Protein Family IF00722
Metagenome
Isolate
137
Members
45
Samples
134
Scaffolds
115.73
Avg Length
Representative Sequence
- ID
- 3300002450|JGI24695J34938_10366281|JGI24695J34938_103662811
- Length
- 137 aa
- Sequence
- MTRGELWWADLGIPFGSEPGYKRPVLIVQNDFLNKSKINTTIVVPLTTNMIFADAPGNILITKSESKLKKDSVITVSQTGVIDRRRIIEKITKLDRALVEKVGNSIMFILGIKELAFELKELAGYFGKPDFNINTD*
Sample Types
Isolate
2.2%
Metagenome
97.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
51.2%
Kalotermitidae
23.3%
Unclassified
11.6%
Rhinotermitidae
7.0%
Termopsidae
4.7%
Hodotermitidae
2.3%
Taxonomy
Archaea
0
Bacteria
130
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 2 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 3 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 4 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 5 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 6 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 7 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 8 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 9 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 10 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 11 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 12 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 13 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 14 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 15 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 16 | 2819990093 | Unclassified Spirochaetes Cu122P1bin9 | Isolate | Unclassified |
| 17 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 18 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 19 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 20 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 21 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 22 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 23 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 24 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 25 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 26 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 27 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 28 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 29 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 30 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 31 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 32 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 33 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 34 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 35 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 36 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 37 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 38 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 39 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 40 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 41 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 42 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 43 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 44 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 45 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_026594 | 3300042659 | Bacteria | 6722 |
