Protein Family IF00707

Metagenome Metatranscriptome Isolate
164 Members
55 Samples
154 Scaffolds
286.48 Avg Length

🧬 Representative Sequence

ID
3300002450|JGI24695J34938_10048583|JGI24695J34938_100485831
Length
321 aa
Sequence
MNQHAVIHADSFVIINNILIKKSSMKVKNVIIGVCVLFVAFAFASCSGGVKTTKEKEEVDPKLVVENSFEKLIEASGTCPAYVLIDKSQVNLDDFAKDSEGYITLFDGETFNGWRGYGRDDVPARWIIEDGAIKFNGSGGGEAQENDGGDIIFAHKFKNFELSIDWKVSKGGNSGIFYLAQEIKGQPIYISSPESQVLDNENHPDAKMGVDGNRQSSSLYDMIPAVPQNAKPFEEWNNTKIMVFKGTVLHSQNGTNVVEYHLWTPQWTEMLQASKFSQAKWPIAFELLNNCGGANREGYIGMQDHGDDVWFKNIKIKILD*

📊 Sample Types

Isolate 5.5%
Metagenome 93.9%
MAG 0.0%
Metatranscriptome 0.6%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 36.4%
Kalotermitidae 25.5%
Blattidae 12.7%
Unclassified 7.3%
Termopsidae 7.3%
Rhinotermitidae 5.5%
Passalidae 3.6%
Hodotermitidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 158
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
2 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
3 2820781750 Unclassified Bacteroidetes Emb289P3bin89 Isolate Unclassified
4 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
5 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
6 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
7 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
8 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
9 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
10 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
11 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
12 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
13 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
14 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
15 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
16 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
17 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
18 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
19 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
20 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
21 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
22 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
23 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
24 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
25 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
26 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
27 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
28 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
29 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
30 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
31 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
32 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
33 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
34 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
35 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
36 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
37 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
38 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
39 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
40 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
41 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
42 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
43 2820772500 Unclassified Bacteroidetes Lab288P1bin72 Isolate Unclassified
44 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
45 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
46 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
47 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
