Protein Family IF00705
Metagenome
Isolate
158
Members
62
Samples
155
Scaffolds
246.85
Avg Length
Representative Sequence
- ID
- 3300002450|JGI24695J34938_10045238|JGI24695J34938_100452382
- Length
- 267 aa
- Sequence
- MKTTKIEWTEATWNPSIGCTKKTAGCKNCYAEIMARRLQGIGVPGYENGFEFKVLPERLQQPTTIKKPTKFFVNSMSDLFHEKMPFSYLDKVFETIKNTPQHHYQILTKREKRLQKYFEKRTVPSNVWLGVTVENASTKHRIDVLRNIEASVRFISVEPLIGDVGELDLSEIHWVIVGGESGISARPMNPEWAINVQKQCAEQDVAFFFKQWGTWGEDGVKRNKKENGNILQGKVWKEEPPILQKYQTRTIVTKKRIKSKVNLQKF*
Sample Types
Isolate
1.9%
Metagenome
98.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
57.6%
Kalotermitidae
22.0%
Unclassified
8.5%
Termopsidae
5.1%
Rhinotermitidae
3.4%
Passalidae
1.7%
Hodotermitidae
1.7%
Taxonomy
Archaea
0
Bacteria
150
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2778260935 | Unclassified Fibrobacteres Co191P1bin79 | Isolate | Unclassified |
| 2 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 5 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 6 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 7 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 8 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 9 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 10 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 11 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 12 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 13 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 14 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 15 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 16 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 17 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 18 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 19 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 20 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 21 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 22 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 23 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
| 24 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 25 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 26 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 27 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 28 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 29 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 30 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 31 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 32 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 33 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 34 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 35 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 36 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 37 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 38 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 39 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 40 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 41 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 42 | 2820151121 | Unclassified Proteobacteria Cu122P5bin52 | Isolate | Unclassified |