| 2 | AustNasuHG_c1016026 | 3300000089 | Bacteria | 2516 |
| 3 | JGI24695J34938_10366281 | 3300002450 | Bacteria | 636 |
| 4 | Ga0466727_114431 | 3300042655 | Bacteria | 1007 |
| 5 | Ga0466712_040091 | 3300042614 | Bacteria | 1314 |
| 6 | Ga0466712_063080 | 3300042614 | Bacteria | 17326 |
| 7 | Ga0466718_019857 | 3300042617 | Bacteria | 20866 |
| 8 | Ga0466694_276012 | 3300042594 | Bacteria | 6080 |
| 9 | Ga0466706_090026 | 3300042599 | Bacteria | 3234 |
| 10 | Ga0466720_024112 | 3300042607 | Bacteria | 4970 |
| 11 | Ga0466720_074504 | 3300042607 | Bacteria | 3061 |
| 12 | Ga0466720_083661 | 3300042607 | Bacteria | 2111 |
| 13 | Ga0466720_184627 | 3300042607 | Bacteria | 6866 |
| 14 | Ga0466722_057734 | 3300042609 | Bacteria | 2326 |
| 15 | Ga0466705_000029 | 3300042612 | Bacteria | 1744 |
| 16 | Ga0466705_241725 | 3300042612 | Bacteria | 6252 |
| 17 | Ga0466733_147731 | 3300042659 | Bacteria | 19381 |
| 18 | JGI24698J34947_10013392 | 3300002449 | Bacteria | 4479 |
| 19 | JGI24702J35022_10372954 | 3300002462 | Bacteria | 857 |
| 20 | Ga0072941_1001794 | 3300005201 | Bacteria | 25495 |
| 21 | Ga0466703_042298 | 3300042636 | Bacteria | 1962 |
| 22 | Ga0466703_387333 | 3300042636 | Bacteria | 4958 |
| 23 | Ga0466712_018575 | 3300042614 | Bacteria | 2229 |
| 24 | Ga0466712_260656 | 3300042614 | Bacteria | 8218 |
| 25 | Ga0466718_065110 | 3300042617 | Bacteria | 1942 |
| 26 | Ga0264413_108510 | 3300024493 | Bacteria | 8548 |
| 27 | Ga0264413_133420 | 3300024493 | Bacteria | 1745 |
| 28 | Ga0466693_265820 | 3300042592 | Bacteria | 2357 |
| 29 | Ga0466694_005431 | 3300042594 | Bacteria | 7536 |
| 30 | Ga0466699_202539 | 3300042597 | Bacteria | 4885 |
| 31 | Ga0466713_143622 | 3300042602 | Bacteria | 2144 |
| 32 | Ga0466720_082576 | 3300042607 | Bacteria | 3703 |
| 33 | Ga0466698_373199 | 3300042610 | Bacteria | 1507 |
| 34 | Ga0466703_180748 | 3300042636 | Bacteria | 1044 |
| 35 | Ga0466704_202258 | 3300042643 | Bacteria | 3748 |
| 36 | Ga0466712_023805 | 3300042614 | Unclassified | 2079 |
| 37 | Ga0466712_070207 | 3300042614 | Bacteria | 9747 |
| 38 | Ga0466712_125640 | 3300042614 | Bacteria | 21364 |
| 39 | Ga0466692_035848 | 3300042591 | Bacteria | 1806 |
| 40 | Ga0466696_112706 | 3300042596 | Bacteria | 1410 |
| 41 | Ga0466699_271155 | 3300042597 | Bacteria | 1648 |
| 42 | Ga0466707_338242 | 3300042601 | Bacteria | 2508 |
| 43 | JGI24698J34947_10012873 | 3300002449 | Unclassified | 4572 |
| 44 | JGI24698J34947_10343667 | 3300002449 | Bacteria | 524 |
| 45 | Ga0072941_1052635 | 3300005201 | Bacteria | 3493 |
| 46 | Ga0466729_251945 | 3300042621 | Unclassified | 1871 |
| 47 | Ga0466731_147245 | 3300042622 | Unclassified | 4512 |
| 48 | Ga0466703_420029 | 3300042636 | Bacteria | 1073 |
| 49 | Ga0466704_337162 | 3300042643 | Bacteria | 16874 |
| 50 | Ga0466727_180297 | 3300042655 | Bacteria | 1225 |
| 51 | Ga0466712_183038 | 3300042614 | Bacteria | 13978 |
