Protein Family IF00719
Metagenome
Isolate
153
Members
52
Samples
147
Scaffolds
139.55
Avg Length
Representative Sequence
- ID
- 3300002450|JGI24695J34938_10125608|JGI24695J34938_101256082
- Length
- 140 aa
- Sequence
- MFLNNSYGRTIDIVHRAMDVSMLRRDVIANNLANADTPNFKRSTVNFESQLNRAFQSQKKPALEARMTNEKHISFYQPIDYRTVGPRRVLDYLTQTDPNGNNVDIEQESVHMLKNQLNYQLLSQVLSNQFTQISMVVAR*
Sample Types
Isolate
3.9%
Metagenome
96.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
56.0%
Kalotermitidae
22.0%
Unclassified
12.0%
Rhinotermitidae
4.0%
Termopsidae
4.0%
Hodotermitidae
2.0%
Taxonomy
Archaea
0
Bacteria
142
Eukaryota
0
Viruses
1
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 12 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 13 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 14 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 15 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 16 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 17 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 18 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 19 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 20 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 21 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 22 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 23 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 24 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 25 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 26 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 27 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 28 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 29 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 30 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 31 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 32 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 33 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 34 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 35 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 36 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 37 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 38 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 39 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 40 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 41 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 42 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 43 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 44 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 45 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 46 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 47 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 48 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 49 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 50 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 51 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 52 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24695J34938_10125608 | 3300002450 | Bacteria | 1045 |
