Protein Family IF00735

Metagenome Isolate
122 Members
49 Samples
116 Scaffolds
487.64 Avg Length

🧬 Representative Sequence

ID
3300002462|JGI24702J35022_10000242|JGI24702J35022_1000024217
Length
524 aa
Sequence
MKPTKKPRKGDPINLTVDFIYGHTKSTGMKNLAKDTAIYGVSSIIGRFLNWMLVPLYTRILQSTGEYGVVTNIYGWIALLLVILTYGMETGFFRFINKKEEQEPIRVYATTLYSIAFTSFLFIAGVLLFLNPVSTVLGYGDHPEYIGMMACVVAVDAICCIPFAYLRYQCRPVRFAAIKSFNIFLNISLNLFFLVLCPKLNNSHPELIKWFYRPEYGVGYIFISNIFTTAITFLMLMPNMLPALRAKFDRQRLKKMLRYSAPILILGAAGIFNQTAASILFPFLFEDRGLAESQLGIYGGCLKIAVVMIMFIQAFRYAYEPFIFAKNKDSDNKKSYIEAMKYFVIFSLVIFLGVMFYIDVIKHFVESEYYSGLSVVPIVMLGELFFGVYFNLSVWYKLTDKTHWGAYFSIAGCALTVAIIIGFVPHYGFIACAWASFASNLLMMLLSYFIGQKKFPVAYNLRSALFYISIAAAFYAVAMLPTIESTFLRLAYRTVFLIVFFAIIIKKDLPSFPKKNHEPVKPS*

📊 Sample Types

Isolate 4.9%
Metagenome 95.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 34.7%
Kalotermitidae 28.6%
Unclassified 12.2%
Rhinotermitidae 6.1%
Blattidae 6.1%
Termopsidae 4.1%
Passalidae 4.1%
Drosophilidae 2.0%
Tenebrionidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 119
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
2 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
5 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
6 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
7 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
8 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
9 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
10 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
11 3300007149 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut Metagenome Drosophilidae
12 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
13 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
14 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
15 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
16 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
17 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
18 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
19 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
20 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
21 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
22 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
23 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
24 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
25 2920168565 Paludibacter sp. 221 Isolate Blattidae
26 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
27 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
28 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
29 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
30 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
31 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
32 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
33 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
34 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
35 2820776227 Unclassified Bacteroidetes Emb289P4bin3 Isolate Unclassified
36 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
37 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
38 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
39 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
40 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
41 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
42 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