48 3300021231 Termite gut microbial communities from nest - French Guiana - 10-1 mRNA SA Metatranscriptome Termitidae
49 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
50 3004667792 Bacteroides sp. 519 Isolate Blattidae
51 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
52 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
53 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
54 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
55 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466723_089276 3300042618 Bacteria 12504
2 Ga0466728_034589 3300042620 Bacteria 4447
3 Ga0466693_089891 3300042592 Bacteria 1148
4 Ga0466735_073909 3300042624 Bacteria 2354
5 Ga0466703_020666 3300042636 Bacteria 2041
6 Ga0466716_408841 3300042605 Bacteria 4690
7 Ga0466719_464343 3300042606 Bacteria 3053
8 Ga0123353_10225915 3300010167 Bacteria 2923
9 Ga0123353_10537175 3300010167 Bacteria 1691
10 Ga0466705_265348 3300042612 Bacteria 30976
11 Ga0466711_081322 3300042615 Bacteria 5795
12 Ga0466711_334623 3300042615 Bacteria 13982
13 Ga0466715_496574 3300042616 Bacteria 33816
14 Ga0466726_240599 3300042619 Bacteria 7648
15 Ga0466726_354264 3300042619 Bacteria 1972
16 Ga0466690_015239 3300042590 Unclassified 3478
17 Ga0466691_071799 3300042593 Bacteria 28796
18 Ga0466704_400011 3300042643 Bacteria 4344
19 Ga0466708_227517 3300042652 Bacteria 22950
20 Ga0466727_048025 3300042655 Bacteria 5651
21 Ga0466707_246390 3300042601 Bacteria 3897
22 Ga0466707_277874 3300042601 Bacteria 6533
23 Ga0466713_098722 3300042602 Bacteria 10272
24 Ga0123356_10023956 3300010049 Bacteria 5744
25 Ga0123356_10420509 3300010049 Unclassified 1478
26 Ga0123353_10097222 3300010167 Bacteria 4745
27 Ga0123353_10335264 3300010167 Bacteria 2287
28 Ga0123353_10718148 3300010167 Bacteria 1398
29 Ga0123353_11028519 3300010167 Bacteria 1103
30 Ga0123354_10000032 3300010882 Bacteria 104032
31 Ga0123354_10027980 3300010882 Bacteria 8880
32 Ga0123354_10209260 3300010882 Bacteria 2114
33 JGI24695J34938_10048583 3300002450 Bacteria 1868
34 Ga0466705_448784 3300042612 Bacteria 15524
35 Ga0466710_140740 3300042613 Bacteria 2887
36 Ga0466715_370112 3300042616 Bacteria 23134
37 Ga0466715_469321 3300042616 Bacteria 12389
38 Ga0466728_046729 3300042620 Bacteria 48709
39 Ga0466728_344707 3300042620 Bacteria 3175
40 Ga0223682_1005967 3300021231 Bacteria 1313
41 Ga0466690_253942 3300042590 Bacteria 13330
42 Ga0466694_224049 3300042594 Bacteria 3922
43 Ga0466703_064776 3300042636 Bacteria 55980
44 Ga0466703_194698 3300042636 Bacteria 13706
45 Ga0466709_206246 3300042648 Bacteria 17439
46 Ga0466709_219439 3300042648 Bacteria 8494
47 Ga0466701_054176 3300042598 Bacteria 1757
48 Ga0466707_373224 3300042601 Bacteria 7565
49 Ga0466719_214013 3300042606 Bacteria 1587
50 Ga0466719_295939 3300042606 Bacteria 2080
51 Ga0466722_039589 3300042609 Bacteria 2849
52 Ga0466722_049429 3300042609 Bacteria 30179
53 Ga0466722_110785 3300042609 Bacteria 32436
54 Ga0123356_10481436 3300010049 Bacteria 1394
55 JGI24705J35276_12201622 3300002504 Bacteria 1621
56 Ga0466727_351525 3300042655 Bacteria 13108
57 Ga0466711_008364 3300042615 Bacteria 12308
58 Ga0466711_474740 3300042615 Bacteria 17723
59 Ga0466715_364165 3300042616 Bacteria 16347
60 Ga0466726_041411 3300042619 Bacteria 2625
61 Ga0466726_371395 3300042619 Bacteria 7857
62 Ga0466690_046047 3300042590 Bacteria 15590
63 Ga0466690_334741 3300042590 Bacteria 12484
64 Ga0466696_191398 3300042596 Bacteria 6524
65 Ga0466696_420970 3300042596 Bacteria 5788
66 Ga0466729_303130 3300042621 Bacteria 14278
67 Ga0466735_132882 3300042624 Bacteria 1908