| 2 | JGI24702J35022_10015386 | 3300002462 | Bacteria | 4211 |
| 3 | Ga0074263_111318 | 3300005485 | Bacteria | 1449 |
| 4 | Ga0415639_042451 | 3300038395 | Bacteria | 4588 |
| 5 | Ga0466694_291972 | 3300042594 | Bacteria | 8558 |
| 6 | Ga0466699_189226 | 3300042597 | Bacteria | 1349 |
| 7 | Ga0466735_001128 | 3300042624 | Bacteria | 11786 |
| 8 | Ga0123356_11559787 | 3300010049 | Bacteria | 816 |
| 9 | Ga0123353_10077513 | 3300010167 | Bacteria | 5340 |
| 10 | Ga0123353_10394892 | 3300010167 | Bacteria | 2061 |
| 11 | Ga0466712_143656 | 3300042614 | Bacteria | 26246 |
| 12 | Ga0466715_497126 | 3300042616 | Bacteria | 24776 |
| 13 | Ga0466729_138173 | 3300042621 | Bacteria | 2310 |
| 14 | JGI24698J34947_10000299 | 3300002449 | Bacteria | 21601 |
| 15 | JGI24702J35022_10046731 | 3300002462 | Bacteria | 2304 |
| 16 | Ga0466722_115318 | 3300042609 | Bacteria | 10822 |
| 17 | Ga0466694_028793 | 3300042594 | Viruses | 1838 |
| 18 | Ga0466732_065748 | 3300042656 | Unclassified | 1054 |
| 19 | Ga0466733_049705 | 3300042659 | Bacteria | 2207 |
| 20 | Ga0466702_111060 | 3300042635 | Bacteria | 1182 |
| 21 | Ga0466708_354560 | 3300042652 | Bacteria | 7805 |
| 22 | Ga0123357_10212609 | 3300009784 | Bacteria | 2168 |
| 23 | Ga0123353_10058175 | 3300010167 | Bacteria | 6194 |
| 24 | Ga0123353_11063840 | 3300010167 | Bacteria | 1079 |
| 25 | Ga0123353_11983248 | 3300010167 | Bacteria | 714 |
| 26 | Ga0466712_195897 | 3300042614 | Unclassified | 1060 |
| 27 | Ga0466712_244016 | 3300042614 | Bacteria | 1808 |
| 28 | Ga0466718_136921 | 3300042617 | Bacteria | 1211 |
| 29 | AustNasuHG_c1000911 | 3300000089 | Bacteria | 10667 |
| 30 | JGI24698J34947_10001652 | 3300002449 | Bacteria | 11877 |
| 31 | JGI24698J34947_10022993 | 3300002449 | Bacteria | 3337 |
| 32 | JGI24695J34938_10039377 | 3300002450 | Bacteria | 2136 |
| 33 | JGI24702J35022_10002298 | 3300002462 | Bacteria | 11731 |
| 34 | Ga0466719_020025 | 3300042606 | Bacteria | 1596 |
| 35 | Ga0466720_012413 | 3300042607 | Bacteria | 1364 |
| 36 | Ga0466698_027000 | 3300042610 | Bacteria | 1727 |
| 37 | Ga0415639_127081 | 3300038395 | Bacteria | 1173 |
| 38 | Ga0466691_148346 | 3300042593 | Bacteria | 5855 |
| 39 | Ga0466725_105924 | 3300042654 | Bacteria | 1164 |
| 40 | Ga0123353_10075922 | 3300010167 | Bacteria | 5400 |
| 41 | Ga0123353_10425237 | 3300010167 | Bacteria | 1967 |
| 42 | Ga0123354_10512245 | 3300010882 | Bacteria | 928 |
| 43 | Ga0466712_083459 | 3300042614 | Bacteria | 1367 |
| 44 | Ga0466718_034599 | 3300042617 | Bacteria | 11704 |
| 45 | Ga0466728_237034 | 3300042620 | Bacteria | 9493 |
| 46 | JGI24698J34947_10000618 | 3300002449 | Bacteria | 17054 |
| 47 | JGI24698J34947_10007625 | 3300002449 | Bacteria | 5948 |
| 48 | JGI24698J34947_10148848 | 3300002449 | Bacteria | 975 |
| 49 | JGI24695J34938_10079214 | 3300002450 | Bacteria | 1359 |
| 50 | JGI24702J35022_10000370 | 3300002462 | Bacteria | 26677 |
| 51 | JGI24702J35022_10006980 | 3300002462 | Bacteria | 6491 |
| 52 | Ga0072940_1380429 | 3300005200 | Bacteria | 695 |
| 53 | Ga0466706_212342 | 3300042599 | Bacteria | 1108 |