43 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
44 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
45 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
46 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
47 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
48 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
49 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_302460 3300042612 Bacteria 17135
2 Ga0466728_154588 3300042620 Bacteria 35846
3 Ga0123354_10197756 3300010882 Bacteria 2223
4 Ga0466656_171987 3300042550 Bacteria 10965
5 Ga0466690_129506 3300042590 Bacteria 9562
6 Ga0466696_087427 3300042596 Bacteria 2421
7 Ga0466709_359738 3300042648 Bacteria 20010
8 IMNBL1DRAFT_c0024131 3300000062 Bacteria 2364
9 Ga0068305_10025013 3300005083 Bacteria 12026
10 Ga0466733_022265 3300042659 Bacteria 16837
11 Ga0466715_253260 3300042616 Bacteria 69795
12 Ga0466718_146032 3300042617 Bacteria 3461
13 Ga0466728_020126 3300042620 Bacteria 8482
14 Ga0123357_10154536 3300009784 Bacteria 2772
15 Ga0123353_10041380 3300010167 Bacteria 7278
16 Ga0466690_143362 3300042590 Bacteria 6878
17 Ga0466696_160857 3300042596 Bacteria 18353
18 Ga0466701_017207 3300042598 Bacteria 16192
19 Ga0466713_112916 3300042602 Bacteria 35573
20 Ga0466716_063852 3300042605 Bacteria 9573
21 Ga0466716_346595 3300042605 Bacteria 12500
22 Ga0466721_240868 3300042608 Unclassified 1329
23 Ga0466735_116378 3300042624 Bacteria 5806
24 Ga0466703_001595 3300042636 Bacteria 18307
25 IMNBL1DRAFT_c0003116 3300000062 Bacteria 10933
26 JGI24702J35022_10000242 3300002462 Bacteria 31179
27 JGI24699J35502_11133427 3300002509 Bacteria 10493
28 Ga0466723_284577 3300042618 Bacteria 30836
29 Ga0123357_10006658 3300009784 Bacteria 14153
30 Ga0466693_034129 3300042592 Bacteria 1666
31 Ga0466691_005929 3300042593 Bacteria 29416
32 Ga0466719_233077 3300042606 Bacteria 7073
33 Ga0466719_292822 3300042606 Bacteria 42754
34 Ga0466722_038280 3300042609 Bacteria 17685
35 Ga0466722_092954 3300042609 Bacteria 48543
36 Ga0466735_165320 3300042624 Bacteria 4046
37 Ga0466703_128766 3300042636 Bacteria 7270
38 IMNBL1DRAFT_c0002135 3300000062 Bacteria 14050
39 JGI24696J40584_12960618 3300002834 Bacteria 7801
40 Ga0466715_270390 3300042616 Bacteria 25190
41 Ga0466715_506261 3300042616 Bacteria 34502
42 Ga0466729_121623 3300042621 Bacteria 6597
43 Ga0466691_214859 3300042593 Bacteria 4353
44 Ga0466696_019403 3300042596 Bacteria 8498
45 Ga0466696_192956 3300042596 Bacteria 11134
46 Ga0466713_086468 3300042602 Bacteria 93752
47 Ga0466714_096666 3300042603 Bacteria 172614
48 Ga0466716_128466 3300042605 Bacteria 7233
49 Ga0466703_034576 3300042636 Bacteria 8775
50 Ga0466704_286323 3300042643 Unclassified 5767
51 Ga0466708_297978 3300042652 Bacteria 6892
52 Ga0466708_391593 3300042652 Bacteria 20677
53 Ga0466725_139670 3300042654 Bacteria 26650
54 2227082781 2225789004 Bacteria 1871
55 JGI24702J35022_10003541 3300002462 Bacteria 9413
56 Ga0466733_124172 3300042659 Bacteria 27546
57 Ga0466715_623799 3300042616 Bacteria 6372
58 Ga0466723_190749 3300042618 Bacteria 41750
59 Ga0466728_108554 3300042620 Bacteria 25332
60 Ga0123355_10030302 3300009826 Bacteria 8767
61 Ga0466690_085991 3300042590 Bacteria 12516
62 Ga0466692_179942 3300042591 Bacteria 100786
63 Ga0466696_182506 3300042596 Bacteria 11867
64 Ga0466696_182725 3300042596 Bacteria 17837