| 43 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 44 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 45 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 46 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 47 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 48 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 49 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 50 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 51 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 52 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 53 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 54 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 55 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 56 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 57 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 58 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 59 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 60 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 61 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 62 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_014403 | 3300042612 | Bacteria | 4983 |
| 2 | Ga0466705_112072 | 3300042612 | Bacteria | 1849 |
| 3 | Ga0466705_250090 | 3300042612 | Bacteria | 2117 |
| 4 | Ga0466732_175028 | 3300042656 | Bacteria | 2535 |
| 5 | JGI24696J40584_12922688 | 3300002834 | Unclassified | 1367 |
| 6 | JGI24696J40584_12956655 | 3300002834 | Bacteria | 3184 |
| 7 | Ga0123353_10926610 | 3300010167 | Bacteria | 1182 |
| 8 | Ga0466692_189713 | 3300042591 | Bacteria | 1504 |
| 9 | Ga0466712_254826 | 3300042614 | Bacteria | 1222 |
| 10 | Ga0466711_313429 | 3300042615 | Bacteria | 90458 |
| 11 | Ga0466726_074667 | 3300042619 | Bacteria | 4046 |
| 12 | Ga0466735_193052 | 3300042624 | Bacteria | 2787 |
| 13 | Ga0466702_240393 | 3300042635 | Bacteria | 2392 |
| 14 | Ga0466702_430753 | 3300042635 | Bacteria | 1028 |
| 15 | Ga0466709_106293 | 3300042648 | Bacteria | 11933 |
| 16 | Ga0466708_402273 | 3300042652 | Bacteria | 4157 |
| 17 | Ga0466713_133937 | 3300042602 | Unclassified | 3812 |
| 18 | Ga0466714_051125 | 3300042603 | Bacteria | 52861 |
| 19 | Ga0466697_008153 | 3300042611 | Bacteria | 1720 |
| 20 | 2227472964 | 2225789004 | Bacteria | 4788 |
| 21 | AustNasuHG_c1006976 | 3300000089 | Bacteria | 4025 |
| 22 | JGI24698J34947_10012743 | 3300002449 | Bacteria | 4601 |
| 23 | JGI24705J35276_12230889 | 3300002504 | Bacteria | 3767 |
| 24 | JGI24696J40584_12950894 | 3300002834 | Bacteria | 2189 |
| 25 | Ga0072940_1025698 | 3300005200 | Bacteria | 10052 |
| 26 | Ga0123356_10012806 | 3300010049 | Bacteria | 8120 |
| 27 | Ga0123356_10055926 | 3300010049 | Bacteria | 3675 |
| 28 | Ga0123356_10703127 | 3300010049 | Bacteria | 1180 |
| 29 | Ga0123353_10014069 | 3300010167 | Bacteria | 11511 |
| 30 | Ga0466691_055724 | 3300042593 | Bacteria | 5259 |
| 31 | Ga0466694_227105 | 3300042594 | Bacteria | 4226 |
| 32 | Ga0466696_049852 | 3300042596 | Bacteria | 8685 |
| 33 | Ga0466710_417545 | 3300042613 | Bacteria | 3025 |
| 34 | Ga0466715_362959 | 3300042616 | Bacteria | 1653 |
| 35 | Ga0466723_250398 | 3300042618 | Bacteria | 3476 |
| 36 | Ga0466726_489063 | 3300042619 | Bacteria | 1274 |
| 37 | Ga0466731_120213 | 3300042622 | Bacteria | 4043 |
| 38 | Ga0466700_156257 | 3300042600 | Bacteria | 2954 |
