Protein Family IF00731
Metagenome
Isolate
163
Members
59
Samples
145
Scaffolds
458.41
Avg Length
Representative Sequence
- ID
- 3300002462|JGI24702J35022_10000101|JGI24702J35022_1000010116
- Length
- 505 aa
- Sequence
- MQYVEKNPRRGDALLTAGTTNGKMNKSRLRTIYIGIDFLSAAITWFLFNLLRYSEVAKYEFGTLPDFLLYAQVVKGQIMVPLFWLWLYFLSGYYNKPFGKSRIGELFSTVITVVIGSIIIFFRVVLNELPPSFDVYYRFFFSLCLMQFVLTYTGRSLITGYAIRKSKSREWVENVLIVGTGKEAVKVRQFLEESGYHIVGFVEEGGFDGQSGIAQEDGFADKNVMTVSPYVDPQEIAGTIDSIPEILQRYKVDEIVVAVKGLEVVNLLYQFYRYRLPVKVLADKKNFLSKAKVSAIGGIPLIDITENNFSEAEKNIKWFLDKVVSVSILLLFSPLYAYIAVRVKFTSQGPVFFRQERIGYRGKPFRIYKFRTMFKEASEEGPLLTARDDKRVTPFGRFLRKYRLDEIPQFWNVLCGDMSLVGPRPEQRYYIEQIVRKAPYYYLLHNVRPGITSWGMVKYGYAETVDKMIERLDYDILYYENMSLALDIKILIYTVQIVLSGKGV*
Sample Types
Isolate
11.0%
Metagenome
89.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
30.5%
Termitidae
23.7%
Kalotermitidae
23.7%
Termopsidae
6.8%
Rhinotermitidae
5.1%
Unclassified
5.1%
Passalidae
3.4%
Hodotermitidae
1.7%
Taxonomy
Archaea
0
Bacteria
161
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 2 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 3 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 4 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 5 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 13 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 14 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 15 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 16 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 17 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 18 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 19 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 20 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 21 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 22 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 23 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 24 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 25 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 26 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 27 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 28 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 29 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 30 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 31 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 32 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 33 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 34 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 35 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 36 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 37 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 38 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 39 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 40 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 41 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 42 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 43 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 44 