65 Ga0466696_198037 3300042596 Bacteria 25609
66 Ga0466696_458987 3300042596 Bacteria 4331
67 Ga0466701_056175 3300042598 Bacteria 61782
68 Ga0466707_186109 3300042601 Bacteria 3087
69 Ga0466716_466289 3300042605 Bacteria 6059
70 Ga0466719_037606 3300042606 Bacteria 9015
71 2227476018 2225789004 Bacteria 4647
72 IMNBL1DRAFT_c0001240 3300000062 Bacteria 19239
73 IMNBL1DRAFT_c0002089 3300000062 Bacteria 14219
74 IMNBL1DRAFT_c0021054 3300000062 Bacteria 2620
75 Ga0562377_0004 3300056842 Bacteria 3525959
76 Ga0466711_010060 3300042615 Bacteria 4253
77 Ga0466715_113213 3300042616 Bacteria 91663
78 Ga0466715_368985 3300042616 Bacteria 23885
79 Ga0466728_021517 3300042620 Bacteria 26535
80 Ga0123354_10017301 3300010882 Bacteria 11293
81 Ga0466707_061575 3300042601 Bacteria 2280
82 Ga0466707_290530 3300042601 Bacteria 21845
83 Ga0466719_084339 3300042606 Bacteria 4874
84 Ga0466722_143082 3300042609 Bacteria 36937
85 Ga0466703_082815 3300042636 Bacteria 22209
86 Ga0466704_027280 3300042643 Bacteria 6629
87 Ga0466727_186998 3300042655 Bacteria 10433
88 2227607682 2225789004 Bacteria 2287
89 JGI24699J35502_11134172 3300002509 Bacteria 43867
90 Ga0466733_113941 3300042659 Bacteria 30906
91 Ga0123354_10001798 3300010882 Bacteria 27042
92 Ga0466690_019619 3300042590 Bacteria 7516
93 Ga0466690_191607 3300042590 Bacteria 12018
94 Ga0466696_273649 3300042596 Bacteria 8955
95 Ga0466713_023619 3300042602 Bacteria 28576
96 Ga0466719_515791 3300042606 Bacteria 3286
97 Ga0466722_238293 3300042609 Bacteria 4811
98 Ga0466704_459583 3300042643 Bacteria 12491
99 Ga0466708_200833 3300042652 Bacteria 7558
100 2227516313 2225789004 Bacteria 17602
101 JGI24702J35022_10029030 3300002462 Bacteria 2969
102 Ga0104040_1142433 3300007149 Bacteria 2804
103 Ga0123357_10001341 3300009784 Bacteria 26019
104 Ga0466733_104531 3300042659 Unclassified 3777
105 Ga0466711_497611 3300042615 Bacteria 15463
106 Ga0466715_142197 3300042616 Bacteria 15178
107 Ga0466729_114635 3300042621 Bacteria 10167
108 Ga0123353_10470813 3300010167 Bacteria 1842
109 Ga0466696_032769 3300042596 Bacteria 4898
110 Ga0466731_347524 3300042622 Bacteria 1821
111 Ga0466703_023808 3300042636 Bacteria 16050
112 Ga0466709_285564 3300042648 Bacteria 5343
113 Ga0466727_068971 3300042655 Bacteria 6037
114 2227164115 2225789004 Bacteria 36228
115 JGI24705J35276_12214599 3300002504 Bacteria 1968
116 JGI24705J35276_12238487 3300002504 Bacteria 23730

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042608 Ga0466721_240868 Ga0466721_240868_29_1309 426
2 3300042601 Ga0466707_186109 Ga0466707_186109_1186_2535 429
3 3300042593 Ga0466691_214859 Ga0466691_214859_308_1780 456
4 3300042598 Ga0466701_017207 Ga0466701_017207_2339_3829 456
5 3300042598 Ga0466701_056175 Ga0466701_056175_55124_56626 457
6 3300042605 Ga0466716_128466 Ga0466716_128466_3036_4460 458
7 2225789004 2227607682 2228177486 459
8 3300042621 Ga0466729_121623 Ga0466729_121623_1628_3082 460
9 3300042636 Ga0466703_034576 Ga0466703_034576_5756_7231 461
10 3300042620 Ga0466728_108554 Ga0466728_108554_18516_20000 464
11 3300042615 Ga0466711_010060 Ga0466711_010060_1538_3028 467
12 3300042615 Ga0466711_497611 Ga0466711_497611_13976_15445 467
13 3300042622 Ga0466731_347524 Ga0466731_347524_178_1692 467
14 3300042652 Ga0466708_200833 Ga0466708_200833_3606_5114 467
15 3300042620 Ga0466728_154588 Ga0466728_154588_16204_17685 468