| 39 | Ga0466720_087002 | 3300042607 | Bacteria | 2860 |
| 40 | Ga0466697_084268 | 3300042611 | Bacteria | 2378 |
| 41 | Ga0466697_106175 | 3300042611 | Bacteria | 1228 |
| 42 | Ga0466733_068626 | 3300042659 | Bacteria | 5750 |
| 43 | JGI24695J34938_10045238 | 3300002450 | Bacteria | 1954 |
| 44 | Ga0123355_10000860 | 3300009826 | Bacteria | 41957 |
| 45 | Ga0123356_10244459 | 3300010049 | Bacteria | 1868 |
| 46 | Ga0123353_11340934 | 3300010167 | Bacteria | 925 |
| 47 | Ga0466690_296980 | 3300042590 | Unclassified | 1612 |
| 48 | Ga0466693_275847 | 3300042592 | Bacteria | 6823 |
| 49 | Ga0466710_270179 | 3300042613 | Bacteria | 1494 |
| 50 | Ga0466715_278886 | 3300042616 | Bacteria | 1662 |
| 51 | Ga0466718_123812 | 3300042617 | Bacteria | 11598 |
| 52 | Ga0466731_019022 | 3300042622 | Bacteria | 1848 |
| 53 | Ga0466704_238811 | 3300042643 | Bacteria | 1183 |
| 54 | Ga0466704_442863 | 3300042643 | Bacteria | 1146 |
| 55 | Ga0466708_082533 | 3300042652 | Bacteria | 3490 |
| 56 | Ga0466707_053250 | 3300042601 | Bacteria | 11788 |
| 57 | Ga0466717_212651 | 3300042604 | Bacteria | 1167 |
| 58 | Ga0466716_204552 | 3300042605 | Bacteria | 1597 |
| 59 | Ga0466720_112167 | 3300042607 | Bacteria | 13198 |
| 60 | FAAS_10001839 | 3300001880 | Bacteria | 1414 |
| 61 | JGI24702J35022_10021150 | 3300002462 | Bacteria | 3529 |
| 62 | Ga0123353_10034596 | 3300010167 | Bacteria | 7889 |
| 63 | Ga0264413_122687 | 3300024493 | Bacteria | 3859 |
| 64 | Ga0466705_404255 | 3300042612 | Bacteria | 4226 |
| 65 | Ga0466705_479437 | 3300042612 | Bacteria | 3431 |
| 66 | Ga0466731_044036 | 3300042622 | Bacteria | 1055 |
| 67 | Ga0466731_144846 | 3300042622 | Bacteria | 1020 |
| 68 | Ga0466702_109383 | 3300042635 | Bacteria | 2410 |
| 69 | Ga0466703_231485 | 3300042636 | Bacteria | 5033 |
| 70 | Ga0466704_001675 | 3300042643 | Bacteria | 7568 |
| 71 | Ga0466704_351944 | 3300042643 | Bacteria | 4835 |
| 72 | Ga0466709_140267 | 3300042648 | Bacteria | 28990 |
| 73 | Ga0466708_087036 | 3300042652 | Bacteria | 3663 |
| 74 | Ga0466727_323871 | 3300042655 | Bacteria | 3411 |
| 75 | Ga0466700_019993 | 3300042600 | Bacteria | 78233 |
| 76 | Ga0466720_008481 | 3300042607 | Bacteria | 3389 |
| 77 | Ga0466720_103456 | 3300042607 | Bacteria | 1701 |
| 78 | Ga0466722_128156 | 3300042609 | Bacteria | 2173 |
| 79 | Ga0123353_10500739 | 3300010167 | Bacteria | 1770 |
| 80 | Ga0123353_10639428 | 3300010167 | Bacteria | 1509 |
| 81 | Ga0415639_036150 | 3300038395 | Bacteria | 10535 |
| 82 | Ga0466690_001125 | 3300042590 | Bacteria | 2961 |
| 83 | Ga0466691_071384 | 3300042593 | Bacteria | 3363 |
| 84 | Ga0466694_262403 | 3300042594 | Bacteria | 1439 |
| 85 | Ga0466711_014777 | 3300042615 | Bacteria | 4591 |
| 86 | Ga0466711_163378 | 3300042615 | Bacteria | 2990 |
| 87 | Ga0466718_150484 | 3300042617 | Bacteria | 1065 |
| 88 | Ga0466726_025681 | 3300042619 | Bacteria | 4164 |
| 89 | Ga0466734_016594 | 3300042623 | Bacteria | 1468 |
| 90 | Ga0466735_202570 | 3300042624 | Bacteria | 1921 |
| 91 | Ga0466708_074707 | 3300042652 | Bacteria | 3013 |
| 92 | Ga0466716_503644 | 3300042605 | Bacteria | 2739 |
| 93 | Ga0466719_090210 | 3300042606 | Unclassified | 2222 |
| 94 | Ga0466720_130446 | 3300042607 | Bacteria | 13979 |
| 95 | Ga0466721_001716 | 3300042608 | Bacteria | 1876 |