| 52 | Ga0466718_118062 | 3300042617 | Bacteria | 4207 |
| 53 | Ga0466726_336630 | 3300042619 | Bacteria | 1143 |
| 54 | Ga0466726_435955 | 3300042619 | Bacteria | 1358 |
| 55 | Ga0466729_044860 | 3300042621 | Bacteria | 1070 |
| 56 | Ga0466690_329811 | 3300042590 | Bacteria | 1885 |
| 57 | Ga0466693_439584 | 3300042592 | Bacteria | 1642 |
| 58 | Ga0466694_063382 | 3300042594 | Bacteria | 1554 |
| 59 | Ga0466694_088094 | 3300042594 | Bacteria | 2251 |
| 60 | Ga0466707_419425 | 3300042601 | Bacteria | 1815 |
| 61 | Ga0466720_164363 | 3300042607 | Bacteria | 7880 |
| 62 | Ga0466698_040723 | 3300042610 | Bacteria | 18025 |
| 63 | Ga0466705_081737 | 3300042612 | Bacteria | 1135 |
| 64 | Ga0466732_009711 | 3300042656 | Bacteria | 2117 |
| 65 | JGI24698J34947_10027816 | 3300002449 | Bacteria | 2999 |
| 66 | JGI24695J34938_10119061 | 3300002450 | Bacteria | 1075 |
| 67 | Ga0072941_1002667 | 3300005201 | Bacteria | 17091 |
| 68 | Ga0466731_387989 | 3300042622 | Bacteria | 1106 |
| 69 | Ga0466712_010872 | 3300042614 | Bacteria | 1474 |
| 70 | Ga0466712_243785 | 3300042614 | Bacteria | 2142 |
| 71 | Ga0466718_086922 | 3300042617 | Bacteria | 3115 |
| 72 | Ga0466696_269780 | 3300042596 | Bacteria | 1862 |
| 73 | Ga0466701_035838 | 3300042598 | Bacteria | 1054 |
| 74 | Ga0466707_108760 | 3300042601 | Bacteria | 1300 |
| 75 | Ga0466722_163017 | 3300042609 | Bacteria | 2513 |
| 76 | Ga0123356_10050413 | 3300010049 | Bacteria | 3873 |
| 77 | Ga0466705_080371 | 3300042612 | Bacteria | 3684 |
| 78 | Ga0466732_023663 | 3300042656 | Bacteria | 2936 |
| 79 | Ga0466732_148116 | 3300042656 | Bacteria | 3033 |
| 80 | Ga0466732_236521 | 3300042656 | Bacteria | 2421 |
| 81 | Nasutiter_Contig31672 | 2030936001 | Bacteria | 757 |
| 82 | JGI24698J34947_10190270 | 3300002449 | Unclassified | 812 |
| 83 | JGI24702J35022_10063243 | 3300002462 | Bacteria | 1982 |
| 84 | Ga0072940_1029359 | 3300005200 | Bacteria | 4505 |
| 85 | Ga0072940_1293355 | 3300005200 | Bacteria | 1239 |
| 86 | Ga0466727_274646 | 3300042655 | Bacteria | 1775 |
| 87 | Ga0466712_017799 | 3300042614 | Bacteria | 8379 |
| 88 | Ga0466712_118570 | 3300042614 | Bacteria | 1516 |
| 89 | Ga0466712_177203 | 3300042614 | Bacteria | 1902 |
| 90 | Ga0466718_017547 | 3300042617 | Bacteria | 1098 |
| 91 | Ga0466726_357034 | 3300042619 | Bacteria | 1304 |
| 92 | Ga0264413_145239 | 3300024493 | Bacteria | 1086 |
| 93 | Ga0466695_094797 | 3300042595 | Bacteria | 1515 |
| 94 | Ga0466707_345244 | 3300042601 | Unclassified | 2183 |
| 95 | Ga0466707_394391 | 3300042601 | Bacteria | 1583 |
| 96 | Ga0466717_152632 | 3300042604 | Bacteria | 2821 |
| 97 | Ga0466717_301998 | 3300042604 | Bacteria | 1618 |
| 98 | Ga0466716_181261 | 3300042605 | Bacteria | 1107 |
| 99 | Ga0466719_553652 | 3300042606 | Bacteria | 2714 |
| 100 | Ga0466720_092079 | 3300042607 | Bacteria | 1922 |
| 101 | Ga0466720_170097 | 3300042607 | Bacteria | 1938 |
| 102 | Ga0466698_057226 | 3300042610 | Bacteria | 1625 |
| 103 | Ga0466732_046835 | 3300042656 | Bacteria | 4552 |
