Protein Family IF00731

Metagenome Isolate
163 Members
59 Samples
145 Scaffolds
458.41 Avg Length

🧬 Representative Sequence

ID
3300002462|JGI24702J35022_10000101|JGI24702J35022_1000010116
Length
505 aa
Sequence
MQYVEKNPRRGDALLTAGTTNGKMNKSRLRTIYIGIDFLSAAITWFLFNLLRYSEVAKYEFGTLPDFLLYAQVVKGQIMVPLFWLWLYFLSGYYNKPFGKSRIGELFSTVITVVIGSIIIFFRVVLNELPPSFDVYYRFFFSLCLMQFVLTYTGRSLITGYAIRKSKSREWVENVLIVGTGKEAVKVRQFLEESGYHIVGFVEEGGFDGQSGIAQEDGFADKNVMTVSPYVDPQEIAGTIDSIPEILQRYKVDEIVVAVKGLEVVNLLYQFYRYRLPVKVLADKKNFLSKAKVSAIGGIPLIDITENNFSEAEKNIKWFLDKVVSVSILLLFSPLYAYIAVRVKFTSQGPVFFRQERIGYRGKPFRIYKFRTMFKEASEEGPLLTARDDKRVTPFGRFLRKYRLDEIPQFWNVLCGDMSLVGPRPEQRYYIEQIVRKAPYYYLLHNVRPGITSWGMVKYGYAETVDKMIERLDYDILYYENMSLALDIKILIYTVQIVLSGKGV*

📊 Sample Types

Isolate 11.0%
Metagenome 89.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 30.5%
Termitidae 23.7%
Kalotermitidae 23.7%
Termopsidae 6.8%
Rhinotermitidae 5.1%
Unclassified 5.1%
Passalidae 3.4%
Hodotermitidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 161
Eukaryota 0
Viruses 0
Unclassified 2

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
2 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
3 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
4 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
5 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
6 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
7 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
8 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
9 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
10 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
13 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
14 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
15 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
16 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
17 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
18 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
19 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
20 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
21 2923982719 Parabacteroides sp. 52 Isolate Blattidae
22 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
23 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
24 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
25 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
26 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
27 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
28 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
29 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
30 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
31 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
32 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
33 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
34 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
35 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
36 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
37 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
38 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
39 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
40 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
41 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
42 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
43 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
44 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
45 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
