Protein Family IF00769

Metagenome
152 Members
47 Samples
152 Scaffolds
326.22 Avg Length

🧬 Representative Sequence

ID
3300002462|JGI24702J35022_10006704|JGI24702J35022_100067043
Length
321 aa
Sequence
MKKAIVLGGGGFIGSHLIKFLKDKDFWVKGVDLKYPMFSESVADEFIIGDLRDPDIVKSVLDYPYDEVYQLAADMGGAGYIFTGENDADVMHNSATINLNVLNYSKDVGVRKIFYSSSACIYPEYNQLDPDNPKCSEDSAYPAAPDSEYGWEKLFSERLYFAYKRNYGMNVKIARFHNIFGEEGTYDGGKEKAPAAICRKVAMTPDGGEIEIWGDGKQTRSFLYISECLKGIEKLMACETFDGPVNIGSDEMVSINQLAEKIIKISGKEIRLKHISGPLGVRGRNSDNHLIQEKLGWKPEKPLTFGLEITYDWINSMVKN*

📊 Sample Types

Isolate 0.0%
Metagenome 100.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 45.5%
Kalotermitidae 31.8%
Rhinotermitidae 6.8%
Unclassified 6.8%
Termopsidae 4.5%
Armadillidiidae 4.5%

🌳 Taxonomy

Archaea 1
Bacteria 137
Eukaryota 0
Viruses 0
Unclassified 14

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
2 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
3 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
4 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
5 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
6 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
7 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
8 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
9 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
10 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
11 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
12 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
13 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
14 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
15 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
16 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
17 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
18 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
19 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
20 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
21 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
22 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
23 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
24 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
25 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
26 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
27 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
28 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
29 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
30 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
31 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
32 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
33 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
34 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
35 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
36 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
37 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
38 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
39 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
40 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
41 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
42 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
43 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
44 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
45 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
46 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
47 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_035522 3300042612 Bacteria 1864