16 3300042596 Ga0466696_032769 Ga0466696_032769_1464_2972 470
17 3300042601 Ga0466707_061575 Ga0466707_061575_19_1533 471
18 3300042616 Ga0466715_506261 Ga0466715_506261_15004_16503 472
19 3300042643 Ga0466704_459583 Ga0466704_459583_3464_4936 472
20 3300042655 Ga0466727_068971 Ga0466727_068971_4505_5977 472
21 3300002509 JGI24699J35502_11134172 JGI24699J35502_1113417215 474
22 3300042616 Ga0466715_270390 Ga0466715_270390_17474_18976 474
23 3300042652 Ga0466708_297978 Ga0466708_297978_3649_5133 474
24 3300042590 Ga0466690_129506 Ga0466690_129506_4943_6451 475
25 3300042601 Ga0466707_290530 Ga0466707_290530_19995_21464 475
26 3300042636 Ga0466703_001595 Ga0466703_001595_15227_16687 476
27 3300042643 Ga0466704_286323 Ga0466704_286323_4140_5660 477
28 3300002462 JGI24702J35022_10029030 JGI24702J35022_100290302 479
29 3300042618 Ga0466723_284577 Ga0466723_284577_19283_20782 479
30 3300042596 Ga0466696_273649 Ga0466696_273649_1419_2915 480
31 3300042616 Ga0466715_142197 Ga0466715_142197_10151_11668 480
32 3300000062 IMNBL1DRAFT_c0021054 IMNBL1DRAFT_00210543 481
33 3300042590 Ga0466690_019619 Ga0466690_019619_491_1996 481
34 3300042591 Ga0466692_179942 Ga0466692_179942_24405_25892 481
35 3300042602 Ga0466713_086468 Ga0466713_086468_65151_66662 482
36 3300042606 Ga0466719_037606 Ga0466719_037606_4026_5543 482
37 3300042620 Ga0466728_021517 Ga0466728_021517_19633_21105 482
38 3300042609 Ga0466722_092954 Ga0466722_092954_3339_4823 483
39 3300010167 Ga0123353_10470813 Ga0123353_104708132 484
40 3300042596 Ga0466696_087427 Ga0466696_087427_740_2224 484
41 3300042617 Ga0466718_146032 Ga0466718_146032_1259_2746 484
42 3300042606 Ga0466719_233077 Ga0466719_233077_801_2291 485
43 3300042609 Ga0466722_143082 Ga0466722_143082_11475_12965 485
44 3300042636 Ga0466703_023808 Ga0466703_023808_13969_15462 485
45 3300042596 Ga0466696_160857 Ga0466696_160857_12_1511 486
46 2225789004 2227082781 2227457940 487
47 3300009784 Ga0123357_10154536 Ga0123357_101545362 487
48 3300042593 Ga0466691_005929 Ga0466691_005929_21406_22905 487
49 3300042659 Ga0466733_113941 Ga0466733_113941_19097_20596 487
50 3300000062 IMNBL1DRAFT_c0002135 IMNBL1DRAFT_00021356 488
51 3300002509 JGI24699J35502_11133427 JGI24699J35502_111334273 488
52 3300042550 Ga0466656_171987 Ga0466656_171987_4549_6015 488
53 3300042620 Ga0466728_020126 Ga0466728_020126_454_1944 488
54 3300042655 Ga0466727_186998 Ga0466727_186998_1900_3366 488
55 3300042596 Ga0466696_192956 Ga0466696_192956_5746_7242 489
56 3300042654 Ga0466725_139670 Ga0466725_139670_913_2382 489
57 iso_pr_bacteria 2820762746 2820764519 489
58 3300000062 IMNBL1DRAFT_c0003116 IMNBL1DRAFT_00031162 490
59 3300042606 Ga0466719_084339 Ga0466719_084339_2644_4140 490
60 3300042624 Ga0466735_165320 Ga0466735_165320_732_2246 490
61 3300042652 Ga0466708_391593 Ga0466708_391593_16953_18425 490
62 3300009826 Ga0123355_10030302 Ga0123355_100303027 491
63 3300042616 Ga0466715_623799 Ga0466715_623799_1064_2560 491
64 2225789004 2227476018 2227928138 492
65 3300005083 Ga0068305_10025013 Ga0068305_100250134 492
66 3300042590 Ga0466690_191607 Ga0466690_191607_161_1660 492
67 3300042596 Ga0466696_458987 Ga0466696_458987_1784_3283 492
68 3300042603 Ga0466714_096666 Ga0466714_096666_158211_159707 492
69 3300042618 Ga0466723_190749 Ga0466723_190749_4878_6377 492
70 3300002834 JGI24696J40584_12960618 JGI24696J40584_129606184 493
