Protein Family IF00748

Metagenome Isolate
138 Members
73 Samples
110 Scaffolds
219.61 Avg Length

🧬 Representative Sequence

ID
3300002462|JGI24702J35022_10000989|JGI24702J35022_100009898
Length
252 aa
Sequence
LESDSLIIFCLLFKNCTYIRALFVRFYDFEMIQTTGIIKSFDKLQVLKGIDLHVEKKEIVAIVGPSGAGKTTLLQIMGTLDKPDGGNVLIDGIDPFGLNEKDMSHFRNRHIGFVFQFHQLLPEFTSLENVMIPMLIAGEKAKTAEKKAKELLDFLQMADRMMHKPAELSGGEKQRIAVARALINDPSVILADEPSGSLDTKNKEELHALFFDLRDKLGQTFVIVTHDVNLAKLTDRIIQMKDGVIAPSILT*

📊 Sample Types

Isolate 20.3%
Metagenome 79.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 29.2%
Termitidae 27.8%
Kalotermitidae 18.1%
Unclassified 13.9%
Rhinotermitidae 4.2%
Termopsidae 2.8%
Passalidae 2.8%
Hodotermitidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 135
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820776227 Unclassified Bacteroidetes Emb289P4bin3 Isolate Unclassified
2 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
3 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
4 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
5 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
6 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
7 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
8 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
9 2923982719 Parabacteroides sp. 52 Isolate Blattidae
10 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
11 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
12 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
13 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
14 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
15 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
16 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
17 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
18 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
19 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
20 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
21 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
22 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
23 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
24 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
25 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
26 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
27 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
28 3004667792 Bacteroides sp. 519 Isolate Blattidae
29 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
30 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
31 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
32 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
33 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
34 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
35 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
36 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
37 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
38 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
39 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
40 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
41 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
42 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
43 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
44 2820014844 Unclassified Spirochaetes Nt197P3bin95 Isolate Unclassified
45 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
46 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
47 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
48 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
49 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
50 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