2 Ga0466705_381721 3300042612 Bacteria 4262
3 Ga0466733_060411 3300042659 Bacteria 10084
4 JGI24695J34938_10000176 3300002450 Bacteria 59497
5 JGI24695J34938_10002113 3300002450 Bacteria 15559
6 JGI24702J35022_10074623 3300002462 Bacteria 1831
7 Ga0466703_013406 3300042636 Bacteria 31137
8 Ga0466703_135234 3300042636 Unclassified 1339
9 Ga0466704_574923 3300042643 Bacteria 1954
10 Ga0466704_613915 3300042643 Bacteria 2894
11 Ga0466709_323589 3300042648 Bacteria 6181
12 Ga0466708_294673 3300042652 Bacteria 3493
13 Ga0466712_112671 3300042614 Bacteria 3914
14 Ga0466711_074680 3300042615 Bacteria 29152
15 Ga0466715_469646 3300042616 Bacteria 15443
16 Ga0466718_133493 3300042617 Bacteria 1709
17 Ga0466723_007804 3300042618 Bacteria 10079
18 Ga0466723_013291 3300042618 Bacteria 9318
19 Ga0466723_252260 3300042618 Bacteria 5289
20 Ga0466726_056916 3300042619 Unclassified 17157
21 Ga0466726_444538 3300042619 Bacteria 2151
22 Ga0160433_100008 3300012846 Bacteria 311360
23 Ga0160443_100054 3300012848 Bacteria 237880
24 Ga0264413_137300 3300024493 Unclassified 5114
25 Ga0466691_017719 3300042593 Bacteria 3536
26 Ga0466720_129446 3300042607 Bacteria 11215
27 Ga0466705_213055 3300042612 Bacteria 3960
28 Ga0466705_220280 3300042612 Bacteria 3294
29 JGI24698J34947_10042231 3300002449 Bacteria 2344
30 Ga0072940_1129214 3300005200 Bacteria 1520
31 Ga0466704_381790 3300042643 Bacteria 14332
32 Ga0466708_329215 3300042652 Bacteria 19363
33 Ga0466727_197667 3300042655 Bacteria 1466
34 Ga0466712_139674 3300042614 Bacteria 11025
35 Ga0466711_231288 3300042615 Bacteria 2896
36 Ga0466711_391927 3300042615 Bacteria 2793
37 Ga0466715_373081 3300042616 Bacteria 2427
38 Ga0466718_126706 3300042617 Bacteria 1336
39 Ga0466723_127162 3300042618 Unclassified 5671
40 Ga0466726_302180 3300042619 Unclassified 3397
41 Ga0466690_028571 3300042590 Bacteria 6660
42 Ga0466696_004225 3300042596 Bacteria 2136
43 Ga0466696_049504 3300042596 Bacteria 7183
44 Ga0466716_055236 3300042605 Bacteria 2505
45 Ga0466719_043858 3300042606 Bacteria 23279
46 Ga0466720_039429 3300042607 Bacteria 8601
47 Ga0466705_046438 3300042612 Bacteria 15962
48 Ga0466705_150614 3300042612 Unclassified 3250
49 AustNasuHG_c1000203 3300000089 Bacteria 19564
50 JGI24702J35022_10001382 3300002462 Bacteria 15081
51 JGI24702J35022_10006704 3300002462 Bacteria 6641
52 Ga0466703_009463 3300042636 Bacteria 19190
53 Ga0466703_017503 3300042636 Bacteria 4106
54 Ga0466704_578964 3300042643 Bacteria 4352
55 Ga0466708_149666 3300042652 Bacteria 12694
56 Ga0466727_042949 3300042655 Bacteria 3573
57 Ga0466715_611063 3300042616 Bacteria 1212
58 Ga0466718_026316 3300042617 Bacteria 1447
59 Ga0466718_087558 3300042617 Bacteria 3035
60 Ga0466726_051654 3300042619 Bacteria 1604
61 Ga0466726_166452 3300042619 Bacteria 12823
62 Ga0466726_237352 3300042619 Unclassified 5467
63 Ga0466657_367130 3300042582 Bacteria 2216
64 Ga0466690_042634 3300042590 Bacteria 2337
65 Ga0466690_132016 3300042590 Bacteria 8012
66 Ga0466690_338998 3300042590 Bacteria 3901
67 Ga0466696_427561 3300042596 Bacteria 2880
68 Ga0466713_105921 3300042602 Bacteria 3584
69 Ga0466713_138185 3300042602 Bacteria 45604
70 Ga0466705_107457 3300042612 Bacteria 2960
71 JGI24702J35022_10046588 3300002462 Bacteria 2308
72 Ga0466730_050483 3300042625 Bacteria 3772
73 Ga0466704_375476 3300042643 Bacteria 2522
74 Ga0466708_318761 3300042652 Bacteria 6749
75 Ga0466715_363120 3300042616 Bacteria 3971
76 Ga0466726_040172 3300042619 Unclassified 7042
77 Ga0466726_185226 3300042619 Bacteria 5714