| 104 | Ga0466732_113386 | 3300042656 | Bacteria | 6578 |
| 105 | Ga0466732_287573 | 3300042656 | Bacteria | 1241 |
| 106 | Ga0466733_035241 | 3300042659 | Bacteria | 1432 |
| 107 | Ga0466733_185067 | 3300042659 | Bacteria | 39045 |
| 108 | JGI24698J34947_10099796 | 3300002449 | Bacteria | 1308 |
| 109 | JGI24698J34947_10129597 | 3300002449 | Bacteria | 1080 |
| 110 | Ga0072941_1039239 | 3300005201 | Bacteria | 17770 |
| 111 | Ga0466704_483005 | 3300042643 | Unclassified | 1169 |
| 112 | Ga0466727_263597 | 3300042655 | Bacteria | 12218 |
| 113 | Ga0466711_023306 | 3300042615 | Bacteria | 21263 |
| 114 | Ga0466718_079063 | 3300042617 | Bacteria | 2539 |
| 115 | Ga0466718_114910 | 3300042617 | Bacteria | 12848 |
| 116 | Ga0466723_064647 | 3300042618 | Bacteria | 11362 |
| 117 | Ga0466693_189429 | 3300042592 | Bacteria | 1460 |
| 118 | Ga0466695_297536 | 3300042595 | Bacteria | 1249 |
| 119 | Ga0466700_380993 | 3300042600 | Bacteria | 1069 |
| 120 | Ga0466700_440047 | 3300042600 | Bacteria | 1806 |
| 121 | Ga0466720_065521 | 3300042607 | Bacteria | 16476 |
| 122 | Ga0466720_067716 | 3300042607 | Bacteria | 1189 |
| 123 | Ga0466722_072712 | 3300042609 | Bacteria | 1289 |
| 124 | Ga0123356_10592372 | 3300010049 | Bacteria | 1273 |
| 125 | Ga0123356_13008842 | 3300010049 | Bacteria | 588 |
| 126 | Ga0466732_088693 | 3300042656 | Bacteria | 3341 |
| 127 | Ga0466732_108607 | 3300042656 | Bacteria | 1822 |
| 128 | Ga0466732_138023 | 3300042656 | Bacteria | 4930 |
| 129 | JGI24698J34947_10005462 | 3300002449 | Bacteria | 6977 |
| 130 | Ga0466702_231122 | 3300042635 | Bacteria | 2272 |
| 131 | Ga0466703_247878 | 3300042636 | Bacteria | 13092 |
| 132 | Ga0466729_004021 | 3300042621 | Bacteria | 1090 |
| 133 | Ga0466691_081871 | 3300042593 | Bacteria | 2082 |
| 134 | Ga0466720_163714 | 3300042607 | Bacteria | 2707 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042619 | Ga0466726_435955 | Ga0466726_435955_279_614 | 111 |
| 2 | 3300042599 | Ga0466706_090026 | Ga0466706_090026_331_669 | 112 |
| 3 | 3300042636 | Ga0466703_387333 | Ga0466703_387333_3366_3704 | 112 |
| 4 | 3300002450 | JGI24695J34938_10119061 | JGI24695J34938_101190611 | 113 |
| 5 | 3300042590 | Ga0466690_329811 | Ga0466690_329811_1095_1436 | 113 |
| 6 | 3300042607 | Ga0466720_164363 | Ga0466720_164363_7398_7739 | 113 |
| 7 | 3300042659 | Ga0466733_185067 | Ga0466733_185067_8969_9310 | 113 |
| 8 | 3300042594 | Ga0466694_005431 | Ga0466694_005431_7137_7481 | 114 |
| 9 | 3300042607 | Ga0466720_163714 | Ga0466720_163714_2070_2414 | 114 |
| 10 | 3300042614 | Ga0466712_040091 | Ga0466712_040091_338_682 | 114 |
| 11 | 3300042655 | Ga0466727_180297 | Ga0466727_180297_701_1045 | 114 |
| 12 | 3300042655 | Ga0466727_263597 | Ga0466727_263597_671_1015 | 114 |
| 13 | 2030936001 | Nasutiter_Contig31672 | Nasutiterm_830600 | 115 |
| 14 | 3300002449 | JGI24698J34947_10012873 | JGI24698J34947_100128738 | 115 |
| 15 | 3300002449 | JGI24698J34947_10013392 | JGI24698J34947_100133926 | 115 |
| 16 | 3300010049 | Ga0123356_13008842 | Ga0123356_130088422 | 115 |
