Protein Family IF00757

Metagenome Isolate
128 Members
43 Samples
127 Scaffolds
327.93 Avg Length

🧬 Representative Sequence

ID
3300002462|JGI24702J35022_10002702|JGI24702J35022_100027026
Length
350 aa
Sequence
MGERIQQGKQFINRWFAGKKFPGKIAIIGGGSWATALAKIILTTQDQINWYMRRPDRIEDFIRLKHNPAYLSSVTFDIDRICFFSSLDRIVQESDMLIFATPSPFLKQHLSTLNVSLKEKFIVSAIKGIVPDENMLISDYLTEFYQVDPDNIAVLGGACHAEEIALERLSFLTIASKDPEKAASIASIFTNSFLKCSCSXDVIGIEXASVLKNVYAIVAGIYHGLKYGHNFRAVFLSNAIQEMQCFLDAAHVLERDITGSAYLGDLLVTAYSRFSRNRTFGTMIGKGYSVKIAQLEMEMIAEGYXGTKCIYEINEKYKAKTPILDALYAILYKHESPANIVNQLTELFN*

📊 Sample Types

Isolate 0.8%
Metagenome 99.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 34.9%
Kalotermitidae 32.6%
Termopsidae 9.3%
Passalidae 7.0%
Unclassified 7.0%
Rhinotermitidae 7.0%
Blattidae 2.3%