78 Ga0466729_076386 3300042621 Bacteria 2165
79 Ga0160430_103739 3300012852 Bacteria 4070
80 Ga0456237_0011524 3300041968 Bacteria 1290
81 Ga0466691_047978 3300042593 Bacteria 9754
82 Ga0466691_121537 3300042593 Bacteria 11235
83 Ga0466700_247952 3300042600 Bacteria 1445
84 Ga0466707_302433 3300042601 Bacteria 1183
85 Ga0466707_306427 3300042601 Bacteria 1661
86 Ga0466717_248134 3300042604 Bacteria 1515
87 Ga0466716_448498 3300042605 Bacteria 2606
88 Ga0466719_159545 3300042606 Bacteria 1693
89 Ga0466698_089011 3300042610 Bacteria 3768
90 JGI24697J35500_11274124 3300002507 Bacteria 6566
91 Ga0466708_310956 3300042652 Bacteria 3137
92 Ga0466705_471682 3300042612 Bacteria 4123
93 Ga0466712_301972 3300042614 Archaea 12210
94 Ga0466728_246151 3300042620 Bacteria 5470
95 Ga0466692_145983 3300042591 Bacteria 1530
96 Ga0466691_096660 3300042593 Bacteria 4239
97 Ga0123357_10057463 3300009784 Bacteria 5228
98 Ga0466713_048330 3300042602 Bacteria 17282
99 Ga0466719_180410 3300042606 Bacteria 4472
100 Ga0068305_10006407 3300005083 Bacteria 10456
101 Ga0068305_10011939 3300005083 Bacteria 27751
102 Ga0072941_1025687 3300005201 Bacteria 14903
103 Ga0466709_026203 3300042648 Unclassified 7350
104 Ga0466708_284999 3300042652 Bacteria 28094
105 Ga0466727_300886 3300042655 Bacteria 3141
106 Ga0466727_305709 3300042655 Bacteria 1752
107 Ga0466711_088026 3300042615 Bacteria 19290
108 Ga0466715_312136 3300042616 Bacteria 7771
109 Ga0466726_482459 3300042619 Bacteria 13117
110 Ga0264413_130353 3300024493 Bacteria 5421
111 Ga0466690_063204 3300042590 Unclassified 2454
112 Ga0123355_10004926 3300009826 Bacteria 19432
113 Ga0123353_10623972 3300010167 Bacteria 1534
114 Ga0466716_524826 3300042605 Bacteria 1487
115 Ga0466727_349740 3300042655 Unclassified 8619
116 Ga0466732_135305 3300042656 Unclassified 2152
117 Ga0466703_158061 3300042636 Bacteria 4160
118 Ga0466704_167397 3300042643 Bacteria 4692
119 Ga0466704_477832 3300042643 Bacteria 7936
120 Ga0466704_486321 3300042643 Bacteria 2789
121 Ga0466709_087743 3300042648 Bacteria 6314
122 Ga0466709_165640 3300042648 Bacteria 10886
123 Ga0466705_463000 3300042612 Bacteria 14210
124 Ga0466711_046410 3300042615 Bacteria 2863
125 Ga0466711_418453 3300042615 Bacteria 3158
126 Ga0466723_203989 3300042618 Bacteria 3535
127 Ga0466726_474491 3300042619 Bacteria 7557
128 Ga0466693_054427 3300042592 Unclassified 2160
129 Ga0466691_076803 3300042593 Bacteria 26891
130 Ga0466713_139981 3300042602 Bacteria 4019
131 Ga0466716_067274 3300042605 Bacteria 16041
132 Ga0466705_003189 3300042612 Bacteria 1993
133 Ga0466705_039077 3300042612 Bacteria 41831
134 Ga0466705_106547 3300042612 Bacteria 12868
135 JGI24702J35022_10028719 3300002462 Bacteria 2988
136 Ga0068305_10013170 3300005083 Bacteria 17816
137 Ga0072941_1127404 3300005201 Unclassified 4070
138 Ga0466709_228858 3300042648 Bacteria 27396
139 Ga0466708_246218 3300042652 Bacteria 12061
140 Ga0466727_318861 3300042655 Bacteria 1377
141 Ga0466727_340254 3300042655 Bacteria 3420
142 Ga0466711_106164 3300042615 Bacteria 1809
143 Ga0466715_032161 3300042616 Bacteria 1924
144 Ga0466715_408404 3300042616 Bacteria 4585
145 Ga0466718_003438 3300042617 Bacteria 12488
146 Ga0466728_031991 3300042620 Bacteria 25093
147 Ga0466690_015850 3300042590 Bacteria 1349
148 Ga0466690_133196 3300042590 Bacteria 2382
149 Ga0466690_243419 3300042590 Bacteria 10284
150 Ga0466707_135040 3300042601 Bacteria 6183
151 Ga0466707_341039 3300042601 Bacteria 1042
152 Ga0466717_260438 3300042604 Bacteria 3685