71 3300042592 Ga0466693_034129 Ga0466693_034129_137_1636 493
72 3300042602 Ga0466713_023619 Ga0466713_023619_18045_19526 493
73 3300042605 Ga0466716_466289 Ga0466716_466289_1767_3269 493
74 3300042659 Ga0466733_124172 Ga0466733_124172_23220_24701 493
75 2225789004 2227164115 2227574773 494
76 3300042596 Ga0466696_019403 Ga0466696_019403_3807_5306 494
77 3300042609 Ga0466722_038280 Ga0466722_038280_1193_2710 494
78 3300042624 Ga0466735_116378 Ga0466735_116378_4111_5598 495
79 3300042636 Ga0466703_128766 Ga0466703_128766_4043_5572 495
80 3300000062 IMNBL1DRAFT_c0024131 IMNBL1DRAFT_00241312 496
81 3300002462 JGI24702J35022_10003541 JGI24702J35022_100035413 496
82 3300010882 Ga0123354_10197756 Ga0123354_101977562 496
83 3300042659 Ga0466733_022265 Ga0466733_022265_4374_5864 496
84 3300000062 IMNBL1DRAFT_c0002089 IMNBL1DRAFT_00020899 497
85 3300042596 Ga0466696_182725 Ga0466696_182725_2755_4248 497
86 iso_pr_bacteria 2910930387 2910932153 497
87 3300002504 JGI24705J35276_12214599 JGI24705J35276_122145992 498
88 3300009784 Ga0123357_10006658 Ga0123357_100066583 498
89 3300010882 Ga0123354_10001798 Ga0123354_1000179816 498
90 3300042596 Ga0466696_182506 Ga0466696_182506_4911_6407 498
91 3300056842 Ga0562377_0004 Ga0562377_0004_2318617_2320113 498
92 2225789004 2227516313 2228015572 499
93 3300042590 Ga0466690_143362 Ga0466690_143362_2164_3663 499
94 3300042602 Ga0466713_112916 Ga0466713_112916_7438_8937 499
95 3300042616 Ga0466715_113213 Ga0466715_113213_19725_21224 499
96 3300042621 Ga0466729_114635 Ga0466729_114635_3603_5102 499
97 3300042648 Ga0466709_285564 Ga0466709_285564_1355_2854 499
98 3300042659 Ga0466733_104531 Ga0466733_104531_2085_3584 499
99 iso_pr_bacteria 2820757377 2820757635 499
100 iso_pr_bacteria 2820776227 2820777860 499
101 3300000062 IMNBL1DRAFT_c0001240 IMNBL1DRAFT_000124012 500
102 3300009784 Ga0123357_10001341 Ga0123357_1000134120 500
103 3300042596 Ga0466696_198037 Ga0466696_198037_20760_22262 500
104 3300042616 Ga0466715_253260 Ga0466715_253260_57010_58512 500
105 3300007149 Ga0104040_1142433 Ga0104040_11424332 501
106 3300010167 Ga0123353_10041380 Ga0123353_100413803 501
107 3300042605 Ga0466716_346595 Ga0466716_346595_5822_7330 502
108 3300042606 Ga0466719_292822 Ga0466719_292822_4775_6283 502
109 3300042616 Ga0466715_368985 Ga0466715_368985_12200_13708 502
110 3300042636 Ga0466703_082815 Ga0466703_082815_10309_11817 502
111 iso_pr_bacteria 2940202316 2940205450 502
112 3300010882 Ga0123354_10017301 Ga0123354_100173017 503
113 3300042609 Ga0466722_238293 Ga0466722_238293_1898_3430 503
114 3300042612 Ga0466705_302460 Ga0466705_302460_13486_15018 503
115 3300042643 Ga0466704_027280 Ga0466704_027280_4314_5846 503
116 3300002504 JGI24705J35276_12238487 JGI24705J35276_122384877 506
117 3300042648 Ga0466709_359738 Ga0466709_359738_1789_3330 506
118 iso_pr_bacteria 2920168565 2920170405 507
119 3300042605 Ga0466716_063852 Ga0466716_063852_6301_7830 509
120 3300042590 Ga0466690_085991 Ga0466690_085991_508_2070 520
121 3300002462 JGI24702J35022_10000242 JGI24702J35022_1000024217 524
122 3300042606 Ga0466719_515791 Ga0466719_515791_1444_3027 527

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF14667 Polysacc_synt_C Polysaccharide biosynthesis C-terminal domain 377 504 0.8

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.85 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.