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 45 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 46 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 47 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 48 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 49 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 50 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 51 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 52 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 53 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 54 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 55 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 56 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 57 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 58 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 59 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_162634 | 3300042659 | Bacteria | 12785 |
| 2 | Ga0466701_015411 | 3300042598 | Bacteria | 14183 |
| 3 | Ga0466729_279151 | 3300042621 | Bacteria | 6672 |
| 4 | Ga0466731_313268 | 3300042622 | Bacteria | 2143 |
| 5 | Ga0466734_128814 | 3300042623 | Bacteria | 3780 |
| 6 | Ga0466709_305645 | 3300042648 | Bacteria | 7160 |
| 7 | Ga0466727_026697 | 3300042655 | Bacteria | 7386 |
| 8 | Ga0466716_128130 | 3300042605 | Bacteria | 17659 |
| 9 | Ga0466698_444636 | 3300042610 | Bacteria | 4812 |
| 10 | Ga0466728_407647 | 3300042620 | Unclassified | 2203 |
| 11 | 2227521841 | 2225789004 | Bacteria | 17301 |
| 12 | 2227535756 | 2225789004 | Bacteria | 15976 |
| 13 | Ga0123354_10131428 | 3300010882 | Bacteria | 3160 |
| 14 | Ga0466692_046708 | 3300042591 | Bacteria | 150257 |
| 15 | Ga0466692_131231 | 3300042591 | Bacteria | 18041 |
| 16 | Ga0466703_008146 | 3300042636 | Bacteria | 15713 |
| 17 | Ga0466704_260073 | 3300042643 | Bacteria | 23800 |
| 18 | Ga0466709_326163 | 3300042648 | Bacteria | 6796 |
| 19 | Ga0466708_094726 | 3300042652 | Bacteria | 14644 |
| 20 | Ga0466706_286334 | 3300042599 | Bacteria | 25445 |
| 21 | Ga0466713_026107 | 3300042602 | Bacteria | 57287 |
| 22 | Ga0466715_508909 | 3300042616 | Bacteria | 1429 |
| 23 | Ga0466728_456442 | 3300042620 | Bacteria | 3566 |
| 24 | JGI24702J35022_10000101 | 3300002462 | Bacteria | 39658 |
| 25 | JGI24702J35022_10076727 | 3300002462 | Bacteria | 1806 |
| 26 | Ga0466690_196376 | 3300042590 | Bacteria | 23671 |
| 27 | Ga0466691_018454 | 3300042593 | Bacteria | 13898 |
| 28 | Ga0466696_169181 | 3300042596 | Bacteria | 3472 |
| 29 | Ga0466734_098282 | 3300042623 | Bacteria | 1929 |
| 30 | Ga0466709_205828 | 3300042648 | Bacteria | 3353 |
| 31 | Ga0466727_125117 | 3300042655 | Bacteria | 15260 |
| 32 | Ga0466700_274743 | 3300042600 | Bacteria | 43717 |
| 33 | Ga0466713_016495 | 3300042602 | Bacteria | 11751 |
| 34 | Ga0466713_029979 | 3300042602 | Bacteria | 8074 |
| 35 | Ga0466713_044677 | 3300042602 | Bacteria | 5655 |
| 36 | Ga0466716_529253 | 3300042605 | Bacteria | 8438 |
| 37 | Ga0466719_090088 | 3300042606 | Bacteria | 4118 |
| 38 | Ga0466719_103315 | 3300042606 | Bacteria | 6695 |