| 96 | Ga0466698_364209 | 3300042610 | Bacteria | 2466 |
| 97 | Ga0466698_387115 | 3300042610 | Bacteria | 1562 |
| 98 | Ga0466705_036681 | 3300042612 | Bacteria | 6392 |
| 99 | Ga0466705_327922 | 3300042612 | Bacteria | 2563 |
| 100 | AustNasuHG_c1000014 | 3300000089 | Bacteria | 40235 |
| 101 | AustNasuHG_c1003136 | 3300000089 | Bacteria | 5961 |
| 102 | JGI24698J34947_10000991 | 3300002449 | Bacteria | 14556 |
| 103 | Ga0072941_1064726 | 3300005201 | Bacteria | 1623 |
| 104 | Ga0264413_109329 | 3300024493 | Bacteria | 2936 |
| 105 | Ga0466657_073071 | 3300042582 | Bacteria | 5337 |
| 106 | Ga0466690_237871 | 3300042590 | Unclassified | 2739 |
| 107 | Ga0466693_224987 | 3300042592 | Bacteria | 4346 |
| 108 | Ga0466691_070379 | 3300042593 | Bacteria | 3329 |
| 109 | Ga0466691_083314 | 3300042593 | Bacteria | 3599 |
| 110 | Ga0466691_154746 | 3300042593 | Bacteria | 5529 |
| 111 | Ga0466711_426181 | 3300042615 | Bacteria | 3243 |
| 112 | Ga0466715_539001 | 3300042616 | Bacteria | 5818 |
| 113 | Ga0466708_221792 | 3300042652 | Bacteria | 3017 |
| 114 | Ga0466697_080428 | 3300042611 | Bacteria | 1180 |
| 115 | Ga0466697_134624 | 3300042611 | Bacteria | 1204 |
| 116 | JGI24695J34938_10002147 | 3300002450 | Bacteria | 15407 |
| 117 | JGI24702J35022_10002804 | 3300002462 | Bacteria | 10569 |
| 118 | JGI24696J40584_12959113 | 3300002834 | Bacteria | 4728 |
| 119 | Ga0123356_10542136 | 3300010049 | Bacteria | 1324 |
| 120 | Ga0123356_10584299 | 3300010049 | Bacteria | 1281 |
| 121 | Ga0466656_257929 | 3300042550 | Bacteria | 1311 |
| 122 | Ga0466657_229008 | 3300042582 | Bacteria | 97233 |
| 123 | Ga0466690_046129 | 3300042590 | Unclassified | 4297 |
| 124 | Ga0466695_057067 | 3300042595 | Unclassified | 3604 |
| 125 | Ga0466696_090131 | 3300042596 | Bacteria | 1991 |
| 126 | Ga0466723_215421 | 3300042618 | Bacteria | 2893 |
| 127 | Ga0466726_040311 | 3300042619 | Bacteria | 1247 |
| 128 | Ga0466731_113149 | 3300042622 | Bacteria | 4054 |
| 129 | Ga0466702_253270 | 3300042635 | Bacteria | 1232 |
| 130 | Ga0466703_224360 | 3300042636 | Bacteria | 2918 |
| 131 | Ga0466703_263450 | 3300042636 | Bacteria | 3167 |
| 132 | Ga0466701_072422 | 3300042598 | Bacteria | 50719 |
| 133 | Ga0466706_244303 | 3300042599 | Bacteria | 41796 |
| 134 | Ga0466719_242968 | 3300042606 | Bacteria | 7854 |
| 135 | Ga0466720_206120 | 3300042607 | Unclassified | 3381 |
| 136 | Ga0466733_028490 | 3300042659 | Bacteria | 18069 |
| 137 | AustNasuHG_c1011397 | 3300000089 | Bacteria | 3082 |
| 138 | JGI24702J35022_10084555 | 3300002462 | Bacteria | 1722 |
| 139 | JGI24699J35502_11109404 | 3300002509 | Bacteria | 2631 |
| 140 | Ga0072940_1482549 | 3300005200 | Bacteria | 955 |
| 141 | Ga0123354_10150434 | 3300010882 | Bacteria | 2823 |
| 142 | Ga0466657_195905 | 3300042582 | Bacteria | 1663 |
| 143 | Ga0466657_362155 | 3300042582 | Bacteria | 6947 |
| 144 | Ga0466693_328714 | 3300042592 | Bacteria | 1077 |
| 145 | Ga0466715_270969 | 3300042616 | Bacteria | 10023 |
| 146 | Ga0466723_267346 | 3300042618 | Bacteria | 1979 |
| 147 | Ga0466726_227813 | 3300042619 | Bacteria | 2939 |
| 148 | Ga0466726_403200 | 3300042619 | Bacteria | 6852 |
| 149 | Ga0466731_176252 | 3300042622 | Bacteria | 4148 |