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042616 Ga0466715_032161 Ga0466715_032161_713_1693 300
2 3300042600 Ga0466700_247952 Ga0466700_247952_207_1130 307
3 3300042625 Ga0466730_050483 Ga0466730_050483_81_1007 308
4 3300005083 Ga0068305_10013170 Ga0068305_100131702 309
5 3300005201 Ga0072941_1127404 Ga0072941_11274043 317
6 3300042659 Ga0466733_060411 Ga0466733_060411_9111_10073 320
7 3300002450 JGI24695J34938_10002113 JGI24695J34938_1000211311 321
8 3300002462 JGI24702J35022_10006704 JGI24702J35022_100067043 321
9 3300042612 Ga0466705_039077 Ga0466705_039077_493_1458 321
10 3300042612 Ga0466705_046438 Ga0466705_046438_14565_15530 321
11 3300009784 Ga0123357_10057463 Ga0123357_100574631 322
12 3300042621 Ga0466729_076386 Ga0466729_076386_17_985 322
13 3300042612 Ga0466705_150614 Ga0466705_150614_162_1133 323
14 3300042619 Ga0466726_051654 Ga0466726_051654_390_1361 323
15 3300002462 JGI24702J35022_10074623 JGI24702J35022_100746232 324
16 3300042604 Ga0466717_260438 Ga0466717_260438_272_1246 324
17 3300042612 Ga0466705_220280 Ga0466705_220280_2076_3050 324
18 3300042617 Ga0466718_126706 Ga0466718_126706_54_1028 324
19 3300042617 Ga0466718_133493 Ga0466718_133493_423_1397 324
20 3300042619 Ga0466726_302180 Ga0466726_302180_628_1602 324
21 3300042636 Ga0466703_013406 Ga0466703_013406_29262_30236 324
22 3300042636 Ga0466703_135234 Ga0466703_135234_197_1171 324
23 3300042643 Ga0466704_486321 Ga0466704_486321_659_1633 324
24 3300042655 Ga0466727_305709 Ga0466727_305709_506_1480 324
25 3300002462 JGI24702J35022_10001382 JGI24702J35022_1000138211 325
26 3300005083 Ga0068305_10006407 Ga0068305_100064071 325
27 3300005083 Ga0068305_10011939 Ga0068305_1001193928 325
28 3300012852 Ga0160430_103739 Ga0160430_1037393 325
29 3300024493 Ga0264413_130353 Ga0264413_1303534 325
30 3300041968 Ga0456237_0011524 Ga0456237_0011524_130_1107 325
31 3300042582 Ga0466657_367130 Ga0466657_367130_696_1673 325
32 3300042590 Ga0466690_028571 Ga0466690_028571_4225_5202 325
33 3300042590 Ga0466690_132016 Ga0466690_132016_6745_7722 325
34 3300042590 Ga0466690_338998 Ga0466690_338998_1563_2540 325
35 3300042593 Ga0466691_121537 Ga0466691_121537_1244_2221 325
36 3300042596 Ga0466696_004225 Ga0466696_004225_1078_2055 325
37 3300042596 Ga0466696_049504 Ga0466696_049504_5148_6125 325
38 3300042596 Ga0466696_427561 Ga0466696_427561_620_1597 325
39 3300042605 Ga0466716_055236 Ga0466716_055236_947_1924 325
40 3300042605 Ga0466716_067274 Ga0466716_067274_3196_4173 325
41 3300042605 Ga0466716_448498 Ga0466716_448498_1139_2116 325
42 3300042606 Ga0466719_043858 Ga0466719_043858_15041_16018 325
43 3300042606 Ga0466719_159545 Ga0466719_159545_589_1566 325
44 3300042606 Ga0466719_180410 Ga0466719_180410_1525_2502 325
45 3300042607 Ga0466720_039429 Ga0466720_039429_4528_5505 325
46 3300042612 Ga0466705_035522 Ga0466705_035522_433_1410 325
47 3300042612 Ga0466705_213055 Ga0466705_213055_148_1125 325
48 3300042612 Ga0466705_471682 Ga0466705_471682_1929_2906 325
49 3300042614 Ga0466712_112671 Ga0466712_112671_1939_2916 325
50 3300042614 Ga0466712_301972 Ga0466712_301972_6893_7870 325
51 3300042615 Ga0466711_088026 Ga0466711_088026_6287_7264 325
52 3300042615 Ga0466711_391927 Ga0466711_391927_1061_2038 325
53 3300042616 Ga0466715_408404 Ga0466715_408404_1204_2181 325