| 54 | Ga0466700_402584 | 3300042600 | Bacteria | 1916 |
| 55 | Ga0466698_218374 | 3300042610 | Bacteria | 1034 |
| 56 | Ga0466693_364194 | 3300042592 | Bacteria | 1764 |
| 57 | Ga0466731_043769 | 3300042622 | Bacteria | 4901 |
| 58 | Ga0466735_085448 | 3300042624 | Bacteria | 3518 |
| 59 | Ga0466703_292399 | 3300042636 | Bacteria | 55753 |
| 60 | Ga0466704_128155 | 3300042643 | Bacteria | 28523 |
| 61 | Ga0466709_343979 | 3300042648 | Bacteria | 10355 |
| 62 | Ga0123357_10614909 | 3300009784 | Bacteria | 825 |
| 63 | Ga0123356_11039467 | 3300010049 | Bacteria | 989 |
| 64 | Ga0123353_11036649 | 3300010167 | Bacteria | 1097 |
| 65 | Ga0123353_12135952 | 3300010167 | Bacteria | 680 |
| 66 | Ga0123354_10678662 | 3300010882 | Bacteria | 727 |
| 67 | Ga0466718_070332 | 3300042617 | Bacteria | 1882 |
| 68 | Ga0466718_085724 | 3300042617 | Bacteria | 1235 |
| 69 | JGI24698J34947_10138237 | 3300002449 | Bacteria | 1030 |
| 70 | JGI24702J35022_10073557 | 3300002462 | Bacteria | 1843 |
| 71 | Ga0466720_018275 | 3300042607 | Bacteria | 1021 |
| 72 | Ga0264413_100336 | 3300024493 | Unclassified | 2129 |
| 73 | Ga0415639_001747 | 3300038395 | Bacteria | 17768 |
| 74 | Ga0466694_089628 | 3300042594 | Bacteria | 1961 |
| 75 | Ga0466699_023663 | 3300042597 | Bacteria | 1023 |
| 76 | Ga0466699_160434 | 3300042597 | Bacteria | 2775 |
| 77 | Ga0466732_300152 | 3300042656 | Unclassified | 1896 |
| 78 | Ga0466731_157630 | 3300042622 | Bacteria | 1057 |
| 79 | Ga0466731_397175 | 3300042622 | Bacteria | 13514 |
| 80 | Ga0123353_10083514 | 3300010167 | Bacteria | 5140 |
| 81 | Ga0123353_10180061 | 3300010167 | Bacteria | 3347 |
| 82 | Ga0123353_10413416 | 3300010167 | Bacteria | 2002 |
| 83 | Ga0123353_10838588 | 3300010167 | Bacteria | 1262 |
| 84 | Ga0123353_10980375 | 3300010167 | Bacteria | 1139 |
| 85 | Ga0466712_180877 | 3300042614 | Bacteria | 1043 |
| 86 | Ga0466718_026738 | 3300042617 | Bacteria | 5412 |
| 87 | JGI24698J34947_10001839 | 3300002449 | Bacteria | 11314 |
| 88 | JGI24698J34947_10027067 | 3300002449 | Bacteria | 3043 |
| 89 | JGI24695J34938_10018224 | 3300002450 | Bacteria | 3517 |
| 90 | JGI24702J35022_10086068 | 3300002462 | Bacteria | 1707 |
| 91 | JGI24705J35276_12044995 | 3300002504 | Bacteria | 909 |
| 92 | Ga0264413_100337 | 3300024493 | Bacteria | 1959 |
| 93 | Ga0415639_101633 | 3300038395 | Bacteria | 2426 |
| 94 | Ga0466690_091323 | 3300042590 | Bacteria | 1122 |
| 95 | Ga0466694_374483 | 3300042594 | Bacteria | 2421 |
| 96 | Ga0466694_406717 | 3300042594 | Bacteria | 27989 |
| 97 | Ga0466695_024946 | 3300042595 | Bacteria | 12658 |
| 98 | Ga0466699_078987 | 3300042597 | Bacteria | 3456 |
| 99 | Ga0466732_417104 | 3300042656 | Bacteria | 1028 |
| 100 | Ga0466709_230530 | 3300042648 | Bacteria | 1934 |
| 101 | Ga0123357_10266990 | 3300009784 | Bacteria | 1796 |
| 102 | Ga0123357_10349103 | 3300009784 | Bacteria | 1418 |
| 103 | Ga0123355_10305658 | 3300009826 | Bacteria | 2162 |
| 104 | Ga0123354_10457672 | 3300010882 | Bacteria | 1028 |
| 105 | Ga0466712_026923 | 3300042614 | Unclassified | 1057 |
| 106 | JGI24698J34947_10009619 | 3300002449 | Bacteria | 5297 |