| 39 | Ga0466722_037431 | 3300042609 | Bacteria | 3470 |
| 40 | Ga0466722_111324 | 3300042609 | Bacteria | 4470 |
| 41 | Ga0466711_303713 | 3300042615 | Bacteria | 13880 |
| 42 | Ga0466715_037900 | 3300042616 | Bacteria | 143938 |
| 43 | Ga0466715_188206 | 3300042616 | Bacteria | 3088 |
| 44 | Ga0466723_099232 | 3300042618 | Bacteria | 25745 |
| 45 | Ga0466723_287832 | 3300042618 | Bacteria | 14308 |
| 46 | Ga0466723_313673 | 3300042618 | Bacteria | 69196 |
| 47 | Ga0466726_347450 | 3300042619 | Bacteria | 33335 |
| 48 | 2227557982 | 2225789004 | Bacteria | 2759 |
| 49 | JGI24702J35022_10037578 | 3300002462 | Bacteria | 2586 |
| 50 | Ga0068302_10058357 | 3300005071 | Bacteria | 3907 |
| 51 | Ga0466705_132638 | 3300042612 | Bacteria | 9271 |
| 52 | Ga0466656_024313 | 3300042550 | Bacteria | 12527 |
| 53 | Ga0466691_181565 | 3300042593 | Bacteria | 12450 |
| 54 | Ga0466696_010174 | 3300042596 | Bacteria | 34499 |
| 55 | Ga0466696_027471 | 3300042596 | Bacteria | 17440 |
| 56 | Ga0466735_073305 | 3300042624 | Bacteria | 2967 |
| 57 | Ga0466709_124532 | 3300042648 | Bacteria | 22970 |
| 58 | Ga0466708_358292 | 3300042652 | Bacteria | 25849 |
| 59 | Ga0466727_125377 | 3300042655 | Bacteria | 24351 |
| 60 | Ga0466727_253174 | 3300042655 | Bacteria | 42635 |
| 61 | Ga0466727_266797 | 3300042655 | Bacteria | 6334 |
| 62 | Ga0466706_100423 | 3300042599 | Bacteria | 7026 |
| 63 | Ga0466700_197280 | 3300042600 | Bacteria | 4449 |
| 64 | Ga0466713_125564 | 3300042602 | Bacteria | 27296 |
| 65 | Ga0466717_262390 | 3300042604 | Bacteria | 2615 |
| 66 | Ga0466723_281682 | 3300042618 | Bacteria | 37853 |
| 67 | IMNBL1DRAFT_c0000622 | 3300000062 | Bacteria | 28309 |
| 68 | JGI24699J35502_11134232 | 3300002509 | Bacteria | 111679 |
| 69 | Ga0068305_10045344 | 3300005083 | Bacteria | 18638 |
| 70 | Ga0068305_10418114 | 3300005083 | Unclassified | 8113 |
| 71 | Ga0123357_10086801 | 3300009784 | Bacteria | 4094 |
| 72 | Ga0123357_10090935 | 3300009784 | Bacteria | 3978 |
| 73 | Ga0466690_420451 | 3300042590 | Bacteria | 55352 |
| 74 | Ga0466692_112545 | 3300042591 | Bacteria | 4840 |
| 75 | Ga0466696_026702 | 3300042596 | Bacteria | 3813 |
| 76 | Ga0466735_025370 | 3300042624 | Bacteria | 12705 |
| 77 | Ga0466704_115064 | 3300042643 | Bacteria | 4076 |
| 78 | Ga0466709_086977 | 3300042648 | Bacteria | 21198 |
| 79 | Ga0466708_403808 | 3300042652 | Bacteria | 9710 |
| 80 | Ga0466713_041641 | 3300042602 | Bacteria | 16534 |
| 81 | Ga0466715_003405 | 3300042616 | Bacteria | 6206 |
| 82 | Ga0466715_077049 | 3300042616 | Bacteria | 2313 |
| 83 | 2227630470 | 2225789004 | Bacteria | 2126 |
| 84 | IMNBL1DRAFT_c0000089 | 3300000062 | Bacteria | 79556 |
| 85 | Ga0466705_000228 | 3300042612 | Bacteria | 13423 |
| 86 | Ga0466705_116292 | 3300042612 | Bacteria | 6155 |
| 87 | Ga0466733_038286 | 3300042659 | Bacteria | 266317 |
| 88 | Ga0466690_030608 | 3300042590 | Bacteria | 6157 |
| 89 | Ga0466691_003181 | 3300042593 | Bacteria | 28797 |
| 90 | Ga0466696_297169 | 3300042596 | Bacteria | 7644 |