| 17 | 3300024493 | Ga0264413_108510 | Ga0264413_1085108 | 115 |
| 18 | 3300024493 | Ga0264413_145239 | Ga0264413_1452393 | 115 |
| 19 | 3300042592 | Ga0466693_189429 | Ga0466693_189429_634_981 | 115 |
| 20 | 3300042592 | Ga0466693_265820 | Ga0466693_265820_257_604 | 115 |
| 21 | 3300042592 | Ga0466693_439584 | Ga0466693_439584_67_414 | 115 |
| 22 | 3300042593 | Ga0466691_081871 | Ga0466691_081871_1405_1752 | 115 |
| 23 | 3300042594 | Ga0466694_088094 | Ga0466694_088094_617_964 | 115 |
| 24 | 3300042594 | Ga0466694_276012 | Ga0466694_276012_2350_2697 | 115 |
| 25 | 3300042595 | Ga0466695_094797 | Ga0466695_094797_1065_1412 | 115 |
| 26 | 3300042596 | Ga0466696_112706 | Ga0466696_112706_799_1146 | 115 |
| 27 | 3300042596 | Ga0466696_269780 | Ga0466696_269780_354_701 | 115 |
| 28 | 3300042597 | Ga0466699_202539 | Ga0466699_202539_2385_2732 | 115 |
| 29 | 3300042597 | Ga0466699_271155 | Ga0466699_271155_1221_1568 | 115 |
| 30 | 3300042600 | Ga0466700_380993 | Ga0466700_380993_650_997 | 115 |
| 31 | 3300042600 | Ga0466700_440047 | Ga0466700_440047_762_1109 | 115 |
| 32 | 3300042601 | Ga0466707_338242 | Ga0466707_338242_669_1016 | 115 |
| 33 | 3300042601 | Ga0466707_345244 | Ga0466707_345244_1668_2015 | 115 |
| 34 | 3300042601 | Ga0466707_394391 | Ga0466707_394391_123_470 | 115 |
| 35 | 3300042601 | Ga0466707_419425 | Ga0466707_419425_815_1162 | 115 |
| 36 | 3300042602 | Ga0466713_143622 | Ga0466713_143622_1234_1581 | 115 |
| 37 | 3300042604 | Ga0466717_152632 | Ga0466717_152632_619_966 | 115 |
| 38 | 3300042604 | Ga0466717_301998 | Ga0466717_301998_741_1088 | 115 |
| 39 | 3300042605 | Ga0466716_181261 | Ga0466716_181261_396_743 | 115 |
| 40 | 3300042606 | Ga0466719_553652 | Ga0466719_553652_1985_2332 | 115 |
| 41 | 3300042607 | Ga0466720_065521 | Ga0466720_065521_5104_5451 | 115 |
| 42 | 3300042607 | Ga0466720_074504 | Ga0466720_074504_2318_2665 | 115 |
| 43 | 3300042607 | Ga0466720_184627 | Ga0466720_184627_1024_1371 | 115 |
| 44 | 3300042609 | Ga0466722_057734 | Ga0466722_057734_920_1267 | 115 |
| 45 | 3300042609 | Ga0466722_072712 | Ga0466722_072712_99_446 | 115 |
| 46 | 3300042609 | Ga0466722_163017 | Ga0466722_163017_666_1013 | 115 |
| 47 | 3300042610 | Ga0466698_040723 | Ga0466698_040723_7646_7993 | 115 |
| 48 | 3300042610 | Ga0466698_057226 | Ga0466698_057226_1114_1461 | 115 |
| 49 | 3300042610 | Ga0466698_373199 | Ga0466698_373199_273_620 | 115 |
| 50 | 3300042612 | Ga0466705_000029 | Ga0466705_000029_947_1294 | 115 |
| 51 | 3300042612 | Ga0466705_080371 | Ga0466705_080371_3061_3408 | 115 |
| 52 | 3300042612 | Ga0466705_081737 | Ga0466705_081737_28_375 | 115 |
| 53 | 3300042612 | Ga0466705_241725 | Ga0466705_241725_4224_4571 | 115 |
| 54 | 3300042614 | Ga0466712_010872 | Ga0466712_010872_1100_1447 | 115 |
| 55 | 3300042614 | Ga0466712_017799 | Ga0466712_017799_2016_2363 | 115 |
| 56 | 3300042614 | Ga0466712_018575 | Ga0466712_018575_1176_1523 | 115 |
| 57 | 3300042614 | Ga0466712_023805 | Ga0466712_023805_36_383 | 115 |
| 58 | 3300042614 | Ga0466712_063080 | Ga0466712_063080_12751_13098 | 115 |