🌳 Taxonomy

Archaea 0
Bacteria 126
Eukaryota 0
Viruses 0
Unclassified 2

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
2 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
3 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
4 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
5 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
6 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
7 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
8 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
9 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
10 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
11 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
12 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
13 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
14 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
15 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
16 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
17 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
18 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
19 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
20 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
21 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
22 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
23 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
24 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
25 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
26 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
27 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
28 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
29 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
30 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
31 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
32 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
33 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
34 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
35 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
36 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
37 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
38 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
39 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
40 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
41 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
42 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
43 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 2227072446 2225789003 Bacteria 12951
2 2227086377 2225789004 Bacteria 9942
3 Ga0068305_10099327 3300005083 Bacteria 22442
4 Ga0466711_119944 3300042615 Bacteria 6329
5 Ga0466711_158971 3300042615 Bacteria 32433
6 Ga0466723_042046 3300042618 Bacteria 9471
7 Ga0123357_10010080 3300009784 Bacteria 11986
8 Ga0123354_10002434 3300010882 Bacteria 24588
9 Ga0466707_067688 3300042601 Bacteria 3758
10 Ga0466719_122140 3300042606 Bacteria 4338
11 Ga0466693_011567 3300042592 Bacteria 1750
12 Ga0466693_120748 3300042592 Bacteria 1393
13 Ga0466729_233543 3300042621 Bacteria 2651
14 Ga0466703_416796 3300042636 Bacteria 12962
15 Ga0466727_351904 3300042655 Bacteria 8432
16 Ga0466733_038690 3300042659 Bacteria 100300
17 Ga0466711_160184 3300042615 Bacteria 13975
18 Ga0466711_215795 3300042615 Bacteria 6141
19 Ga0466711_479751 3300042615 Bacteria 3178
20 Ga0466715_237195 3300042616 Bacteria 8660
21 Ga0466726_228066 3300042619 Bacteria 10586
22 Ga0466726_241003 3300042619 Bacteria 2753
23 Ga0123356_10255106 3300010049 Bacteria 1834
24 Ga0123353_10574214 3300010167 Bacteria 1620
25 Ga0466700_276650 3300042600 Bacteria 9365
26 Ga0466707_121228 3300042601 Bacteria 26661
27 Ga0466692_014618 3300042591 Bacteria 107882
28 Ga0466692_168245 3300042591 Bacteria 5429
29 Ga0466693_445721 3300042592 Bacteria 1886
30 Ga0466696_094699 3300042596 Bacteria 13208
31 Ga0466731_116772 3300042622 Bacteria 3810
32 Ga0466735_223360 3300042624 Bacteria 5505
33 Ga0466703_405994 3300042636 Bacteria 10275
34 Ga0466704_357773 3300042643 Bacteria 5360
35 Ga0466708_021896 3300042652 Bacteria 36089
36 Ga0466727_132693 3300042655 Bacteria 19237
37 Ga0466727_144655 3300042655 Bacteria 5084