68 Ga0466704_101100 3300042643 Bacteria 11747
69 Ga0466701_085101 3300042598 Bacteria 16798
70 Ga0466706_244573 3300042599 Bacteria 1353
71 Ga0466713_049052 3300042602 Bacteria 4670
72 Ga0466716_039975 3300042605 Bacteria 23276
73 Ga0466716_149833 3300042605 Bacteria 35494
74 Ga0466722_248707 3300042609 Bacteria 1517
75 Ga0466698_010748 3300042610 Bacteria 1222
76 Ga0123356_10155634 3300010049 Bacteria 2276
77 Ga0123353_10000732 3300010167 Bacteria 40082
78 Ga0123353_10032786 3300010167 Bacteria 8075
79 Ga0123353_10042211 3300010167 Bacteria 7211
80 JGI24702J35022_10000474 3300002462 Bacteria 24236
81 JGI24696J40584_12933958 3300002834 Bacteria 1530
82 Ga0068302_10006812 3300005071 Bacteria 2890
83 Ga0466723_132747 3300042618 Bacteria 21573
84 Ga0466726_474489 3300042619 Bacteria 1950
85 Ga0466656_254040 3300042550 Bacteria 1150
86 Ga0466691_033227 3300042593 Bacteria 26204
87 Ga0466696_149662 3300042596 Bacteria 4934
88 Ga0466709_304135 3300042648 Bacteria 18714
89 Ga0466727_239187 3300042655 Bacteria 1643
90 Ga0466707_285598 3300042601 Bacteria 1454
91 Ga0466713_042265 3300042602 Bacteria 5220
92 Ga0466713_070306 3300042602 Bacteria 27820
93 Ga0466713_153514 3300042602 Bacteria 1278
94 Ga0466719_471991 3300042606 Bacteria 2861
95 Ga0123357_10009481 3300009784 Bacteria 12296
96 Ga0123356_10001068 3300010049 Bacteria 30306
97 Ga0123356_11139383 3300010049 Unclassified 947
98 Ga0123353_10739163 3300010167 Bacteria 1372
99 IMNBL1DRAFT_c0003817 3300000062 Bacteria 9390
100 Ga0466715_233762 3300042616 Bacteria 19149
101 Ga0466723_187832 3300042618 Bacteria 11485
102 Ga0466728_395603 3300042620 Bacteria 2230
103 Ga0466690_147187 3300042590 Bacteria 19575
104 Ga0466696_036896 3300042596 Bacteria 15555
105 Ga0466696_483594 3300042596 Bacteria 2488
106 Ga0466709_208830 3300042648 Bacteria 4108
107 Ga0466727_060875 3300042655 Bacteria 16488
108 Ga0466727_078457 3300042655 Bacteria 7515
109 Ga0466700_026210 3300042600 Bacteria 1924
110 Ga0466700_062041 3300042600 Bacteria 2041
111 Ga0466707_226647 3300042601 Bacteria 2452
112 Ga0466722_257622 3300042609 Bacteria 1211
113 Ga0123356_10067116 3300010049 Bacteria 3360
114 Ga0123356_10561627 3300010049 Bacteria 1303
115 Ga0123353_10499523 3300010167 Unclassified 1773
116 2227283032 2225789004 Bacteria 1256
117 2227539371 2225789004 Bacteria 3015
118 Ga0466705_007682 3300042612 Bacteria 9716
119 Ga0466733_040837 3300042659 Bacteria 12358
120 Ga0466723_030107 3300042618 Bacteria 20038
121 Ga0466723_249743 3300042618 Bacteria 7023
122 Ga0466726_169281 3300042619 Bacteria 3754
123 Ga0466726_477607 3300042619 Bacteria 6567
124 Ga0466728_027123 3300042620 Bacteria 4503
125 Ga0466731_261941 3300042622 Bacteria 2619
126 Ga0466734_023737 3300042623 Bacteria 1141
127 Ga0466735_013123 3300042624 Bacteria 24815
128 Ga0466735_089734 3300042624 Unclassified 2090
129 Ga0466706_103763 3300042599 Bacteria 4196
130 Ga0466707_199068 3300042601 Bacteria 14926
131 Ga0466713_012036 3300042602 Bacteria 19801
132 Ga0466713_092539 3300042602 Bacteria 79640
133 Ga0466719_381987 3300042606 Bacteria 1041
134 Ga0466698_135863 3300042610 Bacteria 1489
135 Ga0123356_10101072 3300010049 Bacteria 2766
136 Ga0123353_10178542 3300010167 Bacteria 3364
137 Ga0466711_047743 3300042615 Bacteria 2638
138 Ga0466711_096764 3300042615 Bacteria 23270
139 Ga0466718_020779 3300042617 Bacteria 1490
140 Ga0466723_006506 3300042618 Bacteria 2735
141 Ga0466726_444772 3300042619 Unclassified 2250
142 Ga0466690_018231 3300042590 Bacteria 5271
143 Ga0466690_189515 3300042590 Bacteria 4152
144 Ga0466692_033396 3300042591 Bacteria 11132