| 59 | 3300042614 | Ga0466712_070207 | Ga0466712_070207_6771_7118 | 115 |
| 60 | 3300042614 | Ga0466712_118570 | Ga0466712_118570_233_580 | 115 |
| 61 | 3300042614 | Ga0466712_125640 | Ga0466712_125640_996_1343 | 115 |
| 62 | 3300042614 | Ga0466712_177203 | Ga0466712_177203_643_990 | 115 |
| 63 | 3300042614 | Ga0466712_183038 | Ga0466712_183038_1677_2024 | 115 |
| 64 | 3300042614 | Ga0466712_243785 | Ga0466712_243785_887_1234 | 115 |
| 65 | 3300042615 | Ga0466711_023306 | Ga0466711_023306_18799_19146 | 115 |
| 66 | 3300042617 | Ga0466718_017547 | Ga0466718_017547_530_877 | 115 |
| 67 | 3300042617 | Ga0466718_019857 | Ga0466718_019857_13087_13434 | 115 |
| 68 | 3300042617 | Ga0466718_065110 | Ga0466718_065110_1442_1789 | 115 |
| 69 | 3300042617 | Ga0466718_079063 | Ga0466718_079063_887_1234 | 115 |
| 70 | 3300042617 | Ga0466718_086922 | Ga0466718_086922_1846_2193 | 115 |
| 71 | 3300042617 | Ga0466718_114910 | Ga0466718_114910_11734_12081 | 115 |
| 72 | 3300042617 | Ga0466718_118062 | Ga0466718_118062_285_632 | 115 |
| 73 | 3300042618 | Ga0466723_064647 | Ga0466723_064647_8999_9346 | 115 |
| 74 | 3300042619 | Ga0466726_336630 | Ga0466726_336630_497_844 | 115 |
| 75 | 3300042619 | Ga0466726_357034 | Ga0466726_357034_376_723 | 115 |
| 76 | 3300042621 | Ga0466729_004021 | Ga0466729_004021_377_724 | 115 |
| 77 | 3300042621 | Ga0466729_044860 | Ga0466729_044860_469_816 | 115 |
| 78 | 3300042621 | Ga0466729_251945 | Ga0466729_251945_1443_1790 | 115 |
| 79 | 3300042622 | Ga0466731_147245 | Ga0466731_147245_2779_3126 | 115 |
| 80 | 3300042622 | Ga0466731_387989 | Ga0466731_387989_473_820 | 115 |
| 81 | 3300042635 | Ga0466702_231122 | Ga0466702_231122_639_986 | 115 |
| 82 | 3300042636 | Ga0466703_180748 | Ga0466703_180748_541_888 | 115 |
| 83 | 3300042636 | Ga0466703_247878 | Ga0466703_247878_12530_12877 | 115 |
| 84 | 3300042636 | Ga0466703_420029 | Ga0466703_420029_542_889 | 115 |
| 85 | 3300042643 | Ga0466704_202258 | Ga0466704_202258_1971_2318 | 115 |
| 86 | 3300042643 | Ga0466704_483005 | Ga0466704_483005_69_416 | 115 |
| 87 | 3300042655 | Ga0466727_114431 | Ga0466727_114431_513_860 | 115 |
| 88 | 3300042655 | Ga0466727_274646 | Ga0466727_274646_1197_1544 | 115 |
| 89 | 3300042656 | Ga0466732_009711 | Ga0466732_009711_1575_1922 | 115 |
| 90 | 3300042656 | Ga0466732_023663 | Ga0466732_023663_2507_2854 | 115 |
| 91 | 3300042656 | Ga0466732_046835 | Ga0466732_046835_3578_3925 | 115 |
| 92 | 3300042656 | Ga0466732_088693 | Ga0466732_088693_97_444 | 115 |
| 93 | 3300042656 | Ga0466732_108607 | Ga0466732_108607_317_664 | 115 |
| 94 | 3300042656 | Ga0466732_138023 | Ga0466732_138023_3406_3753 | 115 |
| 95 | 3300042656 | Ga0466732_236521 | Ga0466732_236521_1603_1950 | 115 |
| 96 | 3300042659 | Ga0466733_026594 | Ga0466733_026594_3230_3577 | 115 |
| 97 | 3300042659 | Ga0466733_035241 | Ga0466733_035241_1049_1396 | 115 |
| 98 | 3300042659 | Ga0466733_147731 | Ga0466733_147731_5540_5887 | 115 |
| 99 | iso_pr_bacteria | 2781125641 | 2781290680 | 115 |
| 100 | iso_pr_bacteria | 2819990093 | 2819990459 | 115 |