| 107 | JGI24698J34947_10084047 | 3300002449 | Unclassified | 1483 |
| 108 | JGI24695J34938_10226214 | 3300002450 | Bacteria | 787 |
| 109 | JGI24702J35022_10638727 | 3300002462 | Bacteria | 660 |
| 110 | Ga0123357_10001701 | 3300009784 | Bacteria | 23703 |
| 111 | Ga0466717_119467 | 3300042604 | Bacteria | 1322 |
| 112 | Ga0466716_095518 | 3300042605 | Bacteria | 1938 |
| 113 | Ga0466722_028565 | 3300042609 | Bacteria | 1132 |
| 114 | Ga0466722_167210 | 3300042609 | Unclassified | 6613 |
| 115 | Ga0264413_100335 | 3300024493 | Bacteria | 1781 |
| 116 | Ga0415639_206458 | 3300038395 | Bacteria | 1249 |
| 117 | Ga0466696_271574 | 3300042596 | Bacteria | 3928 |
| 118 | Ga0466732_210802 | 3300042656 | Bacteria | 1161 |
| 119 | Ga0466729_200857 | 3300042621 | Bacteria | 1653 |
| 120 | Ga0123357_10007038 | 3300009784 | Bacteria | 13848 |
| 121 | Ga0123355_10066679 | 3300009826 | Bacteria | 5793 |
| 122 | Ga0123356_10377018 | 3300010049 | Bacteria | 1550 |
| 123 | Ga0123356_11624776 | 3300010049 | Bacteria | 800 |
| 124 | Ga0123353_10529723 | 3300010167 | Bacteria | 1706 |
| 125 | Ga0123354_10375857 | 3300010882 | Bacteria | 1234 |
| 126 | Ga0466712_008072 | 3300042614 | Unclassified | 2047 |
| 127 | Ga0466712_049651 | 3300042614 | Bacteria | 30185 |
| 128 | Ga0466712_093083 | 3300042614 | Bacteria | 12102 |
| 129 | JGI24698J34947_10081326 | 3300002449 | Unclassified | 1519 |
| 130 | JGI24698J34947_10149102 | 3300002449 | Unclassified | 974 |
| 131 | JGI24705J35276_11708621 | 3300002504 | Bacteria | 637 |
| 132 | JGI24705J35276_12108464 | 3300002504 | Bacteria | 1037 |
| 133 | Ga0072941_1067922 | 3300005201 | Bacteria | 1258 |
| 134 | Ga0466716_093126 | 3300042605 | Bacteria | 26989 |
| 135 | Ga0466719_471340 | 3300042606 | Bacteria | 3068 |
| 136 | Ga0466722_013044 | 3300042609 | Bacteria | 28253 |
| 137 | Ga0466690_212022 | 3300042590 | Bacteria | 1860 |
| 138 | Ga0466699_293492 | 3300042597 | Bacteria | 1495 |
| 139 | Ga0466731_115724 | 3300042622 | Bacteria | 44043 |
| 140 | Ga0466727_022450 | 3300042655 | Bacteria | 6398 |
| 141 | Ga0123357_10110592 | 3300009784 | Bacteria | 3504 |
| 142 | Ga0123356_10787936 | 3300010049 | Bacteria | 1121 |
| 143 | Ga0123356_11373851 | 3300010049 | Bacteria | 867 |
| 144 | Ga0123356_12490123 | 3300010049 | Bacteria | 648 |
| 145 | Ga0123353_10257372 | 3300010167 | Bacteria | 2699 |
| 146 | Ga0123353_11131579 | 3300010167 | Bacteria | 1036 |
| 147 | Ga0123354_10118688 | 3300010882 | Bacteria | 3432 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042609 | Ga0466722_167210 | Ga0466722_167210_4158_4529 | 123 |
| 2 | 3300042617 | Ga0466718_034599 | Ga0466718_034599_2950_3321 | 123 |
| 3 | 3300042614 | Ga0466712_083459 | Ga0466712_083459_700_1074 | 124 |
| 4 | 3300009826 | Ga0123355_10305658 | Ga0123355_103056584 | 125 |
| 5 | 3300005201 | Ga0072941_1067922 | Ga0072941_10679223 | 128 |
| 6 | 3300042609 | Ga0466722_115318 | Ga0466722_115318_7601_7987 | 128 |
| 7 | 3300038395 | Ga0415639_206458 | Ga0415639_206458_482_907 | 134 |