46 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
47 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
48 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
49 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
50 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
51 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
52 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
53 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
54 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
55 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
56 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
57 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
58 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
59 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_162634 3300042659 Bacteria 12785
2 Ga0466701_015411 3300042598 Bacteria 14183
3 Ga0466729_279151 3300042621 Bacteria 6672
4 Ga0466731_313268 3300042622 Bacteria 2143
5 Ga0466734_128814 3300042623 Bacteria 3780
6 Ga0466709_305645 3300042648 Bacteria 7160
7 Ga0466727_026697 3300042655 Bacteria 7386
8 Ga0466716_128130 3300042605 Bacteria 17659
9 Ga0466698_444636 3300042610 Bacteria 4812
10 Ga0466728_407647 3300042620 Unclassified 2203
11 2227521841 2225789004 Bacteria 17301
12 2227535756 2225789004 Bacteria 15976
13 Ga0123354_10131428 3300010882 Bacteria 3160
14 Ga0466692_046708 3300042591 Bacteria 150257
15 Ga0466692_131231 3300042591 Bacteria 18041
16 Ga0466703_008146 3300042636 Bacteria 15713
17 Ga0466704_260073 3300042643 Bacteria 23800
18 Ga0466709_326163 3300042648 Bacteria 6796
19 Ga0466708_094726 3300042652 Bacteria 14644
20 Ga0466706_286334 3300042599 Bacteria 25445
21 Ga0466713_026107 3300042602 Bacteria 57287
22 Ga0466715_508909 3300042616 Bacteria 1429
23 Ga0466728_456442 3300042620 Bacteria 3566
24 JGI24702J35022_10000101 3300002462 Bacteria 39658
25 JGI24702J35022_10076727 3300002462 Bacteria 1806
26 Ga0466690_196376 3300042590 Bacteria 23671
27 Ga0466691_018454 3300042593 Bacteria 13898
28 Ga0466696_169181 3300042596 Bacteria 3472
29 Ga0466734_098282 3300042623 Bacteria 1929
30 Ga0466709_205828 3300042648 Bacteria 3353
31 Ga0466727_125117 3300042655 Bacteria 15260
32 Ga0466700_274743 3300042600 Bacteria 43717
33 Ga0466713_016495 3300042602 Bacteria 11751
34 Ga0466713_029979 3300042602 Bacteria 8074
35 Ga0466713_044677 3300042602 Bacteria 5655
36 Ga0466716_529253 3300042605 Bacteria 8438
37 Ga0466719_090088 3300042606 Bacteria 4118
38 Ga0466719_103315 3300042606 Bacteria 6695
39 Ga0466722_037431 3300042609 Bacteria 3470
40 Ga0466722_111324 3300042609 Bacteria 4470
41 Ga0466711_303713 3300042615 Bacteria 13880
42 Ga0466715_037900 3300042616 Bacteria 143938
43 Ga0466715_188206 3300042616 Bacteria 3088
44 Ga0466723_099232 3300042618 Bacteria 25745
45 Ga0466723_287832 3300042618 Bacteria 14308
46 Ga0466723_313673 3300042618 Bacteria 69196
47 Ga0466726_347450 3300042619 Bacteria 33335
48 2227557982 2225789004 Bacteria 2759
49 JGI24702J35022_10037578 3300002462 Bacteria 2586
50 Ga0068302_10058357 3300005071 Bacteria 3907
51 Ga0466705_132638 3300042612 Bacteria 9271
52 Ga0466656_024313 3300042550 Bacteria 12527
53 Ga0466691_181565 3300042593 Bacteria 12450
54 Ga0466696_010174 3300042596 Bacteria 34499
55 Ga0466696_027471 3300042596 Bacteria 17440
56 Ga0466735_073305 3300042624 Bacteria 2967
57 Ga0466709_124532 3300042648 Bacteria 22970
58 Ga0466708_358292 3300042652 Bacteria 25849
59 Ga0466727_125377 3300042655 Bacteria 24351
60 Ga0466727_253174 3300042655 Bacteria 42635