54 3300042616 Ga0466715_469646 Ga0466715_469646_12969_13946 325
55 3300042617 Ga0466718_026316 Ga0466718_026316_56_1033 325
56 3300042617 Ga0466718_087558 Ga0466718_087558_1009_1986 325
57 3300042618 Ga0466723_007804 Ga0466723_007804_8384_9361 325
58 3300042619 Ga0466726_056916 Ga0466726_056916_14919_15896 325
59 3300042619 Ga0466726_237352 Ga0466726_237352_627_1604 325
60 3300042619 Ga0466726_482459 Ga0466726_482459_11933_12910 325
61 3300042620 Ga0466728_031991 Ga0466728_031991_19849_20826 325
62 3300042636 Ga0466703_158061 Ga0466703_158061_2414_3391 325
63 3300042643 Ga0466704_167397 Ga0466704_167397_3513_4490 325
64 3300042643 Ga0466704_381790 Ga0466704_381790_2996_3973 325
65 3300042643 Ga0466704_578964 Ga0466704_578964_1777_2754 325
66 3300042643 Ga0466704_613915 Ga0466704_613915_1255_2232 325
67 3300042648 Ga0466709_087743 Ga0466709_087743_3318_4295 325
68 3300042652 Ga0466708_149666 Ga0466708_149666_122_1099 325
69 3300042652 Ga0466708_246218 Ga0466708_246218_691_1668 325
70 3300042652 Ga0466708_294673 Ga0466708_294673_581_1558 325
71 3300042655 Ga0466727_318861 Ga0466727_318861_187_1164 325
72 3300042656 Ga0466732_135305 Ga0466732_135305_199_1176 325
73 3300002462 JGI24702J35022_10046588 JGI24702J35022_100465881 326
74 3300002507 JGI24697J35500_11274124 JGI24697J35500_112741245 326
75 3300005200 Ga0072940_1129214 Ga0072940_11292141 326
76 3300010167 Ga0123353_10623972 Ga0123353_106239722 326
77 3300042593 Ga0466691_047978 Ga0466691_047978_6254_7234 326
78 3300042601 Ga0466707_135040 Ga0466707_135040_2903_3883 326
79 3300042601 Ga0466707_341039 Ga0466707_341039_30_1010 326
80 3300042605 Ga0466716_524826 Ga0466716_524826_315_1295 326
81 3300042612 Ga0466705_381721 Ga0466705_381721_2786_3766 326
82 3300042615 Ga0466711_074680 Ga0466711_074680_17987_18967 326
83 3300042616 Ga0466715_312136 Ga0466715_312136_4869_5849 326
84 3300042616 Ga0466715_611063 Ga0466715_611063_116_1096 326
85 3300042617 Ga0466718_003438 Ga0466718_003438_5708_6688 326
86 3300042618 Ga0466723_252260 Ga0466723_252260_1771_2751 326
87 3300042619 Ga0466726_444538 Ga0466726_444538_55_1035 326
88 3300042648 Ga0466709_228858 Ga0466709_228858_19360_20340 326
89 3300042652 Ga0466708_284999 Ga0466708_284999_18770_19750 326
90 3300042652 Ga0466708_310956 Ga0466708_310956_763_1743 326
91 3300042655 Ga0466727_197667 Ga0466727_197667_467_1447 326
92 3300024493 Ga0264413_137300 Ga0264413_1373002 327
93 3300042590 Ga0466690_063204 Ga0466690_063204_1181_2164 327
94 3300042593 Ga0466691_076803 Ga0466691_076803_11001_11984 327
95 3300042602 Ga0466713_048330 Ga0466713_048330_10556_11539 327
96 3300042602 Ga0466713_138185 Ga0466713_138185_25377_26360 327
97 3300042604 Ga0466717_248134 Ga0466717_248134_33_1016 327
98 3300042607 Ga0466720_129446 Ga0466720_129446_4392_5375 327
99 3300042610 Ga0466698_089011 Ga0466698_089011_183_1166 327
100 3300042612 Ga0466705_003189 Ga0466705_003189_299_1282 327
101 3300042612 Ga0466705_106547 Ga0466705_106547_4696_5679 327
102 3300042612 Ga0466705_463000 Ga0466705_463000_6751_7734 327
103 3300042615 Ga0466711_046410 Ga0466711_046410_1601_2584 327
104 3300042615 Ga0466711_106164 Ga0466711_106164_339_1322 327
105 3300042615 Ga0466711_418453 Ga0466711_418453_1057_2040 327
106 3300042618 Ga0466723_013291 Ga0466723_013291_4557_5540 327