145 Ga0466691_224916 3300042593 Bacteria 19199
146 Ga0466735_139289 3300042624 Bacteria 3026
147 Ga0466727_096909 3300042655 Bacteria 41286
148 Ga0466700_237825 3300042600 Bacteria 1705
149 Ga0466707_189533 3300042601 Bacteria 3614
150 Ga0466719_357503 3300042606 Bacteria 1244
151 Ga0466698_489081 3300042610 Bacteria 1095
152 Ga0123353_10005118 3300010167 Bacteria 17119
153 Ga0123353_10564379 3300010167 Bacteria 1638
154 JGI24705J35276_12218150 3300002504 Bacteria 2130

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042616 Ga0466715_496574 Ga0466715_496574_4371_5117 248
2 3300021231 Ga0223682_1005967 Ga0223682_10059672 252
3 3300042615 Ga0466711_334623 Ga0466711_334623_4841_5620 259
4 3300042616 Ga0466715_364165 Ga0466715_364165_9258_10127 259
5 iso_pr_bacteria 2940202316 2940202853 260
6 iso_pr_bacteria 2940371297 2940372106 263
7 3300042606 Ga0466719_295939 Ga0466719_295939_999_1793 264
8 3300042615 Ga0466711_096764 Ga0466711_096764_253_1104 264
9 3300042618 Ga0466723_249743 Ga0466723_249743_285_1148 264
10 3300042620 Ga0466728_344707 Ga0466728_344707_1000_1794 264
11 3300042648 Ga0466709_219439 Ga0466709_219439_4489_5340 264
12 3300042599 Ga0466706_244573 Ga0466706_244573_475_1272 265
13 3300042655 Ga0466727_096909 Ga0466727_096909_19915_20781 267
14 3300042601 Ga0466707_373224 Ga0466707_373224_5648_6454 268
15 3300042606 Ga0466719_464343 Ga0466719_464343_420_1226 268
16 3300002504 JGI24705J35276_12201622 JGI24705J35276_122016222 269
17 3300042590 Ga0466690_018231 Ga0466690_018231_4284_5132 269
18 3300042606 Ga0466719_381987 Ga0466719_381987_116_925 269
19 3300042610 Ga0466698_135863 Ga0466698_135863_230_1039 269
20 3300042620 Ga0466728_046729 Ga0466728_046729_44076_44906 269
21 3300042643 Ga0466704_400011 Ga0466704_400011_2157_3077 269
22 3300042652 Ga0466708_227517 Ga0466708_227517_16927_17739 270
23 3300042598 Ga0466701_054176 Ga0466701_054176_383_1201 272
24 3300010167 Ga0123353_10042211 Ga0123353_100422112 275
25 3300010167 Ga0123353_10225915 Ga0123353_102259152 275
26 3300042598 Ga0466701_085101 Ga0466701_085101_13285_14115 276
27 3300042618 Ga0466723_132747 Ga0466723_132747_13936_14817 276
28 3300010167 Ga0123353_10000732 Ga0123353_1000073229 277
29 3300042623 Ga0466734_023737 Ga0466734_023737_87_920 277
30 3300005071 Ga0068302_10006812 Ga0068302_100068122 278
31 3300010049 Ga0123356_10023956 Ga0123356_100239563 278
32 3300010049 Ga0123356_10101072 Ga0123356_101010723 278
33 3300010167 Ga0123353_10739163 Ga0123353_107391631 278
34 3300042600 Ga0466700_237825 Ga0466700_237825_736_1641 278
35 3300042636 Ga0466703_020666 Ga0466703_020666_278_1114 278
36 3300042593 Ga0466691_071799 Ga0466691_071799_21077_21916 279
37 3300042596 Ga0466696_149662 Ga0466696_149662_3628_4518 280
38 3300042615 Ga0466711_008364 Ga0466711_008364_11377_12261 280
39 3300042619 Ga0466726_444772 Ga0466726_444772_164_1045 280
40 3300042619 Ga0466726_474489 Ga0466726_474489_636_1478 280
41 3300042620 Ga0466728_395603 Ga0466728_395603_1004_1873 280
42 3300042624 Ga0466735_139289 Ga0466735_139289_1879_2763 280
43 3300002462 JGI24702J35022_10000474 JGI24702J35022_100004745 281
44 3300010049 Ga0123356_10420509 Ga0123356_104205092 281
45 3300042590 Ga0466690_046047 Ga0466690_046047_12163_13050 281
46 2225789004 2227539371 2228059751 282
47 3300042596 Ga0466696_483594 Ga0466696_483594_889_1797 282
48 3300042605 Ga0466716_039975 Ga0466716_039975_19899_20747 282
49 3300042606 Ga0466719_357503 Ga0466719_357503_252_1127 282
50 3300042612 Ga0466705_448784 Ga0466705_448784_12095_12973 282
51 3300042619 Ga0466726_477607 Ga0466726_477607_3826_4719 282