51 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
52 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
53 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
54 2820010479 Unclassified Spirochaetes Th196P4bin55 Isolate Unclassified
55 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
56 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
57 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
58 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
59 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
60 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
61 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
62 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
63 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
64 2920168565 Paludibacter sp. 221 Isolate Blattidae
65 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
66 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
67 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
68 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
69 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
70 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
71 2819998259 Unclassified Spirochaetes Nc150P4bin23 Isolate Unclassified
72 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
73 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466735_102942 3300042624 Bacteria 2326
2 Ga0466715_437866 3300042616 Bacteria 10359
3 Ga0466706_140857 3300042599 Bacteria 123527
4 Ga0466714_029406 3300042603 Bacteria 41959
5 Ga0466717_205453 3300042604 Unclassified 2810
6 Ga0466691_071708 3300042593 Bacteria 18929
7 Ga0466691_145457 3300042593 Bacteria 34874
8 Ga0466696_209402 3300042596 Bacteria 7754
9 Ga0466701_004377 3300042598 Bacteria 4875
10 Ga0466733_066803 3300042659 Bacteria 1833
11 Ga0466704_012661 3300042643 Bacteria 4039
12 Ga0466704_303500 3300042643 Bacteria 20207
13 Ga0466725_016791 3300042654 Bacteria 21213
14 Ga0466728_451299 3300042620 Bacteria 2227
15 Ga0466713_028749 3300042602 Bacteria 28146
16 Ga0466690_199847 3300042590 Bacteria 3086
17 Ga0466693_267612 3300042592 Bacteria 2548
18 Ga0466691_204020 3300042593 Bacteria 6008
19 Ga0466696_023674 3300042596 Bacteria 3211
20 Ga0466701_002954 3300042598 Bacteria 1209
21 2227495473 2225789004 Unclassified 3951
22 IMNBL1DRAFT_c0010101 3300000062 Bacteria 4568
23 JGI24702J35022_10000989 3300002462 Bacteria 17803
24 Ga0068305_10047658 3300005083 Bacteria 8597
25 Ga0072941_1182092 3300005201 Bacteria 3844
26 Ga0123357_10002184 3300009784 Bacteria 21576
27 Ga0466705_156772 3300042612 Bacteria 3875
28 Ga0466703_193143 3300042636 Bacteria 7650
29 Ga0466704_206895 3300042643 Bacteria 10145
30 Ga0466704_242149 3300042643 Bacteria 5574
31 Ga0466704_479765 3300042643 Bacteria 17636
32 Ga0466725_403336 3300042654 Bacteria 14953
33 Ga0466727_229437 3300042655 Bacteria 2730
34 Ga0466716_143652 3300042605 Bacteria 1192
35 Ga0466656_327867 3300042550 Bacteria 5382
36 Ga0466690_427464 3300042590 Bacteria 23231
37 JGI24705J35276_12234362 3300002504 Bacteria 5455
38 Ga0466735_004863 3300042624 Bacteria 16044
39 Ga0466735_104774 3300042624 Bacteria 1608
40 Ga0466703_119224 3300042636 Bacteria 10231
41 Ga0466727_198985 3300042655 Bacteria 2338
42 Ga0466715_406776 3300042616 Bacteria 11716
43 Ga0123353_10333109 3300010167 Bacteria 2296
44 Ga0123354_10016375 3300010882 Bacteria 11617
45 Ga0466714_139060 3300042603 Bacteria 50968
46 Ga0466690_092511 3300042590 Bacteria 2263
47 Ga0466690_147102 3300042590 Bacteria 14491
48 2227247461 2225789004 Bacteria 31587
49 JGI24699J35502_11134229 3300002509 Bacteria 98606
50 Ga0466733_035378 3300042659 Bacteria 72401
51 Ga0466703_345209 3300042636 Bacteria 19451