38 IMNBL1DRAFT_c0000550 3300000062 Bacteria 30486
39 JGI24702J35022_10008256 3300002462 Bacteria 5905
40 Ga0068302_10134031 3300005071 Bacteria 5882
41 Ga0068305_10005717 3300005083 Bacteria 26354
42 Ga0466715_059460 3300042616 Bacteria 11408
43 Ga0466728_314231 3300042620 Bacteria 2307
44 Ga0466729_130706 3300042621 Bacteria 5231
45 Ga0466729_196130 3300042621 Bacteria 2122
46 Ga0123354_10153343 3300010882 Bacteria 2778
47 Ga0466707_075198 3300042601 Bacteria 13033
48 Ga0466716_025263 3300042605 Bacteria 7895
49 Ga0466716_415709 3300042605 Bacteria 17767
50 Ga0466719_093977 3300042606 Bacteria 25952
51 Ga0466719_433286 3300042606 Unclassified 4264
52 Ga0466694_268174 3300042594 Bacteria 1231
53 Ga0466704_284718 3300042643 Bacteria 35033
54 Ga0466705_184819 3300042612 Bacteria 5489
55 2227542985 2225789004 Bacteria 2960
56 JGI24702J35022_10024544 3300002462 Bacteria 3256
57 JGI24702J35022_10178645 3300002462 Bacteria 1205
58 Ga0466711_072307 3300042615 Bacteria 6483
59 Ga0466715_087696 3300042616 Bacteria 10925
60 Ga0466715_361138 3300042616 Bacteria 34031
61 Ga0466723_049142 3300042618 Bacteria 3358
62 Ga0466723_300421 3300042618 Bacteria 62170
63 Ga0466728_171127 3300042620 Bacteria 1037
64 Ga0123353_10710747 3300010167 Bacteria 1408
65 Ga0466701_030510 3300042598 Bacteria 2400
66 Ga0466719_423923 3300042606 Bacteria 8669
67 Ga0466719_465257 3300042606 Bacteria 2980
68 Ga0466697_055165 3300042611 Bacteria 1464
69 Ga0466691_063618 3300042593 Bacteria 14984
70 Ga0466704_445869 3300042643 Bacteria 10104
71 Ga0466725_146232 3300042654 Bacteria 1330
72 Ga0466727_288141 3300042655 Bacteria 4684
73 IMNBL1DRAFT_c0000345 3300000062 Bacteria 39398
74 IMNBL1DRAFT_c0004058 3300000062 Bacteria 8984
75 IMNBL1DRAFT_c0012209 3300000062 Bacteria 3947
76 JGI24699J35502_11112073 3300002509 Bacteria 2745
77 Ga0068305_10106501 3300005083 Bacteria 6594
78 Ga0466726_114262 3300042619 Bacteria 4382
79 Ga0466707_052154 3300042601 Bacteria 5208
80 Ga0466707_172261 3300042601 Bacteria 7437
81 Ga0466713_053263 3300042602 Bacteria 1097
82 Ga0466713_068788 3300042602 Bacteria 21856
83 Ga0466716_276433 3300042605 Bacteria 12747
84 Ga0466690_043876 3300042590 Bacteria 23657
85 Ga0466693_202949 3300042592 Bacteria 1124
86 Ga0466696_107426 3300042596 Bacteria 12596
87 Ga0466703_114630 3300042636 Bacteria 39473
88 Ga0466709_286667 3300042648 Bacteria 8007
89 Ga0466708_073591 3300042652 Bacteria 6339
90 Ga0466727_223234 3300042655 Bacteria 11982
91 2227403034 2225789004 Bacteria 5762
92 2227493519 2225789004 Bacteria 4015
93 IMNBL1DRAFT_c0011250 3300000062 Bacteria 4196
94 JGI24702J35022_10002702 3300002462 Bacteria 10763
95 JGI24699J35502_11134154 3300002509 Bacteria 38326
96 Ga0466711_246719 3300042615 Bacteria 27110
97 Ga0466715_582521 3300042616 Bacteria 12396
98 Ga0123354_10003084 3300010882 Bacteria 22749
99 Ga0123354_10004434 3300010882 Bacteria 19900
100 Ga0466713_077669 3300042602 Bacteria 61043
101 Ga0466716_331525 3300042605 Bacteria 17268
102 Ga0466656_383509 3300042550 Bacteria 6623
103 Ga0466690_372817 3300042590 Bacteria 12235
104 Ga0466703_275769 3300042636 Bacteria 24178
105 Ga0466709_076850 3300042648 Bacteria 50213
106 Ga0466709_223600 3300042648 Bacteria 9989
107 JGI24702J35022_10005299 3300002462 Bacteria 7559
108 Ga0068302_10187294 3300005071 Bacteria 2501
109 Ga0123354_10004553 3300010882 Bacteria 19666
110 Ga0123354_10037989 3300010882 Bacteria 7482
111 Ga0466713_027911 3300042602 Bacteria 17135
112 Ga0466722_055009 3300042609 Bacteria 1807
113 Ga0466692_113976 3300042591 Bacteria 14367
114 Ga0466735_059633 3300042624 Bacteria 2552
115 Ga0466735_102149 3300042624 Unclassified 3525
116 Ga0466735_234997 3300042624 Bacteria 6166
117 Ga0466703_084178 3300042636 Bacteria 10872
118 Ga0466708_016960 3300042652 Bacteria 21170
119 Ga0466725_343708 3300042654 Bacteria 6583
120 Ga0466711_281817 3300042615 Bacteria 6059
121 Ga0466715_511409 3300042616 Bacteria 1740
122 Ga0466723_161938 3300042618 Bacteria 2664
123 Ga0123353_10166522 3300010167 Bacteria 3503
124 Ga0123353_10478268 3300010167 Bacteria 1823
125 Ga0123354_10000042 3300010882 Bacteria 95103
126 Ga0466690_046251 3300042590 Bacteria 8970
127 Ga0466725_066884 3300042654 Bacteria 19090