| 150 | Ga0466704_296227 | 3300042643 | Bacteria | 2909 |
| 151 | Ga0466708_060258 | 3300042652 | Bacteria | 1079 |
| 152 | Ga0466727_091785 | 3300042655 | Bacteria | 2952 |
| 153 | Ga0466713_047417 | 3300042602 | Bacteria | 2564 |
| 154 | Ga0466716_064386 | 3300042605 | Bacteria | 2086 |
| 155 | Ga0466716_243990 | 3300042605 | Bacteria | 2123 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042606 | Ga0466719_090210 | Ga0466719_090210_1130_1774 | 214 |
| 2 | 3300042590 | Ga0466690_296980 | Ga0466690_296980_402_1052 | 216 |
| 3 | 3300042593 | Ga0466691_083314 | Ga0466691_083314_345_1001 | 218 |
| 4 | 3300042612 | Ga0466705_112072 | Ga0466705_112072_982_1647 | 221 |
| 5 | 3300042636 | Ga0466703_263450 | Ga0466703_263450_1268_1933 | 221 |
| 6 | 3300002834 | JGI24696J40584_12959113 | JGI24696J40584_129591134 | 225 |
| 7 | 3300010049 | Ga0123356_10542136 | Ga0123356_105421362 | 227 |
| 8 | 3300042593 | Ga0466691_055724 | Ga0466691_055724_3440_4186 | 227 |
| 9 | 3300042643 | Ga0466704_442863 | Ga0466704_442863_53_739 | 228 |
| 10 | 3300010167 | Ga0123353_10639428 | Ga0123353_106394282 | 232 |
| 11 | 3300042605 | Ga0466716_503644 | Ga0466716_503644_1950_2693 | 236 |
| 12 | 3300042596 | Ga0466696_090131 | Ga0466696_090131_36_761 | 241 |
| 13 | 3300042602 | Ga0466713_133937 | Ga0466713_133937_1292_2017 | 241 |
| 14 | 3300042605 | Ga0466716_204552 | Ga0466716_204552_525_1250 | 241 |
| 15 | 3300042609 | Ga0466722_128156 | Ga0466722_128156_97_822 | 241 |
| 16 | iso_pr_bacteria | 2820151121 | 2820152121 | 241 |
| 17 | 3300010049 | Ga0123356_10584299 | Ga0123356_105842992 | 242 |
| 18 | 3300024493 | Ga0264413_109329 | Ga0264413_1093292 | 242 |
| 19 | 3300042590 | Ga0466690_001125 | Ga0466690_001125_816_1544 | 242 |
| 20 | 3300042607 | Ga0466720_112167 | Ga0466720_112167_6743_7471 | 242 |
| 21 | 3300042607 | Ga0466720_130446 | Ga0466720_130446_6738_7466 | 242 |
| 22 | 3300042607 | Ga0466720_206120 | Ga0466720_206120_465_1193 | 242 |
| 23 | 3300042617 | Ga0466718_150484 | Ga0466718_150484_193_921 | 242 |
| 24 | 2225789004 | 2227472964 | 2227921316 | 243 |
| 25 | 3300000089 | AustNasuHG_c1000014 | AustNasuHG_10000149 | 243 |
| 26 | 3300000089 | AustNasuHG_c1003136 | AustNasuHG_10031363 | 243 |
| 27 | 3300000089 | AustNasuHG_c1011397 | AustNasuHG_10113976 | 243 |
| 28 | 3300005200 | Ga0072940_1025698 | Ga0072940_10256987 | 243 |
| 29 | 3300042600 | Ga0466700_019993 | Ga0466700_019993_52225_52956 | 243 |
| 30 | 3300042608 | Ga0466721_001716 | Ga0466721_001716_317_1048 | 243 |
| 31 | 3300042612 | Ga0466705_250090 | Ga0466705_250090_74_805 | 243 |
| 32 | 3300042615 | Ga0466711_426181 | Ga0466711_426181_1187_1918 | 243 |
| 33 | 3300042622 | Ga0466731_019022 | Ga0466731_019022_1045_1776 | 243 |
| 34 | 3300042635 | Ga0466702_109383 | Ga0466702_109383_1584_2315 | 243 |
| 35 | 3300010167 | Ga0123353_10926610 | Ga0123353_109266102 | 244 |
| 36 | 3300010167 | Ga0123353_11340934 | Ga0123353_113409342 | 244 |
| 37 | 3300038395 | Ga0415639_036150 | Ga0415639_036150_9357_10091 | 244 |
| 38 | 3300042596 | Ga0466696_049852 | Ga0466696_049852_7832_8566 | 244 |
| 39 | 3300042602 | Ga0466713_047417 | Ga0466713_047417_1646_2380 | 244 |
| 40 | 3300042606 | Ga0466719_242968 | Ga0466719_242968_6092_6826 | 244 |