52 Ga0466715_567116 3300042616 Bacteria 22152
53 Ga0123353_11251477 3300010167 Bacteria 968
54 Ga0466717_165218 3300042604 Bacteria 1595
55 Ga0466716_176243 3300042605 Bacteria 5676
56 Ga0466719_125517 3300042606 Bacteria 1573
57 Ga0466722_146419 3300042609 Bacteria 5011
58 Ga0466696_036472 3300042596 Bacteria 2963
59 Ga0466696_300391 3300042596 Bacteria 6821
60 IMNBL1DRAFT_c0000112 3300000062 Bacteria 72967
61 IMNBL1DRAFT_c0000571 3300000062 Bacteria 29765
62 IMNBL1DRAFT_c0039194 3300000062 Bacteria 1620
63 JGI24702J35022_10005602 3300002462 Bacteria 7320
64 JGI24702J35022_10006225 3300002462 Bacteria 6916
65 Ga0466705_142107 3300042612 Bacteria 26909
66 Ga0466731_016398 3300042622 Bacteria 1867
67 Ga0466708_210049 3300042652 Bacteria 11481
68 Ga0466715_129051 3300042616 Bacteria 2017
69 Ga0466715_163266 3300042616 Bacteria 6579
70 Ga0466715_410700 3300042616 Unclassified 1925
71 Ga0466718_037637 3300042617 Bacteria 3143
72 Ga0123356_10076752 3300010049 Bacteria 3149
73 Ga0466701_082585 3300042598 Bacteria 4504
74 Ga0466706_028547 3300042599 Bacteria 1608
75 Ga0466706_148602 3300042599 Bacteria 49418
76 Ga0466707_250018 3300042601 Bacteria 4062
77 Ga0466714_041819 3300042603 Bacteria 104465
78 Ga0466722_154859 3300042609 Bacteria 2203
79 Ga0466696_001911 3300042596 Bacteria 82336
80 IMNBL1DRAFT_c0035365 3300000062 Bacteria 1762
81 JGI24695J34938_10155291 3300002450 Bacteria 939
82 Ga0466732_080661 3300042656 Bacteria 5256
83 Ga0466733_198828 3300042659 Bacteria 7420
84 Ga0466731_134563 3300042622 Bacteria 1155
85 Ga0466735_109538 3300042624 Bacteria 3497
86 Ga0123355_10434800 3300009826 Bacteria 1666
87 Ga0123353_10987715 3300010167 Bacteria 1133
88 Ga0466706_233555 3300042599 Bacteria 45210
89 Ga0466707_345958 3300042601 Bacteria 40317
90 Ga0466690_091124 3300042590 Bacteria 36086
91 Ga0466692_144683 3300042591 Bacteria 28602
92 Ga0466693_392870 3300042592 Bacteria 1884
93 Ga0466691_078732 3300042593 Bacteria 3961
94 Ga0466691_088639 3300042593 Bacteria 19618
95 2227087500 2225789004 Bacteria 1849
96 2227140834 2225789004 Bacteria 1622
97 JGI24702J35022_10003001 3300002462 Bacteria 10216
98 Ga0466697_124222 3300042611 Bacteria 1637
99 Ga0466711_288675 3300042615 Bacteria 20859
100 Ga0466711_415995 3300042615 Bacteria 11652
101 Ga0466715_181610 3300042616 Bacteria 4284
102 Ga0466723_226467 3300042618 Bacteria 13219
103 Ga0466729_173861 3300042621 Bacteria 5830
104 Ga0466706_125714 3300042599 Bacteria 14827
105 Ga0466713_058794 3300042602 Bacteria 46658
106 Ga0466714_134258 3300042603 Bacteria 4633
107 2227519938 2225789004 Bacteria 3358
108 IMNBL1DRAFT_c0001800 3300000062 Bacteria 15642
109 JGI24702J35022_10013758 3300002462 Bacteria 4474
110 JGI24705J35276_12238557 3300002504 Bacteria 26549

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042590 Ga0466690_091124 Ga0466690_091124_20095_20772 206
2 3300042652 Ga0466708_210049 Ga0466708_210049_8602_9267 215
3 3300042598 Ga0466701_004377 Ga0466701_004377_2759_3409 216
4 3300042599 Ga0466706_140857 Ga0466706_140857_47570_48220 216
5 3300042599 Ga0466706_148602 Ga0466706_148602_20304_20954 216
6 3300042603 Ga0466714_041819 Ga0466714_041819_53542_54192 216
7 3300042603 Ga0466714_134258 Ga0466714_134258_239_889 216
8 3300042605 Ga0466716_143652 Ga0466716_143652_384_1034 216
9 3300042609 Ga0466722_154859 Ga0466722_154859_855_1505 216
10 3300042624 Ga0466735_004863 Ga0466735_004863_7191_7841 216
11 3300042654 Ga0466725_016791 Ga0466725_016791_14932_15582 216
12 3300042659 Ga0466733_198828 Ga0466733_198828_3766_4416 216
13 iso_pr_bacteria 2820776227 2820777233 216
14 2225789004 2227087500 2227464954 217
15 2225789004 2227140834 2227542713 217