| 8 | 3300038395 | Ga0415639_042451 | Ga0415639_042451_3105_3518 | 137 |
| 9 | 3300038395 | Ga0415639_101633 | Ga0415639_101633_634_1047 | 137 |
| 10 | 3300042599 | Ga0466706_212342 | Ga0466706_212342_52_465 | 137 |
| 11 | 3300042614 | Ga0466712_244016 | Ga0466712_244016_861_1274 | 137 |
| 12 | 3300042622 | Ga0466731_115724 | Ga0466731_115724_24696_25109 | 137 |
| 13 | 3300042622 | Ga0466731_397175 | Ga0466731_397175_9641_10054 | 137 |
| 14 | 3300042624 | Ga0466735_001128 | Ga0466735_001128_5127_5540 | 137 |
| 15 | 3300042635 | Ga0466702_111060 | Ga0466702_111060_424_837 | 137 |
| 16 | 3300042636 | Ga0466703_292399 | Ga0466703_292399_7987_8400 | 137 |
| 17 | 3300042654 | Ga0466725_105924 | Ga0466725_105924_147_560 | 137 |
| 18 | iso_pr_bacteria | 2781125640 | 2781286963 | 137 |
| 19 | 3300002449 | JGI24698J34947_10022993 | JGI24698J34947_100229932 | 138 |
| 20 | 3300002449 | JGI24698J34947_10148848 | JGI24698J34947_101488481 | 138 |
| 21 | 3300002449 | JGI24698J34947_10149102 | JGI24698J34947_101491021 | 138 |
| 22 | 3300002450 | JGI24695J34938_10018224 | JGI24695J34938_100182243 | 138 |
| 23 | 3300009826 | Ga0123355_10066679 | Ga0123355_100666793 | 138 |
| 24 | 3300042590 | Ga0466690_091323 | Ga0466690_091323_172_588 | 138 |
| 25 | 3300042590 | Ga0466690_212022 | Ga0466690_212022_786_1202 | 138 |
| 26 | 3300042593 | Ga0466691_148346 | Ga0466691_148346_3935_4351 | 138 |
| 27 | 3300042596 | Ga0466696_271574 | Ga0466696_271574_3412_3828 | 138 |
| 28 | 3300042605 | Ga0466716_093126 | Ga0466716_093126_16536_16952 | 138 |
| 29 | 3300042605 | Ga0466716_095518 | Ga0466716_095518_1057_1473 | 138 |
| 30 | 3300042606 | Ga0466719_020025 | Ga0466719_020025_82_498 | 138 |
| 31 | 3300042606 | Ga0466719_471340 | Ga0466719_471340_1264_1680 | 138 |
| 32 | 3300042609 | Ga0466722_013044 | Ga0466722_013044_23626_24042 | 138 |
| 33 | 3300042616 | Ga0466715_497126 | Ga0466715_497126_23158_23574 | 138 |
| 34 | 3300042620 | Ga0466728_237034 | Ga0466728_237034_6605_7021 | 138 |
| 35 | 3300042621 | Ga0466729_138173 | Ga0466729_138173_610_1026 | 138 |
| 36 | 3300042624 | Ga0466735_085448 | Ga0466735_085448_1844_2260 | 138 |
| 37 | 3300042643 | Ga0466704_128155 | Ga0466704_128155_21095_21511 | 138 |
| 38 | 3300042648 | Ga0466709_230530 | Ga0466709_230530_740_1156 | 138 |
| 39 | 3300042648 | Ga0466709_343979 | Ga0466709_343979_6353_6769 | 138 |
| 40 | 3300042652 | Ga0466708_354560 | Ga0466708_354560_253_669 | 138 |
| 41 | 3300042655 | Ga0466727_022450 | Ga0466727_022450_4585_5004 | 139 |
| 42 | 3300002450 | JGI24695J34938_10125608 | JGI24695J34938_101256082 | 140 |
| 43 | 3300002462 | JGI24702J35022_10073557 | JGI24702J35022_100735573 | 140 |
| 44 | 3300024493 | Ga0264413_100335 | Ga0264413_1003353 | 140 |
| 45 | 3300024493 | Ga0264413_100336 | Ga0264413_1003362 | 140 |
| 46 | 3300024493 | Ga0264413_100337 | Ga0264413_1003371 | 140 |
| 47 | 3300042594 | Ga0466694_028793 | Ga0466694_028793_439_861 | 140 |
| 48 | 3300042594 | Ga0466694_089628 | Ga0466694_089628_461_883 | 140 |
| 49 | 3300042594 | Ga0466694_291972 | Ga0466694_291972_5887_6309 | 140 |
| 50 | 3300042594 | Ga0466694_374483 | Ga0466694_374483_1709_2131 | 140 |