61 Ga0466727_266797 3300042655 Bacteria 6334
62 Ga0466706_100423 3300042599 Bacteria 7026
63 Ga0466700_197280 3300042600 Bacteria 4449
64 Ga0466713_125564 3300042602 Bacteria 27296
65 Ga0466717_262390 3300042604 Bacteria 2615
66 Ga0466723_281682 3300042618 Bacteria 37853
67 IMNBL1DRAFT_c0000622 3300000062 Bacteria 28309
68 JGI24699J35502_11134232 3300002509 Bacteria 111679
69 Ga0068305_10045344 3300005083 Bacteria 18638
70 Ga0068305_10418114 3300005083 Unclassified 8113
71 Ga0123357_10086801 3300009784 Bacteria 4094
72 Ga0123357_10090935 3300009784 Bacteria 3978
73 Ga0466690_420451 3300042590 Bacteria 55352
74 Ga0466692_112545 3300042591 Bacteria 4840
75 Ga0466696_026702 3300042596 Bacteria 3813
76 Ga0466735_025370 3300042624 Bacteria 12705
77 Ga0466704_115064 3300042643 Bacteria 4076
78 Ga0466709_086977 3300042648 Bacteria 21198
79 Ga0466708_403808 3300042652 Bacteria 9710
80 Ga0466713_041641 3300042602 Bacteria 16534
81 Ga0466715_003405 3300042616 Bacteria 6206
82 Ga0466715_077049 3300042616 Bacteria 2313
83 2227630470 2225789004 Bacteria 2126
84 IMNBL1DRAFT_c0000089 3300000062 Bacteria 79556
85 Ga0466705_000228 3300042612 Bacteria 13423
86 Ga0466705_116292 3300042612 Bacteria 6155
87 Ga0466733_038286 3300042659 Bacteria 266317
88 Ga0466690_030608 3300042590 Bacteria 6157
89 Ga0466691_003181 3300042593 Bacteria 28797
90 Ga0466696_297169 3300042596 Bacteria 7644
91 Ga0466708_086991 3300042652 Bacteria 84818
92 Ga0466727_067522 3300042655 Bacteria 4550
93 Ga0466727_069058 3300042655 Bacteria 20083
94 Ga0466707_147134 3300042601 Bacteria 4178
95 Ga0466713_023349 3300042602 Bacteria 47416
96 Ga0466716_483383 3300042605 Bacteria 3173
97 Ga0466719_025259 3300042606 Bacteria 5069
98 Ga0466719_222496 3300042606 Bacteria 2277
99 Ga0466719_563489 3300042606 Bacteria 4925
100 Ga0466722_085305 3300042609 Bacteria 8822
101 Ga0466705_447381 3300042612 Bacteria 3877
102 Ga0466711_234013 3300042615 Bacteria 5771
103 Ga0466715_026564 3300042616 Bacteria 24516
104 Ga0466726_392655 3300042619 Bacteria 5142
105 IMNBL1DRAFT_c0006155 3300000062 Bacteria 6632
106 JGI24702J35022_10045977 3300002462 Bacteria 2325
107 Ga0068305_10043541 3300005083 Bacteria 24254
108 Ga0123357_10053839 3300009784 Bacteria 5428
109 Ga0466690_130405 3300042590 Bacteria 17175
110 Ga0466692_044459 3300042591 Bacteria 6470
111 Ga0466692_176518 3300042591 Bacteria 19183
112 Ga0466696_237950 3300042596 Bacteria 8488
113 Ga0466735_073233 3300042624 Bacteria 2518
114 Ga0466703_260219 3300042636 Bacteria 7889
115 Ga0466703_343349 3300042636 Bacteria 6769
116 Ga0466703_415408 3300042636 Bacteria 4807
117 Ga0466725_174101 3300042654 Bacteria 15697
118 Ga0466727_072896 3300042655 Bacteria 3660
119 Ga0466713_118280 3300042602 Bacteria 6295
120 Ga0466716_183262 3300042605 Bacteria 30600
121 Ga0466716_461665 3300042605 Bacteria 14636
122 Ga0466711_221277 3300042615 Bacteria 13189
123 Ga0466715_525875 3300042616 Bacteria 7148
124 Ga0466728_356610 3300042620 Bacteria 4592
125 IMNBL1DRAFT_c0000827 3300000062 Bacteria 24404
126 IMNBL1DRAFT_c0001549 3300000062 Bacteria 17157
127 JGI24702J35022_10003733 3300002462 Bacteria 9152
128 JGI24702J35022_10005531 3300002462 Bacteria 7367
129 JGI24705J35276_12238189 3300002504 Bacteria 17050
130 Ga0466733_192802 3300042659 Bacteria 54728
131 Ga0123357_10146408 3300009784 Bacteria 2883
132 Ga0466690_398823 3300042590 Bacteria 4098
133 Ga0466692_036236 3300042591 Bacteria 19554
134 Ga0466696_272280 3300042596 Bacteria 5143
135 Ga0466703_086275 3300042636 Bacteria 16351