16 2225789004 2227247461 2227689369 217
17 2225789004 2227495473 2227972294 217
18 3300000062 IMNBL1DRAFT_c0000112 IMNBL1DRAFT_000011228 217
19 3300002450 JGI24695J34938_10155291 JGI24695J34938_101552911 217
20 3300002504 JGI24705J35276_12234362 JGI24705J35276_122343624 217
21 3300009784 Ga0123357_10002184 Ga0123357_100021844 217
22 3300009826 Ga0123355_10434800 Ga0123355_104348002 217
23 3300010049 Ga0123356_10076752 Ga0123356_100767522 217
24 3300010167 Ga0123353_11251477 Ga0123353_112514772 217
25 3300042590 Ga0466690_199847 Ga0466690_199847_2046_2699 217
26 3300042593 Ga0466691_088639 Ga0466691_088639_8808_9461 217
27 3300042593 Ga0466691_145457 Ga0466691_145457_29226_29879 217
28 3300042596 Ga0466696_209402 Ga0466696_209402_5079_5732 217
29 3300042596 Ga0466696_300391 Ga0466696_300391_60_713 217
30 3300042598 Ga0466701_082585 Ga0466701_082585_3025_3678 217
31 3300042599 Ga0466706_028547 Ga0466706_028547_224_877 217
32 3300042602 Ga0466713_028749 Ga0466713_028749_4833_5486 217
33 3300042604 Ga0466717_165218 Ga0466717_165218_894_1547 217
34 3300042609 Ga0466722_146419 Ga0466722_146419_2446_3099 217
35 3300042611 Ga0466697_124222 Ga0466697_124222_660_1313 217
36 3300042612 Ga0466705_142107 Ga0466705_142107_12865_13518 217
37 3300042612 Ga0466705_156772 Ga0466705_156772_1346_1999 217
38 3300042616 Ga0466715_567116 Ga0466715_567116_13345_13998 217
39 3300042621 Ga0466729_173861 Ga0466729_173861_1328_1981 217
40 3300042636 Ga0466703_193143 Ga0466703_193143_2160_2813 217
41 3300042643 Ga0466704_303500 Ga0466704_303500_13396_14049 217
42 3300042643 Ga0466704_479765 Ga0466704_479765_7372_8025 217
43 3300042654 Ga0466725_403336 Ga0466725_403336_9562_10215 217
44 3300042655 Ga0466727_198985 Ga0466727_198985_205_858 217
45 3300042655 Ga0466727_229437 Ga0466727_229437_1981_2634 217
46 3300042656 Ga0466732_080661 Ga0466732_080661_704_1357 217
47 3300042659 Ga0466733_035378 Ga0466733_035378_29516_30169 217
48 iso_pr_bacteria 2820778767 2820779305 217
49 iso_pr_bacteria 2920168565 2920168847 217
50 iso_pr_bacteria 2940205530 2940206072 217
51 iso_pr_bacteria 2940212447 2940212987 217
52 iso_pr_bacteria 2940298504 2940299044 217
53 iso_pr_bacteria 2940302308 2940302884 217
54 iso_pr_bacteria 2940306115 2940306292 217
55 iso_pr_bacteria 2940309933 2940310075 217
56 iso_pr_bacteria 2940313741 2940313884 217
57 iso_pr_bacteria 2940317558 2940317735 217
58 iso_pr_bacteria 2940321370 2940321513 217
59 iso_pr_bacteria 2940325180 2940325756 217
60 iso_pr_bacteria 2940328985 2940329562 217
61 iso_pr_bacteria 2940332795 2940332972 217
62 3300000062 IMNBL1DRAFT_c0035365 IMNBL1DRAFT_00353652 218
63 3300000062 IMNBL1DRAFT_c0039194 IMNBL1DRAFT_00391942 218
64 3300002462 JGI24702J35022_10003001 JGI24702J35022_100030016 218
65 3300002462 JGI24702J35022_10005602 JGI24702J35022_100056024 218
66 3300002462 JGI24702J35022_10006225 JGI24702J35022_100062254 218
67 3300002504 JGI24705J35276_12238557 JGI24705J35276_1223855722 218
68 3300005083 Ga0068305_10047658 Ga0068305_100476585 218
69 3300005201 Ga0072941_1182092 Ga0072941_11820922 218
70 3300042590 Ga0466690_092511 Ga0466690_092511_113_769 218
71 3300042591 Ga0466692_144683 Ga0466692_144683_13281_13937 218
72 3300042596 Ga0466696_036472 Ga0466696_036472_164_820 218
73 3300042599 Ga0466706_125714 Ga0466706_125714_13466_14122 218
74 3300042601 Ga0466707_250018 Ga0466707_250018_746_1402 218
75 3300042602 Ga0466713_058794 Ga0466713_058794_15651_16307 218
76 3300042603 Ga0466714_029406 Ga0466714_029406_3247_3903 218
77 3300042603 Ga0466714_139060 Ga0466714_139060_22612_23268 218
78 3300042606 Ga0466719_125517 Ga0466719_125517_700_1356 218
79 3300042615 Ga0466711_288675 Ga0466711_288675_13220_13876 218