| 51 | 3300042594 | Ga0466694_406717 | Ga0466694_406717_9903_10325 | 140 |
| 52 | 3300042595 | Ga0466695_024946 | Ga0466695_024946_8531_8953 | 140 |
| 53 | 3300042597 | Ga0466699_023663 | Ga0466699_023663_517_939 | 140 |
| 54 | 3300042597 | Ga0466699_078987 | Ga0466699_078987_2912_3334 | 140 |
| 55 | 3300042597 | Ga0466699_160434 | Ga0466699_160434_1663_2085 | 140 |
| 56 | 3300042597 | Ga0466699_189226 | Ga0466699_189226_646_1068 | 140 |
| 57 | 3300042597 | Ga0466699_293492 | Ga0466699_293492_331_753 | 140 |
| 58 | 3300042600 | Ga0466700_402584 | Ga0466700_402584_789_1211 | 140 |
| 59 | 3300042607 | Ga0466720_012413 | Ga0466720_012413_333_755 | 140 |
| 60 | 3300042607 | Ga0466720_018275 | Ga0466720_018275_161_583 | 140 |
| 61 | 3300042609 | Ga0466722_028565 | Ga0466722_028565_611_1033 | 140 |
| 62 | 3300042610 | Ga0466698_027000 | Ga0466698_027000_385_807 | 140 |
| 63 | 3300042610 | Ga0466698_218374 | Ga0466698_218374_524_946 | 140 |
| 64 | 3300042614 | Ga0466712_008072 | Ga0466712_008072_838_1260 | 140 |
| 65 | 3300042614 | Ga0466712_026923 | Ga0466712_026923_219_641 | 140 |
| 66 | 3300042614 | Ga0466712_049651 | Ga0466712_049651_1861_2283 | 140 |
| 67 | 3300042614 | Ga0466712_093083 | Ga0466712_093083_2642_3064 | 140 |
| 68 | 3300042614 | Ga0466712_143656 | Ga0466712_143656_3547_3969 | 140 |
| 69 | 3300042614 | Ga0466712_180877 | Ga0466712_180877_106_528 | 140 |
| 70 | 3300042614 | Ga0466712_195897 | Ga0466712_195897_581_1003 | 140 |
| 71 | 3300042617 | Ga0466718_026738 | Ga0466718_026738_541_963 | 140 |
| 72 | 3300042617 | Ga0466718_070332 | Ga0466718_070332_897_1319 | 140 |
| 73 | 3300042617 | Ga0466718_085724 | Ga0466718_085724_497_919 | 140 |
| 74 | 3300042617 | Ga0466718_136921 | Ga0466718_136921_53_475 | 140 |
| 75 | 3300042622 | Ga0466731_043769 | Ga0466731_043769_1760_2182 | 140 |
| 76 | 3300042656 | Ga0466732_065748 | Ga0466732_065748_29_451 | 140 |
| 77 | 3300042656 | Ga0466732_210802 | Ga0466732_210802_363_785 | 140 |
| 78 | 3300042656 | Ga0466732_300152 | Ga0466732_300152_1145_1567 | 140 |
| 79 | 3300042656 | Ga0466732_417104 | Ga0466732_417104_353_775 | 140 |
| 80 | 3300042659 | Ga0466733_049705 | Ga0466733_049705_1428_1850 | 140 |
| 81 | iso_pr_bacteria | 2781125686 | 2781419107 | 140 |
| 82 | iso_pr_bacteria | 2781125690 | 2781427626 | 140 |
| 83 | iso_pr_bacteria | 2781125691 | 2781429511 | 140 |
| 84 | iso_pr_bacteria | 2781125694 | 2781436849 | 140 |
| 85 | iso_pr_bacteria | 2781125697 | 2781443522 | 140 |
| 86 | 3300000089 | AustNasuHG_c1000911 | AustNasuHG_10009114 | 141 |
| 87 | 3300002449 | JGI24698J34947_10000299 | JGI24698J34947_1000029921 | 141 |
| 88 | 3300002449 | JGI24698J34947_10000618 | JGI24698J34947_100006182 | 141 |
| 89 | 3300002449 | JGI24698J34947_10001652 | JGI24698J34947_1000165214 | 141 |
| 90 | 3300002449 | JGI24698J34947_10001839 | JGI24698J34947_100018398 | 141 |
| 91 | 3300002449 | JGI24698J34947_10007625 | JGI24698J34947_100076252 | 141 |
| 92 | 3300002449 | JGI24698J34947_10009619 | JGI24698J34947_100096195 | 141 |