52 iso_pr_bacteria 3004667792 3004667856 282
53 3300042605 Ga0466716_149833 Ga0466716_149833_30081_30932 283
54 3300042615 Ga0466711_047743 Ga0466711_047743_483_1334 283
55 3300042615 Ga0466711_081322 Ga0466711_081322_1368_2219 283
56 3300042616 Ga0466715_233762 Ga0466715_233762_4551_5402 283
57 3300010049 Ga0123356_11139383 Ga0123356_111393831 284
58 3300042602 Ga0466713_042265 Ga0466713_042265_293_1150 285
59 3300042610 Ga0466698_489081 Ga0466698_489081_151_1008 285
60 3300042593 Ga0466691_224916 Ga0466691_224916_10619_11479 286
61 3300042601 Ga0466707_246390 Ga0466707_246390_2177_3070 286
62 3300042606 Ga0466719_214013 Ga0466719_214013_637_1497 286
63 3300042613 Ga0466710_140740 Ga0466710_140740_584_1444 286
64 3300042624 Ga0466735_013123 Ga0466735_013123_10105_10983 286
65 3300042624 Ga0466735_132882 Ga0466735_132882_670_1545 286
66 3300010167 Ga0123353_10097222 Ga0123353_100972225 287
67 3300042601 Ga0466707_226647 Ga0466707_226647_710_1573 287
68 3300042609 Ga0466722_110785 Ga0466722_110785_28844_29707 287
69 3300042618 Ga0466723_006506 Ga0466723_006506_302_1165 287
70 3300010049 Ga0123356_10067116 Ga0123356_100671162 288
71 3300042550 Ga0466656_254040 Ga0466656_254040_32_928 288
72 3300042590 Ga0466690_147187 Ga0466690_147187_3976_4842 288
73 3300042592 Ga0466693_089891 Ga0466693_089891_156_1022 288
74 3300042602 Ga0466713_070306 Ga0466713_070306_12919_13785 288
75 3300042606 Ga0466719_471991 Ga0466719_471991_502_1386 288
76 3300042610 Ga0466698_010748 Ga0466698_010748_147_1013 288
77 3300042619 Ga0466726_240599 Ga0466726_240599_5725_6591 288
78 3300042619 Ga0466726_354264 Ga0466726_354264_624_1490 288
79 3300042624 Ga0466735_073909 Ga0466735_073909_896_1762 288
80 3300042655 Ga0466727_351525 Ga0466727_351525_3565_4470 288
81 3300000062 IMNBL1DRAFT_c0003817 IMNBL1DRAFT_00038174 289
82 3300042590 Ga0466690_253942 Ga0466690_253942_3885_4754 289
83 3300042590 Ga0466690_334741 Ga0466690_334741_6134_7003 289
84 3300042591 Ga0466692_033396 Ga0466692_033396_266_1159 289
85 3300042601 Ga0466707_189533 Ga0466707_189533_1337_2206 289
86 3300042602 Ga0466713_049052 Ga0466713_049052_3656_4525 289
87 3300042648 Ga0466709_208830 Ga0466709_208830_496_1365 289
88 3300010167 Ga0123353_10537175 Ga0123353_105371752 290
89 3300042590 Ga0466690_189515 Ga0466690_189515_82_954 290
90 3300042609 Ga0466722_039589 Ga0466722_039589_186_1058 290
91 3300042615 Ga0466711_474740 Ga0466711_474740_11008_11880 290
92 3300042624 Ga0466735_089734 Ga0466735_089734_927_1799 290
93 3300042648 Ga0466709_304135 Ga0466709_304135_9353_10276 290
94 3300042655 Ga0466727_060875 Ga0466727_060875_651_1523 290
95 iso_pr_bacteria 2940244548 2940246427 290
96 iso_pr_bacteria 2940248789 2940250501 290
97 iso_pr_bacteria 2940253009 2940254671 290
98 iso_pr_bacteria 2940257232 2940258840 290
99 2225789004 2227283032 2227734656 291
100 3300010049 Ga0123356_10481436 Ga0123356_104814362 291
101 3300042596 Ga0466696_191398 Ga0466696_191398_1958_2833 291
102 3300042601 Ga0466707_277874 Ga0466707_277874_2080_2955 291
103 3300042616 Ga0466715_469321 Ga0466715_469321_1950_2825 291
104 3300042618 Ga0466723_089276 Ga0466723_089276_247_1122 291
105 3300042620 Ga0466728_027123 Ga0466728_027123_2964_3839 291
106 3300042620 Ga0466728_034589 Ga0466728_034589_1147_2022 291
107 3300042621 Ga0466729_303130 Ga0466729_303130_5744_6619 291
108 3300042636 Ga0466703_194698 Ga0466703_194698_12595_13470 291
109 3300042655 Ga0466727_078457 Ga0466727_078457_6593_7468 291
110 3300042593 Ga0466691_033227 Ga0466691_033227_3417_4325 292