| 41 | 3300042614 | Ga0466712_254826 | Ga0466712_254826_433_1167 | 244 |
| 42 | 3300042622 | Ga0466731_120213 | Ga0466731_120213_510_1244 | 244 |
| 43 | 3300042652 | Ga0466708_074707 | Ga0466708_074707_403_1137 | 244 |
| 44 | 3300024493 | Ga0264413_122687 | Ga0264413_1226875 | 245 |
| 45 | 3300042582 | Ga0466657_073071 | Ga0466657_073071_2115_2852 | 245 |
| 46 | 3300042599 | Ga0466706_244303 | Ga0466706_244303_37400_38137 | 245 |
| 47 | 3300042600 | Ga0466700_156257 | Ga0466700_156257_839_1576 | 245 |
| 48 | 3300042601 | Ga0466707_053250 | Ga0466707_053250_5331_6068 | 245 |
| 49 | 3300042605 | Ga0466716_064386 | Ga0466716_064386_359_1096 | 245 |
| 50 | 3300042607 | Ga0466720_103456 | Ga0466720_103456_278_1015 | 245 |
| 51 | 3300042610 | Ga0466698_364209 | Ga0466698_364209_1264_2001 | 245 |
| 52 | 3300042615 | Ga0466711_163378 | Ga0466711_163378_2094_2831 | 245 |
| 53 | 3300042615 | Ga0466711_313429 | Ga0466711_313429_50985_51722 | 245 |
| 54 | 3300042618 | Ga0466723_250398 | Ga0466723_250398_1888_2625 | 245 |
| 55 | 3300042619 | Ga0466726_040311 | Ga0466726_040311_259_996 | 245 |
| 56 | 3300042619 | Ga0466726_227813 | Ga0466726_227813_403_1140 | 245 |
| 57 | 3300042622 | Ga0466731_113149 | Ga0466731_113149_1934_2671 | 245 |
| 58 | 3300042643 | Ga0466704_296227 | Ga0466704_296227_1428_2165 | 245 |
| 59 | 3300042648 | Ga0466709_106293 | Ga0466709_106293_9145_9882 | 245 |
| 60 | 3300042652 | Ga0466708_082533 | Ga0466708_082533_1396_2133 | 245 |
| 61 | 3300042655 | Ga0466727_323871 | Ga0466727_323871_1406_2143 | 245 |
| 62 | 3300042659 | Ga0466733_068626 | Ga0466733_068626_1585_2322 | 245 |
| 63 | 3300010049 | Ga0123356_10012806 | Ga0123356_100128062 | 246 |
| 64 | 3300042582 | Ga0466657_229008 | Ga0466657_229008_53155_53895 | 246 |
| 65 | 3300042582 | Ga0466657_362155 | Ga0466657_362155_3710_4450 | 246 |
| 66 | 3300042592 | Ga0466693_275847 | Ga0466693_275847_1938_2678 | 246 |
| 67 | 3300042593 | Ga0466691_154746 | Ga0466691_154746_1572_2312 | 246 |
| 68 | 3300042613 | Ga0466710_417545 | Ga0466710_417545_586_1326 | 246 |
| 69 | 3300042648 | Ga0466709_140267 | Ga0466709_140267_20445_21185 | 246 |
| 70 | 3300042652 | Ga0466708_402273 | Ga0466708_402273_500_1240 | 246 |
| 71 | 3300002834 | JGI24696J40584_12922688 | JGI24696J40584_129226882 | 247 |
| 72 | 3300042582 | Ga0466657_195905 | Ga0466657_195905_727_1470 | 247 |
| 73 | 3300042592 | Ga0466693_224987 | Ga0466693_224987_1255_1998 | 247 |
| 74 | 3300042592 | Ga0466693_328714 | Ga0466693_328714_152_895 | 247 |
| 75 | 3300042594 | Ga0466694_262403 | Ga0466694_262403_108_851 | 247 |
| 76 | 3300042603 | Ga0466714_051125 | Ga0466714_051125_43012_43755 | 247 |
| 77 | 3300042604 | Ga0466717_212651 | Ga0466717_212651_73_816 | 247 |
| 78 | 3300042607 | Ga0466720_008481 | Ga0466720_008481_2326_3069 | 247 |
| 79 | 3300042611 | Ga0466697_084268 | Ga0466697_084268_1143_1886 | 247 |
| 80 | 3300042611 | Ga0466697_134624 | Ga0466697_134624_228_971 | 247 |
| 81 | 3300042619 | Ga0466726_489063 | Ga0466726_489063_452_1195 | 247 |
| 82 | 3300042622 | Ga0466731_044036 | Ga0466731_044036_180_923 | 247 |
| 83 | 3300042622 | Ga0466731_144846 | Ga0466731_144846_137_880 | 247 |
| 84 | 3300042622 | Ga0466731_176252 | Ga0466731_176252_2987_3730 | 247 |
