.65 0.76 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.