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042601 Ga0466707_075198 Ga0466707_075198_1558_2388 266
2 3300005083 Ga0068305_10106501 Ga0068305_101065017 286
3 3300042601 Ga0466707_067688 Ga0466707_067688_947_1915 288
4 3300042619 Ga0466726_114262 Ga0466726_114262_2955_3845 296
5 3300042624 Ga0466735_234997 Ga0466735_234997_386_1381 297
6 3300042592 Ga0466693_202949 Ga0466693_202949_26_922 298
7 3300042598 Ga0466701_030510 Ga0466701_030510_1479_2375 298
8 3300042620 Ga0466728_171127 Ga0466728_171127_14_910 298
9 3300042624 Ga0466735_223360 Ga0466735_223360_4573_5469 298
10 3300010167 Ga0123353_10710747 Ga0123353_107107472 300
11 3300042602 Ga0466713_053263 Ga0466713_053263_172_1074 300
12 3300042609 Ga0466722_055009 Ga0466722_055009_521_1516 305
13 3300042592 Ga0466693_120748 Ga0466693_120748_460_1383 307
14 3300042601 Ga0466707_121228 Ga0466707_121228_1617_2585 312
15 3300042624 Ga0466735_059633 Ga0466735_059633_1170_2138 314
16 3300002509 JGI24699J35502_11112073 JGI24699J35502_111120732 315
17 3300002509 JGI24699J35502_11134154 JGI24699J35502_1113415415 317
18 3300042596 Ga0466696_094699 Ga0466696_094699_2211_3179 322
19 3300042602 Ga0466713_077669 Ga0466713_077669_27959_28927 322
20 3300042615 Ga0466711_072307 Ga0466711_072307_5460_6428 322
21 3300042618 Ga0466723_300421 Ga0466723_300421_16630_17598 322
22 3300042655 Ga0466727_144655 Ga0466727_144655_835_1803 322
23 3300010882 Ga0123354_10002434 Ga0123354_100024349 323
24 3300042616 Ga0466715_059460 Ga0466715_059460_3964_4959 323
25 3300042618 Ga0466723_049142 Ga0466723_049142_2244_3215 323
26 3300042593 Ga0466691_063618 Ga0466691_063618_8252_9247 325
27 3300042606 Ga0466719_433286 Ga0466719_433286_2500_3495 325
28 2225789003 2227072446 2227435247 331
29 2225789004 2227086377 2227463268 331
30 2225789004 2227403034 2227846142 331
31 2225789004 2227493519 2227968079 331
32 3300002462 JGI24702J35022_10008256 JGI24702J35022_100082561 331
33 3300042550 Ga0466656_383509 Ga0466656_383509_5293_6288 331
34 3300042590 Ga0466690_043876 Ga0466690_043876_7663_8658 331
35 3300042590 Ga0466690_046251 Ga0466690_046251_5830_6825 331
36 3300042590 Ga0466690_372817 Ga0466690_372817_7515_8510 331
37 3300042591 Ga0466692_014618 Ga0466692_014618_81828_82823 331
38 3300042591 Ga0466692_113976 Ga0466692_113976_10561_11556 331
39 3300042591 Ga0466692_168245 Ga0466692_168245_3071_4066 331
40 3300042592 Ga0466693_011567 Ga0466693_011567_163_1158 331
41 3300042596 Ga0466696_107426 Ga0466696_107426_9019_10014 331
42 3300042600 Ga0466700_276650 Ga0466700_276650_1810_2805 331
43 3300042601 Ga0466707_052154 Ga0466707_052154_2576_3571 331
44 3300042605 Ga0466716_025263 Ga0466716_025263_4602_5597 331
45 3300042605 Ga0466716_276433 Ga0466716_276433_9717_10712 331
46 3300042605 Ga0466716_331525 Ga0466716_331525_1329_2324 331
47 3300042605 Ga0466716_415709 Ga0466716_415709_3904_4899 331
48 3300042606 Ga0466719_093977 Ga0466719_093977_22847_23842 331
49 3300042606 Ga0466719_423923 Ga0466719_423923_7630_8625 331
50 3300042612 Ga0466705_184819 Ga0466705_184819_2854_3849 331
51 3300042615 Ga0466711_119944 Ga0466711_119944_3433_4428 331
52 3300042615 Ga0466711_158971 Ga0466711_158971_19331_20326 331
53 3300042615 Ga0466711_246719 Ga0466711_246719_24462_25457 331
54 3300042615 Ga0466711_281817 Ga0466711_281817_1582_2577 331
55 3300042616 Ga0466715_087696 Ga0466715_087696_2886_3881 331
56 3300042616 Ga0466715_237195 Ga0466715_237195_1850_2845 331
57 3300042616 Ga0466715_511409 Ga0466715_511409_575_1570 331
58 3300042616 Ga0466715_582521 Ga0466715_582521_6558_7553 331
59 3300042618 Ga0466723_042046 Ga0466723_042046_8200_9195 331
60 3300042618 Ga0466723_161938 Ga0466723_161938_1296_2291 331
61 3300042619 Ga0466726_228066 Ga0466726_228066_5914_6909 331
62 3300042619 Ga0466726_241003 Ga0466726_241003_1432_2427 331
63 3300042620 Ga0466728_314231 Ga0466728_314231_1143_2138 331
64 3300042621 Ga0466729_130706 Ga0466729_130706_2611_3606 331
65 3300042621 Ga0466729_233543 Ga0466729_233543_851_1846 331
66 3300042622 Ga0466731_116772 Ga0466731_116772_2571_3566 331
67 3300042624 Ga0466735_102149 Ga0466735_102149_1034_2029 331