136 Ga0466704_055783 3300042643 Bacteria 11258
137 Ga0466704_123070 3300042643 Bacteria 36133
138 Ga0466704_145846 3300042643 Bacteria 11150
139 Ga0466727_319110 3300042655 Bacteria 3208
140 Ga0466707_366508 3300042601 Bacteria 2094
141 Ga0466713_051716 3300042602 Bacteria 14617
142 Ga0466719_358095 3300042606 Bacteria 26180
143 Ga0466723_299222 3300042618 Bacteria 28350
144 Ga0466726_123657 3300042619 Bacteria 3931
145 JGI24702J35022_10006038 3300002462 Bacteria 7028

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042596 Ga0466696_027471 Ga0466696_027471_8776_10173 411
2 3300042622 Ga0466731_313268 Ga0466731_313268_51_1298 415
3 3300042616 Ga0466715_525875 Ga0466715_525875_5390_6730 418
4 3300042591 Ga0466692_131231 Ga0466692_131231_4960_6255 423
5 3300042616 Ga0466715_508909 Ga0466715_508909_79_1404 427
6 3300042623 Ga0466734_128814 Ga0466734_128814_1654_3072 431
7 3300042612 Ga0466705_447381 Ga0466705_447381_693_2081 436
8 3300009784 Ga0123357_10146408 Ga0123357_101464082 438
9 3300010882 Ga0123354_10131428 Ga0123354_101314282 438
10 3300042624 Ga0466735_073233 Ga0466735_073233_221_1618 438
11 3300042606 Ga0466719_563489 Ga0466719_563489_814_2133 439
12 3300042618 Ga0466723_281682 Ga0466723_281682_32427_33767 439
13 3300042604 Ga0466717_262390 Ga0466717_262390_509_1909 440
14 3300042655 Ga0466727_069058 Ga0466727_069058_8147_9469 440
15 3300042620 Ga0466728_356610 Ga0466728_356610_2137_3492 441
16 3300042600 Ga0466700_197280 Ga0466700_197280_2399_3799 442
17 3300000062 IMNBL1DRAFT_c0001549 IMNBL1DRAFT_00015497 444
18 3300042591 Ga0466692_044459 Ga0466692_044459_2334_3707 444
19 3300042598 Ga0466701_015411 Ga0466701_015411_920_2338 444
20 3300042609 Ga0466722_085305 Ga0466722_085305_5395_6780 444
21 3300042623 Ga0466734_098282 Ga0466734_098282_469_1869 444
22 3300005083 Ga0068305_10043541 Ga0068305_1004354116 445
23 3300009784 Ga0123357_10090935 Ga0123357_100909352 445
24 3300042596 Ga0466696_297169 Ga0466696_297169_3201_4643 445
25 3300042618 Ga0466723_287832 Ga0466723_287832_3809_5227 445
26 3300042643 Ga0466704_055783 Ga0466704_055783_4685_6103 445
27 3300000062 IMNBL1DRAFT_c0000089 IMNBL1DRAFT_000008917 446
28 3300002462 JGI24702J35022_10003733 JGI24702J35022_1000373311 446
29 3300042591 Ga0466692_036236 Ga0466692_036236_11056_12456 446
30 3300042601 Ga0466707_147134 Ga0466707_147134_1999_3339 446
31 3300042618 Ga0466723_299222 Ga0466723_299222_24544_25926 446
32 3300005083 Ga0068305_10418114 Ga0068305_104181145 447
33 3300042609 Ga0466722_037431 Ga0466722_037431_1143_2543 447
34 3300042659 Ga0466733_038286 Ga0466733_038286_65178_66578 447
35 3300002504 JGI24705J35276_12238189 JGI24705J35276_122381894 448
36 3300042602 Ga0466713_125564 Ga0466713_125564_15545_16891 448
37 3300042606 Ga0466719_103315 Ga0466719_103315_2111_3511 448
38 3300042620 Ga0466728_456442 Ga0466728_456442_1865_3265 448
39 3300000062 IMNBL1DRAFT_c0000622 IMNBL1DRAFT_000062219 449
40 3300042615 Ga0466711_303713 Ga0466711_303713_8691_10091 449
41 3300042602 Ga0466713_041641 Ga0466713_041641_5578_6951 450
42 3300009784 Ga0123357_10086801 Ga0123357_100868013 451
43 3300042612 Ga0466705_000228 Ga0466705_000228_6183_7601 451
44 3300042618 Ga0466723_313673 Ga0466723_313673_29330_30685 451
45 3300042636 Ga0466703_343349 Ga0466703_343349_2284_3684 451
46 3300042643 Ga0466704_123070 Ga0466704_123070_2358_3782 451
47 3300042643 Ga0466704_145846 Ga0466704_145846_4522_5916 451
48 3300042648 Ga0466709_086977 Ga0466709_086977_4332_5687 451