| 93 | 3300002449 | JGI24698J34947_10027067 | JGI24698J34947_100270674 | 141 |
| 94 | 3300002449 | JGI24698J34947_10081326 | JGI24698J34947_100813262 | 141 |
| 95 | 3300002449 | JGI24698J34947_10084047 | JGI24698J34947_100840472 | 141 |
| 96 | 3300002449 | JGI24698J34947_10138237 | JGI24698J34947_101382372 | 141 |
| 97 | 3300002450 | JGI24695J34938_10039377 | JGI24695J34938_100393772 | 141 |
| 98 | 3300002450 | JGI24695J34938_10079214 | JGI24695J34938_100792142 | 141 |
| 99 | 3300002450 | JGI24695J34938_10226214 | JGI24695J34938_102262141 | 141 |
| 100 | 3300002462 | JGI24702J35022_10000370 | JGI24702J35022_100003706 | 141 |
| 101 | 3300002462 | JGI24702J35022_10002298 | JGI24702J35022_100022987 | 141 |
| 102 | 3300002462 | JGI24702J35022_10006980 | JGI24702J35022_100069807 | 141 |
| 103 | 3300002462 | JGI24702J35022_10015386 | JGI24702J35022_100153864 | 141 |
| 104 | 3300002462 | JGI24702J35022_10046731 | JGI24702J35022_100467312 | 141 |
| 105 | 3300002462 | JGI24702J35022_10086068 | JGI24702J35022_100860683 | 141 |
| 106 | 3300002462 | JGI24702J35022_10638727 | JGI24702J35022_106387271 | 141 |
| 107 | 3300002504 | JGI24705J35276_11708621 | JGI24705J35276_117086212 | 141 |
| 108 | 3300002504 | JGI24705J35276_12044995 | JGI24705J35276_120449952 | 141 |
| 109 | 3300002504 | JGI24705J35276_12108464 | JGI24705J35276_121084642 | 141 |
| 110 | 3300005200 | Ga0072940_1380429 | Ga0072940_13804292 | 141 |
| 111 | 3300005485 | Ga0074263_111318 | Ga0074263_1113182 | 141 |
| 112 | 3300009784 | Ga0123357_10001701 | Ga0123357_100017019 | 141 |
| 113 | 3300009784 | Ga0123357_10007038 | Ga0123357_100070382 | 141 |
| 114 | 3300009784 | Ga0123357_10110592 | Ga0123357_101105922 | 141 |
| 115 | 3300009784 | Ga0123357_10212609 | Ga0123357_102126092 | 141 |
| 116 | 3300009784 | Ga0123357_10266990 | Ga0123357_102669902 | 141 |
| 117 | 3300009784 | Ga0123357_10349103 | Ga0123357_103491032 | 141 |
| 118 | 3300009784 | Ga0123357_10614909 | Ga0123357_106149092 | 141 |
| 119 | 3300010049 | Ga0123356_10377018 | Ga0123356_103770183 | 141 |
| 120 | 3300010049 | Ga0123356_10787936 | Ga0123356_107879362 | 141 |
| 121 | 3300010049 | Ga0123356_11039467 | Ga0123356_110394671 | 141 |
| 122 | 3300010049 | Ga0123356_11373851 | Ga0123356_113738512 | 141 |
| 123 | 3300010049 | Ga0123356_11559787 | Ga0123356_115597871 | 141 |
| 124 | 3300010049 | Ga0123356_11624776 | Ga0123356_116247762 | 141 |
| 125 | 3300010049 | Ga0123356_12490123 | Ga0123356_124901232 | 141 |
| 126 | 3300010167 | Ga0123353_10075922 | Ga0123353_100759223 | 141 |
| 127 | 3300010167 | Ga0123353_10077513 | Ga0123353_100775135 | 141 |
| 128 | 3300010167 | Ga0123353_10083514 | Ga0123353_100835142 | 141 |
| 129 | 3300010167 | Ga0123353_10180061 | Ga0123353_101800613 | 141 |
| 130 | 3300010167 | Ga0123353_10257372 | Ga0123353_102573723 | 141 |
| 131 | 3300010167 | Ga0123353_10394892 | Ga0123353_103948923 | 141 |
| 132 | 3300010167 | Ga0123353_10413416 | Ga0123353_104134162 | 141 |
| 133 | 3300010167 | Ga0123353_10425237 | Ga0123353_104252372 | 141 |
| 134 | 3300010167 | Ga0123353_10529723 | Ga0123353_105297232 | 141 |