80 3300042616 Ga0466715_129051 Ga0466715_129051_1218_1874 218
81 3300042616 Ga0466715_410700 Ga0466715_410700_950_1606 218
82 3300042618 Ga0466723_226467 Ga0466723_226467_11367_12023 218
83 3300042624 Ga0466735_104774 Ga0466735_104774_354_1010 218
84 3300042636 Ga0466703_119224 Ga0466703_119224_6808_7464 218
85 3300042643 Ga0466704_012661 Ga0466704_012661_2991_3647 218
86 3300042659 Ga0466733_066803 Ga0466733_066803_528_1184 218
87 iso_pr_bacteria 2923982719 2923984483 218
88 iso_pr_bacteria 2940195863 2940197741 218
89 iso_pr_bacteria 2940202316 2940203059 218
90 iso_pr_bacteria 2940371297 2940372335 218
91 iso_pr_bacteria 2967483437 2967485691 218
92 3300010167 Ga0123353_10333109 Ga0123353_103331092 219
93 3300010882 Ga0123354_10016375 Ga0123354_100163757 219
94 3300042550 Ga0466656_327867 Ga0466656_327867_4157_4816 219
95 3300042598 Ga0466701_002954 Ga0466701_002954_153_812 219
96 3300042601 Ga0466707_345958 Ga0466707_345958_9490_10149 219
97 3300042616 Ga0466715_406776 Ga0466715_406776_3235_3894 219
98 3300042636 Ga0466703_345209 Ga0466703_345209_9286_9945 219
99 iso_pr_bacteria 2940199050 2940201016 219
100 iso_pr_bacteria 2940209341 2940209643 219
101 iso_pr_bacteria 2940346213 2940347929 219
102 2225789004 2227519938 2228022368 220
103 3300000062 IMNBL1DRAFT_c0000571 IMNBL1DRAFT_00005718 220
104 3300000062 IMNBL1DRAFT_c0001800 IMNBL1DRAFT_00018001 220
105 3300000062 IMNBL1DRAFT_c0010101 IMNBL1DRAFT_00101012 220
106 3300042590 Ga0466690_427464 Ga0466690_427464_7858_8520 220
107 3300042596 Ga0466696_023674 Ga0466696_023674_618_1280 220
108 3300042599 Ga0466706_233555 Ga0466706_233555_18051_18713 220
109 iso_pr_bacteria 2820757377 2820759830 220
110 3300002509 JGI24699J35502_11134229 JGI24699J35502_111342292 221
111 3300042590 Ga0466690_147102 Ga0466690_147102_1431_2096 221
112 3300042593 Ga0466691_071708 Ga0466691_071708_17783_18448 221
113 3300042593 Ga0466691_204020 Ga0466691_204020_3502_4167 221
114 3300042605 Ga0466716_176243 Ga0466716_176243_1728_2393 221
115 3300042616 Ga0466715_163266 Ga0466715_163266_5811_6476 221
116 3300042620 Ga0466728_451299 Ga0466728_451299_1518_2183 221
117 3300010167 Ga0123353_10987715 Ga0123353_109877152 222
118 3300042643 Ga0466704_206895 Ga0466704_206895_6161_6829 222
119 3300042624 Ga0466735_109538 Ga0466735_109538_1177_1851 224
120 3300042643 Ga0466704_242149 Ga0466704_242149_2097_2771 224
121 3300042593 Ga0466691_078732 Ga0466691_078732_513_1190 225
122 3300042596 Ga0466696_001911 Ga0466696_001911_12846_13523 225
123 3300042615 Ga0466711_415995 Ga0466711_415995_8261_8941 226
124 iso_pr_bacteria 2820010479 2820012554 226
125 iso_pr_bacteria 3004667792 3004670955 226
126 3300002462 JGI24702J35022_10013758 JGI24702J35022_100137585 227
127 3300042622 Ga0466731_016398 Ga0466731_016398_299_982 227
128 3300042624 Ga0466735_102942 Ga0466735_102942_235_918 227
129 3300042617 Ga0466718_037637 Ga0466718_037637_1962_2648 228
130 3300042592 Ga0466693_267612 Ga0466693_267612_1498_2187 229
131 iso_pr_bacteria 2819998259 2819998513 229
132 3300042604 Ga0466717_205453 Ga0466717_205453_153_845 230
133 iso_pr_bacteria 2820014844 2820015860 230
134 3300042622 Ga0466731_134563 Ga0466731_134563_374_1081 235
135 3300042616 Ga0466715_181610 Ga0466715_181610_2421_3131 236
136 3300042616 Ga0466715_437866 Ga0466715_437866_3873_4598 241
137 3300042592 Ga0466693_392870 Ga0466693_392870_392_1129 245
138 3300002462 JGI24702J35022_10000989 JGI24702J35022_100009898 252

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00005 ABC_tran ABC transporter 47 195 0.89

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.87 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.