49 3300042655 Ga0466727_067522 Ga0466727_067522_2356_3726 451
50 3300042659 Ga0466733_192802 Ga0466733_192802_32147_33541 451
51 3300042602 Ga0466713_044677 Ga0466713_044677_3855_5252 452
52 3300042654 Ga0466725_174101 Ga0466725_174101_6586_7986 452
53 3300042596 Ga0466696_026702 Ga0466696_026702_1930_3327 453
54 3300042605 Ga0466716_128130 Ga0466716_128130_2284_3684 453
55 3300042612 Ga0466705_116292 Ga0466705_116292_3099_4493 453
56 3300042616 Ga0466715_003405 Ga0466715_003405_2743_4104 453
57 3300042619 Ga0466726_392655 Ga0466726_392655_2457_3857 453
58 3300042590 Ga0466690_398823 Ga0466690_398823_1750_3150 454
59 3300042596 Ga0466696_169181 Ga0466696_169181_1586_2986 454
60 3300042591 Ga0466692_112545 Ga0466692_112545_1592_2959 455
61 3300042636 Ga0466703_086275 Ga0466703_086275_461_1882 455
62 3300042590 Ga0466690_030608 Ga0466690_030608_1973_3376 456
63 3300042609 Ga0466722_111324 Ga0466722_111324_353_1753 456
64 2225789004 2227630470 2228214418 457
65 3300000062 IMNBL1DRAFT_c0006155 IMNBL1DRAFT_00061554 457
66 3300002462 JGI24702J35022_10045977 JGI24702J35022_100459771 458
67 3300002509 JGI24699J35502_11134232 JGI24699J35502_1113423284 458
68 3300042602 Ga0466713_029979 Ga0466713_029979_6408_7787 459
69 3300002462 JGI24702J35022_10005531 JGI24702J35022_100055313 460
70 3300042652 Ga0466708_358292 Ga0466708_358292_10622_12004 460
71 3300042655 Ga0466727_026697 Ga0466727_026697_4525_5940 460
72 3300002462 JGI24702J35022_10006038 JGI24702J35022_100060382 461
73 3300042616 Ga0466715_037900 Ga0466715_037900_83795_85225 461
74 3300042648 Ga0466709_124532 Ga0466709_124532_16875_18287 461
75 2225789004 2227521841 2228025772 462
76 3300042643 Ga0466704_115064 Ga0466704_115064_1760_3148 462
77 3300042655 Ga0466727_072896 Ga0466727_072896_1706_3094 462
78 3300000062 IMNBL1DRAFT_c0000827 IMNBL1DRAFT_000082710 463
79 3300002462 JGI24702J35022_10037578 JGI24702J35022_100375782 463
80 3300005071 Ga0068302_10058357 Ga0068302_100583572 463
81 3300042601 Ga0466707_366508 Ga0466707_366508_150_1541 463
82 3300042602 Ga0466713_118280 Ga0466713_118280_3846_5261 463
83 3300042610 Ga0466698_444636 Ga0466698_444636_291_1682 463
84 3300002462 JGI24702J35022_10076727 JGI24702J35022_100767272 464
85 3300042593 Ga0466691_003181 Ga0466691_003181_23363_24757 464
86 3300042593 Ga0466691_181565 Ga0466691_181565_2076_3470 464
87 3300042602 Ga0466713_016495 Ga0466713_016495_4701_6095 464
88 3300042648 Ga0466709_305645 Ga0466709_305645_51_1445 464
89 3300042659 Ga0466733_162634 Ga0466733_162634_8142_9536 464
90 2225789004 2227535756 2228053244 465
91 3300042596 Ga0466696_010174 Ga0466696_010174_14665_16062 465
92 3300042615 Ga0466711_221277 Ga0466711_221277_10712_12130 465
93 3300042648 Ga0466709_205828 Ga0466709_205828_1762_3159 465
94 3300042550 Ga0466656_024313 Ga0466656_024313_2756_4156 466
95 3300042591 Ga0466692_046708 Ga0466692_046708_16195_17595 466
96 3300042593 Ga0466691_018454 Ga0466691_018454_8676_10076 466
97 3300042599 Ga0466706_100423 Ga0466706_100423_1964_3364 466
98 3300042602 Ga0466713_026107 Ga0466713_026107_53422_54822 466
99 3300042605 Ga0466716_183262 Ga0466716_183262_14630_16030 466
100 3300042605 Ga0466716_461665 Ga0466716_461665_9349_10749 466
101 3300042605 Ga0466716_483383 Ga0466716_483383_272_1672 466
102 3300042606 Ga0466719_090088 Ga0466719_090088_922_2322 466
103 3300042612 Ga0466705_132638 Ga0466705_132638_5264_6664 466
104 3300042616 Ga0466715_026564 Ga0466715_026564_8719_10119 466
105 3300042618 Ga0466723_099232 Ga0466723_099232_12076_13476 466