| 91 | Ga0466708_086991 | 3300042652 | Bacteria | 84818 |
| 92 | Ga0466727_067522 | 3300042655 | Bacteria | 4550 |
| 93 | Ga0466727_069058 | 3300042655 | Bacteria | 20083 |
| 94 | Ga0466707_147134 | 3300042601 | Bacteria | 4178 |
| 95 | Ga0466713_023349 | 3300042602 | Bacteria | 47416 |
| 96 | Ga0466716_483383 | 3300042605 | Bacteria | 3173 |
| 97 | Ga0466719_025259 | 3300042606 | Bacteria | 5069 |
| 98 | Ga0466719_222496 | 3300042606 | Bacteria | 2277 |
| 99 | Ga0466719_563489 | 3300042606 | Bacteria | 4925 |
| 100 | Ga0466722_085305 | 3300042609 | Bacteria | 8822 |
| 101 | Ga0466705_447381 | 3300042612 | Bacteria | 3877 |
| 102 | Ga0466711_234013 | 3300042615 | Bacteria | 5771 |
| 103 | Ga0466715_026564 | 3300042616 | Bacteria | 24516 |
| 104 | Ga0466726_392655 | 3300042619 | Bacteria | 5142 |
| 105 | IMNBL1DRAFT_c0006155 | 3300000062 | Bacteria | 6632 |
| 106 | JGI24702J35022_10045977 | 3300002462 | Bacteria | 2325 |
| 107 | Ga0068305_10043541 | 3300005083 | Bacteria | 24254 |
| 108 | Ga0123357_10053839 | 3300009784 | Bacteria | 5428 |
| 109 | Ga0466690_130405 | 3300042590 | Bacteria | 17175 |
| 110 | Ga0466692_044459 | 3300042591 | Bacteria | 6470 |
| 111 | Ga0466692_176518 | 3300042591 | Bacteria | 19183 |
| 112 | Ga0466696_237950 | 3300042596 | Bacteria | 8488 |
| 113 | Ga0466735_073233 | 3300042624 | Bacteria | 2518 |
| 114 | Ga0466703_260219 | 3300042636 | Bacteria | 7889 |
| 115 | Ga0466703_343349 | 3300042636 | Bacteria | 6769 |
| 116 | Ga0466703_415408 | 3300042636 | Bacteria | 4807 |
| 117 | Ga0466725_174101 | 3300042654 | Bacteria | 15697 |
| 118 | Ga0466727_072896 | 3300042655 | Bacteria | 3660 |
| 119 | Ga0466713_118280 | 3300042602 | Bacteria | 6295 |
| 120 | Ga0466716_183262 | 3300042605 | Bacteria | 30600 |
| 121 | Ga0466716_461665 | 3300042605 | Bacteria | 14636 |
| 122 | Ga0466711_221277 | 3300042615 | Bacteria | 13189 |
| 123 | Ga0466715_525875 | 3300042616 | Bacteria | 7148 |
| 124 | Ga0466728_356610 | 3300042620 | Bacteria | 4592 |
| 125 | IMNBL1DRAFT_c0000827 | 3300000062 | Bacteria | 24404 |
| 126 | IMNBL1DRAFT_c0001549 | 3300000062 | Bacteria | 17157 |
| 127 | JGI24702J35022_10003733 | 3300002462 | Bacteria | 9152 |
| 128 | JGI24702J35022_10005531 | 3300002462 | Bacteria | 7367 |
| 129 | JGI24705J35276_12238189 | 3300002504 | Bacteria | 17050 |
| 130 | Ga0466733_192802 | 3300042659 | Bacteria | 54728 |
| 131 | Ga0123357_10146408 | 3300009784 | Bacteria | 2883 |
| 132 | Ga0466690_398823 | 3300042590 | Bacteria | 4098 |
| 133 | Ga0466692_036236 | 3300042591 | Bacteria | 19554 |
| 134 | Ga0466696_272280 | 3300042596 | Bacteria | 5143 |
| 135 | Ga0466703_086275 | 3300042636 | Bacteria | 16351 |
| 136 | Ga0466704_055783 | 3300042643 | Bacteria | 11258 |
| 137 | Ga0466704_123070 | 3300042643 | Bacteria | 36133 |
| 138 | Ga0466704_145846 | 3300042643 | Bacteria | 11150 |
| 139 | Ga0466727_319110 | 3300042655 | Bacteria | 3208 |
| 140 | Ga0466707_366508 | 3300042601 | Bacteria | 2094 |
| 141 | Ga0466713_051716 | 3300042602 | Bacteria | 14617 |
| 142 | Ga0466719_358095 | 3300042606 | Bacteria | 26180 |