| 101 | 3300002449 | JGI24698J34947_10005462 | JGI24698J34947_100054622 | 116 |
| 102 | 3300002449 | JGI24698J34947_10027816 | JGI24698J34947_100278165 | 116 |
| 103 | 3300002449 | JGI24698J34947_10099796 | JGI24698J34947_100997962 | 116 |
| 104 | 3300002449 | JGI24698J34947_10129597 | JGI24698J34947_101295972 | 116 |
| 105 | 3300002449 | JGI24698J34947_10190270 | JGI24698J34947_101902702 | 116 |
| 106 | 3300002449 | JGI24698J34947_10343667 | JGI24698J34947_103436671 | 116 |
| 107 | 3300002462 | JGI24702J35022_10063243 | JGI24702J35022_100632432 | 116 |
| 108 | 3300005201 | Ga0072941_1001794 | Ga0072941_10017942 | 116 |
| 109 | 3300005201 | Ga0072941_1002667 | Ga0072941_10026671 | 116 |
| 110 | 3300005201 | Ga0072941_1039239 | Ga0072941_103923913 | 116 |
| 111 | 3300005201 | Ga0072941_1052635 | Ga0072941_10526355 | 116 |
| 112 | 3300010049 | Ga0123356_10050413 | Ga0123356_100504131 | 116 |
| 113 | 3300010049 | Ga0123356_10592372 | Ga0123356_105923722 | 116 |
| 114 | 3300042591 | Ga0466692_035848 | Ga0466692_035848_1372_1722 | 116 |
| 115 | 3300042594 | Ga0466694_063382 | Ga0466694_063382_1170_1520 | 116 |
| 116 | 3300042598 | Ga0466701_035838 | Ga0466701_035838_490_840 | 116 |
| 117 | 3300042607 | Ga0466720_024112 | Ga0466720_024112_1429_1779 | 116 |
| 118 | 3300042607 | Ga0466720_067716 | Ga0466720_067716_52_402 | 116 |
| 119 | 3300042607 | Ga0466720_082576 | Ga0466720_082576_2727_3077 | 116 |
| 120 | 3300042607 | Ga0466720_083661 | Ga0466720_083661_626_976 | 116 |
| 121 | 3300042607 | Ga0466720_092079 | Ga0466720_092079_135_485 | 116 |
| 122 | 3300042607 | Ga0466720_170097 | Ga0466720_170097_1338_1688 | 116 |
| 123 | 3300042614 | Ga0466712_260656 | Ga0466712_260656_1546_1896 | 116 |
| 124 | 3300042656 | Ga0466732_113386 | Ga0466732_113386_1245_1595 | 116 |
| 125 | 3300042656 | Ga0466732_148116 | Ga0466732_148116_1509_1859 | 116 |
| 126 | 3300042656 | Ga0466732_287573 | Ga0466732_287573_856_1206 | 116 |
| 127 | iso_pr_bacteria | 2781125694 | 2781437315 | 116 |
| 128 | 3300000089 | AustNasuHG_c1016026 | AustNasuHG_10160263 | 117 |
| 129 | 3300002462 | JGI24702J35022_10372954 | JGI24702J35022_103729542 | 117 |
| 130 | 3300005200 | Ga0072940_1029359 | Ga0072940_10293594 | 117 |
| 131 | 3300042643 | Ga0466704_337162 | Ga0466704_337162_16151_16504 | 117 |
| 132 | 3300024493 | Ga0264413_133420 | Ga0264413_1334202 | 119 |
| 133 | 3300042636 | Ga0466703_042298 | Ga0466703_042298_774_1136 | 120 |
| 134 | 3300042601 | Ga0466707_108760 | Ga0466707_108760_831_1196 | 121 |
| 135 | 3300042595 | Ga0466695_297536 | Ga0466695_297536_218_595 | 125 |
| 136 | 3300002450 | JGI24695J34938_10366281 | JGI24695J34938_103662811 | 137 |
| 137 | 3300005200 | Ga0072940_1293355 | Ga0072940_12933552 | 156 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02452 | PemK_toxin | PemK-like, MazF-like toxin of type II toxin-antitoxin system | 3 | 109 | 0.92 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02452 | GO:0003677 | DNA binding | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.79 | 0.88 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.