106 3300042619 Ga0466726_123657 Ga0466726_123657_1850_3250 466
107 3300042636 Ga0466703_260219 Ga0466703_260219_2038_3438 466
108 3300042636 Ga0466703_415408 Ga0466703_415408_1340_2740 466
109 3300042655 Ga0466727_266797 Ga0466727_266797_3222_4622 466
110 iso_pr_bacteria 2923982719 2923984322 466
111 iso_pr_bacteria 2940199050 2940200819 466
112 iso_pr_bacteria 2940205530 2940205731 466
113 iso_pr_bacteria 2940209341 2940210126 466
114 iso_pr_bacteria 2940212447 2940212648 466
115 iso_pr_bacteria 2940298504 2940298705 466
116 iso_pr_bacteria 2940302308 2940302509 466
117 iso_pr_bacteria 2940306115 2940306638 466
118 iso_pr_bacteria 2940309933 2940310380 466
119 iso_pr_bacteria 2940313741 2940314191 466
120 iso_pr_bacteria 2940317558 2940318005 466
121 iso_pr_bacteria 2940321370 2940321892 466
122 iso_pr_bacteria 2940325180 2940325375 466
123 iso_pr_bacteria 2940328985 2940329181 466
124 iso_pr_bacteria 2940332795 2940333318 466
125 iso_pr_bacteria 2940346213 2940347677 466
126 iso_pr_bacteria 2940371297 2940371997 466
127 3300005083 Ga0068305_10045344 Ga0068305_1004534418 467
128 3300042602 Ga0466713_051716 Ga0466713_051716_8534_9937 467
129 3300042605 Ga0466716_529253 Ga0466716_529253_3987_5390 467
130 3300042606 Ga0466719_358095 Ga0466719_358095_3324_4727 467
131 3300042615 Ga0466711_234013 Ga0466711_234013_3605_5008 467
132 3300042616 Ga0466715_077049 Ga0466715_077049_754_2157 467
133 3300042620 Ga0466728_407647 Ga0466728_407647_275_1693 467
134 3300042624 Ga0466735_025370 Ga0466735_025370_963_2366 467
135 3300042648 Ga0466709_326163 Ga0466709_326163_3046_4449 467
136 3300042652 Ga0466708_086991 Ga0466708_086991_56168_57571 467
137 3300042652 Ga0466708_403808 Ga0466708_403808_6252_7655 467
138 3300042655 Ga0466727_125117 Ga0466727_125117_10781_12184 467
139 3300042596 Ga0466696_237950 Ga0466696_237950_2798_4222 468
140 3300042606 Ga0466719_025259 Ga0466719_025259_814_2220 468
141 3300042616 Ga0466715_188206 Ga0466715_188206_742_2148 468
142 3300042655 Ga0466727_125377 Ga0466727_125377_15825_17231 468
143 3300042636 Ga0466703_008146 Ga0466703_008146_11894_13303 469
144 3300009784 Ga0123357_10053839 Ga0123357_100538394 470
145 3300042590 Ga0466690_130405 Ga0466690_130405_425_1840 471
146 3300042643 Ga0466704_260073 Ga0466704_260073_4269_5684 471
147 3300042590 Ga0466690_196376 Ga0466690_196376_12406_13824 472
148 3300042591 Ga0466692_176518 Ga0466692_176518_15954_17372 472
149 3300042596 Ga0466696_272280 Ga0466696_272280_498_1916 472
150 3300042600 Ga0466700_274743 Ga0466700_274743_8294_9712 472
151 3300042606 Ga0466719_222496 Ga0466719_222496_358_1776 472
152 3300042652 Ga0466708_094726 Ga0466708_094726_2840_4258 472
153 3300042655 Ga0466727_319110 Ga0466727_319110_865_2283 472
154 iso_pr_bacteria 2940216256 2940217739 472
155 3300042599 Ga0466706_286334 Ga0466706_286334_16442_17863 473
156 3300042602 Ga0466713_023349 Ga0466713_023349_42164_43585 473
157 3300042619 Ga0466726_347450 Ga0466726_347450_24044_25465 473
158 3300042621 Ga0466729_279151 Ga0466729_279151_2754_4175 473
159 3300042624 Ga0466735_073305 Ga0466735_073305_797_2218 473
160 3300042655 Ga0466727_253174 Ga0466727_253174_12340_13761 473
161 2225789004 2227557982 2228092778 474
162 3300042590 Ga0466690_420451 Ga0466690_420451_29454_30965 503
163 3300002462 JGI24702J35022_10000101 JGI24702J35022_1000010116 505

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02397 Bac_transf Bacterial sugar transferase 317 499 0.96

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.