| 143 | Ga0466723_299222 | 3300042618 | Bacteria | 28350 |
| 144 | Ga0466726_123657 | 3300042619 | Bacteria | 3931 |
| 145 | JGI24702J35022_10006038 | 3300002462 | Bacteria | 7028 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042596 | Ga0466696_027471 | Ga0466696_027471_8776_10173 | 411 |
| 2 | 3300042622 | Ga0466731_313268 | Ga0466731_313268_51_1298 | 415 |
| 3 | 3300042616 | Ga0466715_525875 | Ga0466715_525875_5390_6730 | 418 |
| 4 | 3300042591 | Ga0466692_131231 | Ga0466692_131231_4960_6255 | 423 |
| 5 | 3300042616 | Ga0466715_508909 | Ga0466715_508909_79_1404 | 427 |
| 6 | 3300042623 | Ga0466734_128814 | Ga0466734_128814_1654_3072 | 431 |
| 7 | 3300042612 | Ga0466705_447381 | Ga0466705_447381_693_2081 | 436 |
| 8 | 3300009784 | Ga0123357_10146408 | Ga0123357_101464082 | 438 |
| 9 | 3300010882 | Ga0123354_10131428 | Ga0123354_101314282 | 438 |
| 10 | 3300042624 | Ga0466735_073233 | Ga0466735_073233_221_1618 | 438 |
| 11 | 3300042606 | Ga0466719_563489 | Ga0466719_563489_814_2133 | 439 |
| 12 | 3300042618 | Ga0466723_281682 | Ga0466723_281682_32427_33767 | 439 |
| 13 | 3300042604 | Ga0466717_262390 | Ga0466717_262390_509_1909 | 440 |
| 14 | 3300042655 | Ga0466727_069058 | Ga0466727_069058_8147_9469 | 440 |
| 15 | 3300042620 | Ga0466728_356610 | Ga0466728_356610_2137_3492 | 441 |
| 16 | 3300042600 | Ga0466700_197280 | Ga0466700_197280_2399_3799 | 442 |
| 17 | 3300000062 | IMNBL1DRAFT_c0001549 | IMNBL1DRAFT_00015497 | 444 |
| 18 | 3300042591 | Ga0466692_044459 | Ga0466692_044459_2334_3707 | 444 |
| 19 | 3300042598 | Ga0466701_015411 | Ga0466701_015411_920_2338 | 444 |
| 20 | 3300042609 | Ga0466722_085305 | Ga0466722_085305_5395_6780 | 444 |
| 21 | 3300042623 | Ga0466734_098282 | Ga0466734_098282_469_1869 | 444 |
| 22 | 3300005083 | Ga0068305_10043541 | Ga0068305_1004354116 | 445 |
| 23 | 3300009784 | Ga0123357_10090935 | Ga0123357_100909352 | 445 |
| 24 | 3300042596 | Ga0466696_297169 | Ga0466696_297169_3201_4643 | 445 |
| 25 | 3300042618 | Ga0466723_287832 | Ga0466723_287832_3809_5227 | 445 |
| 26 | 3300042643 | Ga0466704_055783 | Ga0466704_055783_4685_6103 | 445 |
| 27 | 3300000062 | IMNBL1DRAFT_c0000089 | IMNBL1DRAFT_000008917 | 446 |
| 28 | 3300002462 | JGI24702J35022_10003733 | JGI24702J35022_1000373311 | 446 |
| 29 | 3300042591 | Ga0466692_036236 | Ga0466692_036236_11056_12456 | 446 |
| 30 | 3300042601 | Ga0466707_147134 | Ga0466707_147134_1999_3339 | 446 |
| 31 | 3300042618 | Ga0466723_299222 | Ga0466723_299222_24544_25926 | 446 |
| 32 | 3300005083 | Ga0068305_10418114 | Ga0068305_104181145 | 447 |
| 33 | 3300042609 | Ga0466722_037431 | Ga0466722_037431_1143_2543 | 447 |
| 34 | 3300042659 | Ga0466733_038286 | Ga0466733_038286_65178_66578 | 447 |
| 35 | 3300002504 | JGI24705J35276_12238189 | JGI24705J35276_122381894 | 448 |
| 36 | 3300042602 | Ga0466713_125564 | Ga0466713_125564_15545_16891 | 448 |
| 37 | 3300042606 | Ga0466719_103315 | Ga0466719_103315_2111_3511 | 448 |
| 38 | 3300042620 | Ga0466728_456442 | Ga0466728_456442_1865_3265 | 448 |
| 39 | 3300000062 | IMNBL1DRAFT_c0000622 | IMNBL1DRAFT_000062219 | 449 |