107 3300042618 Ga0466723_127162 Ga0466723_127162_2146_3129 327
108 3300042619 Ga0466726_040172 Ga0466726_040172_5903_6886 327
109 3300042620 Ga0466728_246151 Ga0466728_246151_1800_2783 327
110 3300042636 Ga0466703_009463 Ga0466703_009463_11537_12520 327
111 3300042643 Ga0466704_375476 Ga0466704_375476_841_1824 327
112 3300042643 Ga0466704_574923 Ga0466704_574923_273_1256 327
113 3300042652 Ga0466708_318761 Ga0466708_318761_4280_5263 327
114 3300042655 Ga0466727_042949 Ga0466727_042949_1942_2925 327
115 3300042655 Ga0466727_300886 Ga0466727_300886_1403_2386 327
116 3300042655 Ga0466727_340254 Ga0466727_340254_2082_3065 327
117 3300002450 JGI24695J34938_10000176 JGI24695J34938_1000017622 328
118 3300002462 JGI24702J35022_10028719 JGI24702J35022_100287193 328
119 3300005201 Ga0072941_1025687 Ga0072941_10256875 328
120 3300009826 Ga0123355_10004926 Ga0123355_1000492615 328
121 3300042590 Ga0466690_243419 Ga0466690_243419_4314_5300 328
122 3300042593 Ga0466691_017719 Ga0466691_017719_1764_2750 328
123 3300042601 Ga0466707_306427 Ga0466707_306427_110_1096 328
124 3300042616 Ga0466715_363120 Ga0466715_363120_2640_3626 328
125 3300042655 Ga0466727_349740 Ga0466727_349740_217_1203 328
126 3300000089 AustNasuHG_c1000203 AustNasuHG_100020325 329
127 3300042592 Ga0466693_054427 Ga0466693_054427_51_1040 329
128 3300042602 Ga0466713_105921 Ga0466713_105921_773_1762 329
129 3300042602 Ga0466713_139981 Ga0466713_139981_229_1218 329
130 3300042618 Ga0466723_203989 Ga0466723_203989_2405_3394 329
131 3300042619 Ga0466726_166452 Ga0466726_166452_1145_2134 329
132 3300042619 Ga0466726_474491 Ga0466726_474491_5515_6504 329
133 3300042648 Ga0466709_165640 Ga0466709_165640_2547_3536 329
134 3300002449 JGI24698J34947_10042231 JGI24698J34947_100422312 330
135 3300012848 Ga0160443_100054 Ga0160443_10005478 330
136 3300042612 Ga0466705_107457 Ga0466705_107457_898_1890 330
137 3300042614 Ga0466712_139674 Ga0466712_139674_9802_10794 330
138 3300042643 Ga0466704_477832 Ga0466704_477832_559_1551 330
139 3300042636 Ga0466703_017503 Ga0466703_017503_608_1603 331
140 3300042652 Ga0466708_329215 Ga0466708_329215_4609_5604 331
141 3300042590 Ga0466690_015850 Ga0466690_015850_161_1159 332
142 3300042615 Ga0466711_231288 Ga0466711_231288_783_1781 332
143 3300042619 Ga0466726_185226 Ga0466726_185226_4390_5388 332
144 3300042648 Ga0466709_026203 Ga0466709_026203_4027_5028 333
145 3300042590 Ga0466690_133196 Ga0466690_133196_585_1592 335
146 3300012846 Ga0160433_100008 Ga0160433_100008194 336
147 3300042591 Ga0466692_145983 Ga0466692_145983_466_1479 337
148 3300042593 Ga0466691_096660 Ga0466691_096660_2634_3647 337
149 3300042616 Ga0466715_373081 Ga0466715_373081_1338_2351 337
150 3300042601 Ga0466707_302433 Ga0466707_302433_53_1075 340
151 3300042590 Ga0466690_042634 Ga0466690_042634_556_1596 346
152 3300042648 Ga0466709_323589 Ga0466709_323589_3708_4754 348

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01370 Epimerase NAD dependent epimerase/dehydratase family 5 238 0.86
PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase 6 300 0.77
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 5 160 0.71

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.9 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.