111 3300042596 Ga0466696_036896 Ga0466696_036896_10473_11351 292
112 3300042601 Ga0466707_285598 Ga0466707_285598_566_1444 292
113 3300042602 Ga0466713_092539 Ga0466713_092539_62779_63675 292
114 3300042616 Ga0466715_370112 Ga0466715_370112_5492_6370 292
115 3300042618 Ga0466723_030107 Ga0466723_030107_3674_4552 292
116 3300042619 Ga0466726_041411 Ga0466726_041411_1355_2233 292
117 3300042619 Ga0466726_371395 Ga0466726_371395_350_1228 292
118 3300042609 Ga0466722_248707 Ga0466722_248707_465_1346 293
119 3300042609 Ga0466722_257622 Ga0466722_257622_157_1038 293
120 3300042619 Ga0466726_169281 Ga0466726_169281_276_1157 293
121 iso_pr_bacteria 2820781750 2820781896 293
122 3300010049 Ga0123356_10001068 Ga0123356_100010685 294
123 3300042602 Ga0466713_098722 Ga0466713_098722_7374_8258 294
124 3300042612 Ga0466705_007682 Ga0466705_007682_3056_3940 294
125 3300042612 Ga0466705_265348 Ga0466705_265348_8696_9580 294
126 3300042617 Ga0466718_020779 Ga0466718_020779_201_1085 294
127 3300042643 Ga0466704_101100 Ga0466704_101100_7357_8241 294
128 3300042648 Ga0466709_206246 Ga0466709_206246_8992_9876 294
129 3300042602 Ga0466713_153514 Ga0466713_153514_122_1009 295
130 3300042655 Ga0466727_048025 Ga0466727_048025_48_935 295
131 3300042659 Ga0466733_040837 Ga0466733_040837_5935_6822 295
132 iso_pr_bacteria 2820772500 2820773687 295
133 3300002504 JGI24705J35276_12218150 JGI24705J35276_122181502 296
134 3300010167 Ga0123353_10005118 Ga0123353_1000511818 296
135 3300010167 Ga0123353_10564379 Ga0123353_105643792 296
136 3300010882 Ga0123354_10209260 Ga0123354_102092602 296
137 3300042590 Ga0466690_015239 Ga0466690_015239_551_1441 296
138 3300042600 Ga0466700_026210 Ga0466700_026210_779_1669 296
139 3300042636 Ga0466703_064776 Ga0466703_064776_46761_47651 296
140 3300010167 Ga0123353_10499523 Ga0123353_104995232 297
141 3300010167 Ga0123353_11028519 Ga0123353_110285191 297
142 3300042596 Ga0466696_420970 Ga0466696_420970_1064_1957 297
143 3300042599 Ga0466706_103763 Ga0466706_103763_1179_2072 297
144 3300042601 Ga0466707_199068 Ga0466707_199068_2884_3777 297
145 3300010167 Ga0123353_10718148 Ga0123353_107181482 298
146 3300042600 Ga0466700_062041 Ga0466700_062041_341_1237 298
147 3300042602 Ga0466713_012036 Ga0466713_012036_16541_17437 298
148 3300042618 Ga0466723_187832 Ga0466723_187832_7831_8727 298
149 3300002834 JGI24696J40584_12933958 JGI24696J40584_129339581 299
150 3300042594 Ga0466694_224049 Ga0466694_224049_1273_2172 299
151 3300010167 Ga0123353_10335264 Ga0123353_103352642 300
152 3300042609 Ga0466722_049429 Ga0466722_049429_3823_4725 300
153 3300010049 Ga0123356_10561627 Ga0123356_105616272 301
154 3300010167 Ga0123353_10032786 Ga0123353_100327862 301
155 3300010882 Ga0123354_10000032 Ga0123354_1000003277 301
156 3300010882 Ga0123354_10027980 Ga0123354_100279809 301
157 3300042622 Ga0466731_261941 Ga0466731_261941_1499_2404 301
158 3300009784 Ga0123357_10009481 Ga0123357_100094813 302
159 3300010049 Ga0123356_10155634 Ga0123356_101556342 302
160 3300010167 Ga0123353_10178542 Ga0123353_101785421 304
161 3300042655 Ga0466727_239187 Ga0466727_239187_343_1299 310
162 3300042605 Ga0466716_408841 Ga0466716_408841_2268_3209 313
163 3300010167 Ga0123353_10042211 Ga0123353_100422114 315
164 3300002450 JGI24695J34938_10048583 JGI24695J34938_100485831 321

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF06439 3keto-disac_hyd 3-keto-disaccharide hydrolase 101 317 0.96

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF06439 GO:0016787 hydrolase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.8 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.