| 40 | 3300042615 | Ga0466711_303713 | Ga0466711_303713_8691_10091 | 449 |
| 41 | 3300042602 | Ga0466713_041641 | Ga0466713_041641_5578_6951 | 450 |
| 42 | 3300009784 | Ga0123357_10086801 | Ga0123357_100868013 | 451 |
| 43 | 3300042612 | Ga0466705_000228 | Ga0466705_000228_6183_7601 | 451 |
| 44 | 3300042618 | Ga0466723_313673 | Ga0466723_313673_29330_30685 | 451 |
| 45 | 3300042636 | Ga0466703_343349 | Ga0466703_343349_2284_3684 | 451 |
| 46 | 3300042643 | Ga0466704_123070 | Ga0466704_123070_2358_3782 | 451 |
| 47 | 3300042643 | Ga0466704_145846 | Ga0466704_145846_4522_5916 | 451 |
| 48 | 3300042648 | Ga0466709_086977 | Ga0466709_086977_4332_5687 | 451 |
| 49 | 3300042655 | Ga0466727_067522 | Ga0466727_067522_2356_3726 | 451 |
| 50 | 3300042659 | Ga0466733_192802 | Ga0466733_192802_32147_33541 | 451 |
| 51 | 3300042602 | Ga0466713_044677 | Ga0466713_044677_3855_5252 | 452 |
| 52 | 3300042654 | Ga0466725_174101 | Ga0466725_174101_6586_7986 | 452 |
| 53 | 3300042596 | Ga0466696_026702 | Ga0466696_026702_1930_3327 | 453 |
| 54 | 3300042605 | Ga0466716_128130 | Ga0466716_128130_2284_3684 | 453 |
| 55 | 3300042612 | Ga0466705_116292 | Ga0466705_116292_3099_4493 | 453 |
| 56 | 3300042616 | Ga0466715_003405 | Ga0466715_003405_2743_4104 | 453 |
| 57 | 3300042619 | Ga0466726_392655 | Ga0466726_392655_2457_3857 | 453 |
| 58 | 3300042590 | Ga0466690_398823 | Ga0466690_398823_1750_3150 | 454 |
| 59 | 3300042596 | Ga0466696_169181 | Ga0466696_169181_1586_2986 | 454 |
| 60 | 3300042591 | Ga0466692_112545 | Ga0466692_112545_1592_2959 | 455 |
| 61 | 3300042636 | Ga0466703_086275 | Ga0466703_086275_461_1882 | 455 |
| 62 | 3300042590 | Ga0466690_030608 | Ga0466690_030608_1973_3376 | 456 |
| 63 | 3300042609 | Ga0466722_111324 | Ga0466722_111324_353_1753 | 456 |
| 64 | 2225789004 | 2227630470 | 2228214418 | 457 |
| 65 | 3300000062 | IMNBL1DRAFT_c0006155 | IMNBL1DRAFT_00061554 | 457 |
| 66 | 3300002462 | JGI24702J35022_10045977 | JGI24702J35022_100459771 | 458 |
| 67 | 3300002509 | JGI24699J35502_11134232 | JGI24699J35502_1113423284 | 458 |
| 68 | 3300042602 | Ga0466713_029979 | Ga0466713_029979_6408_7787 | 459 |
| 69 | 3300002462 | JGI24702J35022_10005531 | JGI24702J35022_100055313 | 460 |
| 70 | 3300042652 | Ga0466708_358292 | Ga0466708_358292_10622_12004 | 460 |
| 71 | 3300042655 | Ga0466727_026697 | Ga0466727_026697_4525_5940 | 460 |
| 72 | 3300002462 | JGI24702J35022_10006038 | JGI24702J35022_100060382 | 461 |
| 73 | 3300042616 | Ga0466715_037900 | Ga0466715_037900_83795_85225 | 461 |
| 74 | 3300042648 | Ga0466709_124532 | Ga0466709_124532_16875_18287 | 461 |
| 75 | 2225789004 | 2227521841 | 2228025772 | 462 |
| 76 | 3300042643 | Ga0466704_115064 | Ga0466704_115064_1760_3148 | 462 |
| 77 | 3300042655 | Ga0466727_072896 | Ga0466727_072896_1706_3094 | 462 |
| 78 | 3300000062 | IMNBL1DRAFT_c0000827 | IMNBL1DRAFT_000082710 | 463 |
| 79 | 3300002462 | JGI24702J35022_10037578 | JGI24702J35022_100375782 | 463 |
| 80 | 3300005071 | Ga0068302_10058357 | Ga0068302_100583572 | 463 |