68 3300042636 Ga0466703_084178 Ga0466703_084178_2206_3201 331
69 3300042636 Ga0466703_275769 Ga0466703_275769_3112_4107 331
70 3300042636 Ga0466703_405994 Ga0466703_405994_744_1739 331
71 3300042636 Ga0466703_416796 Ga0466703_416796_3532_4527 331
72 3300042643 Ga0466704_284718 Ga0466704_284718_19843_20838 331
73 3300042648 Ga0466709_076850 Ga0466709_076850_40235_41230 331
74 3300042648 Ga0466709_223600 Ga0466709_223600_402_1397 331
75 3300042648 Ga0466709_286667 Ga0466709_286667_5077_6072 331
76 3300042652 Ga0466708_021896 Ga0466708_021896_14840_15835 331
77 3300042652 Ga0466708_073591 Ga0466708_073591_3297_4292 331
78 3300042655 Ga0466727_132693 Ga0466727_132693_4792_5787 331
79 3300042655 Ga0466727_223234 Ga0466727_223234_9119_10114 331
80 3300042655 Ga0466727_351904 Ga0466727_351904_5662_6657 331
81 3300042659 Ga0466733_038690 Ga0466733_038690_4806_5801 331
82 iso_pr_bacteria 2940216256 2940216400 331
83 3300000062 IMNBL1DRAFT_c0000345 IMNBL1DRAFT_00003457 332
84 3300000062 IMNBL1DRAFT_c0000550 IMNBL1DRAFT_00005505 332
85 3300000062 IMNBL1DRAFT_c0004058 IMNBL1DRAFT_00040587 332
86 3300000062 IMNBL1DRAFT_c0012209 IMNBL1DRAFT_00122094 332
87 3300002462 JGI24702J35022_10024544 JGI24702J35022_100245443 332
88 3300002462 JGI24702J35022_10178645 JGI24702J35022_101786451 332
89 3300005071 Ga0068302_10134031 Ga0068302_101340313 332
90 3300009784 Ga0123357_10010080 Ga0123357_100100805 332
91 3300010049 Ga0123356_10255106 Ga0123356_102551062 332
92 3300010167 Ga0123353_10478268 Ga0123353_104782682 332
93 3300010882 Ga0123354_10000042 Ga0123354_1000004244 332
94 3300010882 Ga0123354_10003084 Ga0123354_1000308412 332
95 3300010882 Ga0123354_10004434 Ga0123354_1000443417 332
96 3300010882 Ga0123354_10004553 Ga0123354_100045536 332
97 3300010882 Ga0123354_10153343 Ga0123354_101533432 332
98 3300042602 Ga0466713_027911 Ga0466713_027911_12016_13014 332
99 3300042606 Ga0466719_122140 Ga0466719_122140_1194_2192 332
100 3300042615 Ga0466711_479751 Ga0466711_479751_198_1196 332
101 3300042616 Ga0466715_361138 Ga0466715_361138_20557_21555 332
102 3300042621 Ga0466729_196130 Ga0466729_196130_591_1589 332
103 3300000062 IMNBL1DRAFT_c0011250 IMNBL1DRAFT_00112504 333
104 3300005071 Ga0068302_10187294 Ga0068302_101872942 333
105 3300005083 Ga0068305_10099327 Ga0068305_100993279 333
106 3300010167 Ga0123353_10574214 Ga0123353_105742142 333
107 3300010882 Ga0123354_10037989 Ga0123354_100379896 333
108 3300042592 Ga0466693_445721 Ga0466693_445721_769_1770 333
109 3300042601 Ga0466707_172261 Ga0466707_172261_5120_6121 333
110 3300042606 Ga0466719_465257 Ga0466719_465257_1714_2715 333
111 3300042643 Ga0466704_445869 Ga0466704_445869_8358_9359 333
112 3300042654 Ga0466725_066884 Ga0466725_066884_17079_18080 333
113 3300042654 Ga0466725_343708 Ga0466725_343708_4436_5437 333
114 3300010167 Ga0123353_10166522 Ga0123353_101665222 334
115 3300042594 Ga0466694_268174 Ga0466694_268174_163_1167 334
116 3300042615 Ga0466711_215795 Ga0466711_215795_1618_2625 335
117 3300042615 Ga0466711_160184 Ga0466711_160184_7154_8170 338
118 3300005083 Ga0068305_10005717 Ga0068305_100057176 341
119 3300042655 Ga0466727_288141 Ga0466727_288141_1677_2708 343
120 3300042602 Ga0466713_068788 Ga0466713_068788_15668_16702 344
121 3300042611 Ga0466697_055165 Ga0466697_055165_257_1291 344
122 3300042636 Ga0466703_114630 Ga0466703_114630_31233_32267 344
123 3300042643 Ga0466704_357773 Ga0466704_357773_2771_3805 344
124 3300042652 Ga0466708_016960 Ga0466708_016960_3078_4112 344
125 2225789004 2227542985 2228066217 349
126 3300042654 Ga0466725_146232 Ga0466725_146232_124_1173 349
127 3300002462 JGI24702J35022_10002702 JGI24702J35022_100027026 350
128 3300002462 JGI24702J35022_10005299 JGI24702J35022_100052995 350

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF07479 NAD_Gly3P_dh_C NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus 201 341 0.98
PF01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus 24 181 0.97
PF20618 GPD_NAD_C_bact Bacterial GPD, NAD-dependent C-terminal 261 326 0.92
PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent 24 126 0.91

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.