| 135 | 3300010167 | Ga0123353_10838588 | Ga0123353_108385883 | 141 |
| 136 | 3300010167 | Ga0123353_10980375 | Ga0123353_109803752 | 141 |
| 137 | 3300010167 | Ga0123353_11036649 | Ga0123353_110366492 | 141 |
| 138 | 3300010167 | Ga0123353_11063840 | Ga0123353_110638401 | 141 |
| 139 | 3300010167 | Ga0123353_11983248 | Ga0123353_119832482 | 141 |
| 140 | 3300010167 | Ga0123353_12135952 | Ga0123353_121359522 | 141 |
| 141 | 3300010882 | Ga0123354_10118688 | Ga0123354_101186882 | 141 |
| 142 | 3300010882 | Ga0123354_10375857 | Ga0123354_103758572 | 141 |
| 143 | 3300010882 | Ga0123354_10457672 | Ga0123354_104576722 | 141 |
| 144 | 3300010882 | Ga0123354_10512245 | Ga0123354_105122451 | 141 |
| 145 | 3300010882 | Ga0123354_10678662 | Ga0123354_106786622 | 141 |
| 146 | 3300038395 | Ga0415639_127081 | Ga0415639_127081_366_791 | 141 |
| 147 | 3300042621 | Ga0466729_200857 | Ga0466729_200857_428_853 | 141 |
| 148 | 3300010167 | Ga0123353_10058175 | Ga0123353_100581756 | 142 |
| 149 | 3300042604 | Ga0466717_119467 | Ga0466717_119467_321_761 | 146 |
| 150 | 3300042622 | Ga0466731_157630 | Ga0466731_157630_300_740 | 146 |
| 151 | 3300038395 | Ga0415639_001747 | Ga0415639_001747_2846_3289 | 147 |
| 152 | 3300042592 | Ga0466693_364194 | Ga0466693_364194_1222_1668 | 148 |
| 153 | 3300010167 | Ga0123353_11131579 | Ga0123353_111315792 | 153 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00460 | Flg_bb_rod | Flagella basal body rod protein | 26 | 41 | 0.94 |
Structural Annotation β Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6k9q-assembly1.cif.gz_Q | Structure of the native supercoiled hook as a universal joint | 0.99 | 102 | 137 |
| 7nvg-assembly1.cif.gz_T2 | Salmonella flagellar basal body refined in C1 map | 0.856 | 11 | 136 |
| 7cgo-assembly1.cif.gz_l | Cryo-EM structure of the flagellar motor-hook complex from Salmonella | 0.851 | 11 | 137 |
| 7cg0-assembly1.cif.gz_m | Cryo-EM structure of the flagellar proximal rod with FliF peptides from Salmonella | 0.849 | 11 | 137 |
| 7cg0-assembly1.cif.gz_o | Cryo-EM structure of the flagellar proximal rod with FliF peptides from Salmonella | 0.837 | 8 | 136 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2f1mC03 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin | 0.6481 | 6 | 133 | 1.10.287.470 |
| 2f1mA03 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin | 0.6396 | 6 | 133 | 1.10.287.470 |
| 2f1mD03 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin | 0.6343 | 6 | 133 | 1.10.287.470 |
| af_P30181_733_913_1.10.132.10 | Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4; | 0.6316 | 1 | 129 | 1.10.132.10 |
| af_P52553_2_106_1.10.287.370 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.6251 | 5 | 139 | 1.10.287.370 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3L7RTQ7-F1-model_v4 | Uncharacterized/unreviewed | 0.952 | 6 | 138 | |
| AF-A0A497E5Z7-F1-model_v4 | Flagellar basal body rod protein FlgB | 0.9416 | 10 | 139 |
GO:0030694
GO:0071978 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.75 | 0.81 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.