| 81 | 3300042601 | Ga0466707_366508 | Ga0466707_366508_150_1541 | 463 |
| 82 | 3300042602 | Ga0466713_118280 | Ga0466713_118280_3846_5261 | 463 |
| 83 | 3300042610 | Ga0466698_444636 | Ga0466698_444636_291_1682 | 463 |
| 84 | 3300002462 | JGI24702J35022_10076727 | JGI24702J35022_100767272 | 464 |
| 85 | 3300042593 | Ga0466691_003181 | Ga0466691_003181_23363_24757 | 464 |
| 86 | 3300042593 | Ga0466691_181565 | Ga0466691_181565_2076_3470 | 464 |
| 87 | 3300042602 | Ga0466713_016495 | Ga0466713_016495_4701_6095 | 464 |
| 88 | 3300042648 | Ga0466709_305645 | Ga0466709_305645_51_1445 | 464 |
| 89 | 3300042659 | Ga0466733_162634 | Ga0466733_162634_8142_9536 | 464 |
| 90 | 2225789004 | 2227535756 | 2228053244 | 465 |
| 91 | 3300042596 | Ga0466696_010174 | Ga0466696_010174_14665_16062 | 465 |
| 92 | 3300042615 | Ga0466711_221277 | Ga0466711_221277_10712_12130 | 465 |
| 93 | 3300042648 | Ga0466709_205828 | Ga0466709_205828_1762_3159 | 465 |
| 94 | 3300042550 | Ga0466656_024313 | Ga0466656_024313_2756_4156 | 466 |
| 95 | 3300042591 | Ga0466692_046708 | Ga0466692_046708_16195_17595 | 466 |
| 96 | 3300042593 | Ga0466691_018454 | Ga0466691_018454_8676_10076 | 466 |
| 97 | 3300042599 | Ga0466706_100423 | Ga0466706_100423_1964_3364 | 466 |
| 98 | 3300042602 | Ga0466713_026107 | Ga0466713_026107_53422_54822 | 466 |
| 99 | 3300042605 | Ga0466716_183262 | Ga0466716_183262_14630_16030 | 466 |
| 100 | 3300042605 | Ga0466716_461665 | Ga0466716_461665_9349_10749 | 466 |
| 101 | 3300042605 | Ga0466716_483383 | Ga0466716_483383_272_1672 | 466 |
| 102 | 3300042606 | Ga0466719_090088 | Ga0466719_090088_922_2322 | 466 |
| 103 | 3300042612 | Ga0466705_132638 | Ga0466705_132638_5264_6664 | 466 |
| 104 | 3300042616 | Ga0466715_026564 | Ga0466715_026564_8719_10119 | 466 |
| 105 | 3300042618 | Ga0466723_099232 | Ga0466723_099232_12076_13476 | 466 |
| 106 | 3300042619 | Ga0466726_123657 | Ga0466726_123657_1850_3250 | 466 |
| 107 | 3300042636 | Ga0466703_260219 | Ga0466703_260219_2038_3438 | 466 |
| 108 | 3300042636 | Ga0466703_415408 | Ga0466703_415408_1340_2740 | 466 |
| 109 | 3300042655 | Ga0466727_266797 | Ga0466727_266797_3222_4622 | 466 |
| 110 | iso_pr_bacteria | 2923982719 | 2923984322 | 466 |
| 111 | iso_pr_bacteria | 2940199050 | 2940200819 | 466 |
| 112 | iso_pr_bacteria | 2940205530 | 2940205731 | 466 |
| 113 | iso_pr_bacteria | 2940209341 | 2940210126 | 466 |
| 114 | iso_pr_bacteria | 2940212447 | 2940212648 | 466 |
| 115 | iso_pr_bacteria | 2940298504 | 2940298705 | 466 |
| 116 | iso_pr_bacteria | 2940302308 | 2940302509 | 466 |
| 117 | iso_pr_bacteria | 2940306115 | 2940306638 | 466 |
| 118 | iso_pr_bacteria | 2940309933 | 2940310380 | 466 |
| 119 | iso_pr_bacteria | 2940313741 | 2940314191 | 466 |
| 120 | iso_pr_bacteria | 2940317558 | 2940318005 | 466 |
| 121 | iso_pr_bacteria | 2940321370 | 2940321892 | 466 |
| 122 | iso_pr_bacteria | 2940325180 | 2940325375 | 466 |
| 123 | iso_pr_bacteria | 2940328985 | 2940329181 | 466 |
| 124 | iso_pr_bacteria | 2940332795 | 2940333318 | 466 |
| 125 | iso_pr_bacteria | 2940346213 | 2940347677 | 466 |
| 126 | iso_pr_bacteria | 2940371297 | 2940371997 | 466 |
| 127 | 3300005083 | Ga0068305_10045344 | Ga0068305_1004534418 | 467 |
| 128 | 3300042602 | Ga0466713_051716 | Ga0466713_051716_8534_9937 | 467 |
| 129 | 3300042605 | Ga0466716_529253 | Ga0466716_529253_3987_5390 | 467 |
| 130 | 3300042606 | Ga0466719_358095 | Ga0466719_358095_3324_4727 | 467 |
| 131 | 3300042615 | Ga0466711_234013 | Ga0466711_234013_3605_5008 | 467 |
| 132 | 3300042616 | Ga0466715_077049 | Ga0466715_077049_754_2157 | 467 |
| 133 | 3300042620 | Ga0466728_407647 | Ga0466728_407647_275_1693 | 467 |
| 134 | 3300042624 | Ga0466735_025370 | Ga0466735_025370_963_2366 | 467 |
| 135 | 3300042648 | Ga0466709_326163 | Ga0466709_326163_3046_4449 | 467 |
| 136 | 3300042652 | Ga0466708_086991 | Ga0466708_086991_56168_57571 | 467 |
| 137 | 3300042652 | Ga0466708_403808 | Ga0466708_403808_6252_7655 | 467 |
| 138 | 3300042655 | Ga0466727_125117 | Ga0466727_125117_10781_12184 | 467 |
| 139 | 3300042596 | Ga0466696_237950 | Ga0466696_237950_2798_4222 | 468 |
| 140 | 3300042606 | Ga0466719_025259 | Ga0466719_025259_814_2220 | 468 |
| 141 | 3300042616 | Ga0466715_188206 | Ga0466715_188206_742_2148 | 468 |
| 142 | 3300042655 | Ga0466727_125377 | Ga0466727_125377_15825_17231 | 468 |
| 143 | 3300042636 | Ga0466703_008146 | Ga0466703_008146_11894_13303 | 469 |
| 144 | 3300009784 | Ga0123357_10053839 | Ga0123357_100538394 | 470 |
| 145 | 3300042590 | Ga0466690_130405 | Ga0466690_130405_425_1840 | 471 |
| 146 | 3300042643 | Ga0466704_260073 | Ga0466704_260073_4269_5684 | 471 |
| 147 | 3300042590 | Ga0466690_196376 | Ga0466690_196376_12406_13824 | 472 |
| 148 | 3300042591 | Ga0466692_176518 | Ga0466692_176518_15954_17372 | 472 |
| 149 | 3300042596 | Ga0466696_272280 | Ga0466696_272280_498_1916 | 472 |
| 150 | 3300042600 | Ga0466700_274743 | Ga0466700_274743_8294_9712 | 472 |
| 151 | 3300042606 | Ga0466719_222496 | Ga0466719_222496_358_1776 | 472 |
| 152 | 3300042652 | Ga0466708_094726 | Ga0466708_094726_2840_4258 | 472 |
| 153 | 3300042655 | Ga0466727_319110 | Ga0466727_319110_865_2283 | 472 |
| 154 | iso_pr_bacteria | 2940216256 | 2940217739 | 472 |
| 155 | 3300042599 | Ga0466706_286334 | Ga0466706_286334_16442_17863 | 473 |
| 156 | 3300042602 | Ga0466713_023349 | Ga0466713_023349_42164_43585 | 473 |
| 157 | 3300042619 | Ga0466726_347450 | Ga0466726_347450_24044_25465 | 473 |
| 158 | 3300042621 | Ga0466729_279151 | Ga0466729_279151_2754_4175 | 473 |
| 159 | 3300042624 | Ga0466735_073305 | Ga0466735_073305_797_2218 | 473 |
| 160 | 3300042655 | Ga0466727_253174 | Ga0466727_253174_12340_13761 | 473 |
| 161 | 2225789004 | 2227557982 | 2228092778 | 474 |
| 162 | 3300042590 | Ga0466690_420451 | Ga0466690_420451_29454_30965 | 503 |
| 163 | 3300002462 | JGI24702J35022_10000101 | JGI24702J35022_1000010116 | 505 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02397 | Bac_transf | Bacterial sugar transferase | 317 | 499 | 0.96 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.81 | 0.86 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.