| 85 | 3300042635 | Ga0466702_430753 | Ga0466702_430753_123_866 | 247 |
| 86 | 3300042659 | Ga0466733_028490 | Ga0466733_028490_2670_3413 | 247 |
| 87 | 3300002449 | JGI24698J34947_10012743 | JGI24698J34947_100127434 | 248 |
| 88 | 3300002462 | JGI24702J35022_10084555 | JGI24702J35022_100845552 | 248 |
| 89 | 3300002504 | JGI24705J35276_12230889 | JGI24705J35276_122308894 | 248 |
| 90 | 3300002509 | JGI24699J35502_11109404 | JGI24699J35502_111094043 | 248 |
| 91 | 3300002834 | JGI24696J40584_12950894 | JGI24696J40584_129508942 | 248 |
| 92 | 3300005201 | Ga0072941_1064726 | Ga0072941_10647263 | 248 |
| 93 | 3300010049 | Ga0123356_10055926 | Ga0123356_100559263 | 248 |
| 94 | 3300010049 | Ga0123356_10244459 | Ga0123356_102444592 | 248 |
| 95 | 3300010167 | Ga0123353_10014069 | Ga0123353_1001406910 | 248 |
| 96 | 3300010167 | Ga0123353_10500739 | Ga0123353_105007392 | 248 |
| 97 | 3300010882 | Ga0123354_10150434 | Ga0123354_101504342 | 248 |
| 98 | 3300042619 | Ga0466726_025681 | Ga0466726_025681_127_873 | 248 |
| 99 | 3300042623 | Ga0466734_016594 | Ga0466734_016594_68_814 | 248 |
| 100 | 3300002834 | JGI24696J40584_12956655 | JGI24696J40584_129566552 | 249 |
| 101 | 3300042550 | Ga0466656_257929 | Ga0466656_257929_139_888 | 249 |
| 102 | 3300042611 | Ga0466697_080428 | Ga0466697_080428_205_954 | 249 |
| 103 | 3300042611 | Ga0466697_106175 | Ga0466697_106175_363_1112 | 249 |
| 104 | 3300042615 | Ga0466711_014777 | Ga0466711_014777_407_1156 | 249 |
| 105 | 3300042619 | Ga0466726_074667 | Ga0466726_074667_1734_2483 | 249 |
| 106 | 3300042635 | Ga0466702_240393 | Ga0466702_240393_15_764 | 249 |
| 107 | 3300042652 | Ga0466708_060258 | Ga0466708_060258_31_780 | 249 |
| 108 | 3300042598 | Ga0466701_072422 | Ga0466701_072422_24313_25065 | 250 |
| 109 | 3300042607 | Ga0466720_087002 | Ga0466720_087002_1606_2358 | 250 |
| 110 | 3300001880 | FAAS_10001839 | FAAS_100018392 | 251 |
| 111 | 3300042590 | Ga0466690_046129 | Ga0466690_046129_749_1504 | 251 |
| 112 | 3300042618 | Ga0466723_215421 | Ga0466723_215421_1533_2288 | 251 |
| 113 | 3300042636 | Ga0466703_224360 | Ga0466703_224360_1280_2035 | 251 |
| 114 | 3300042636 | Ga0466703_231485 | Ga0466703_231485_2496_3251 | 251 |
| 115 | 3300042655 | Ga0466727_091785 | Ga0466727_091785_2031_2786 | 251 |
| 116 | 3300000089 | AustNasuHG_c1006976 | AustNasuHG_10069761 | 252 |
| 117 | 3300002449 | JGI24698J34947_10000991 | JGI24698J34947_100009913 | 252 |
| 118 | 3300042590 | Ga0466690_237871 | Ga0466690_237871_1454_2212 | 252 |
| 119 | 3300042591 | Ga0466692_189713 | Ga0466692_189713_64_822 | 252 |
| 120 | 3300042593 | Ga0466691_070379 | Ga0466691_070379_1951_2709 | 252 |
| 121 | 3300042593 | Ga0466691_071384 | Ga0466691_071384_471_1229 | 252 |
| 122 | 3300042605 | Ga0466716_243990 | Ga0466716_243990_370_1128 | 252 |
| 123 | 3300042612 | Ga0466705_014403 | Ga0466705_014403_2915_3673 | 252 |
| 124 | 3300042612 | Ga0466705_327922 | Ga0466705_327922_161_919 | 252 |
| 125 | 3300042612 | Ga0466705_404255 | Ga0466705_404255_3315_4073 | 252 |
| 126 | 3300042612 | Ga0466705_479437 | Ga0466705_479437_657_1415 | 252 |
| 127 | 3300042616 | Ga0466715_270969 | Ga0466715_270969_4083_4841 | 252 |
| 128 | 3300042616 | Ga0466715_362959 | Ga0466715_362959_196_954 | 252 |
| 129 | 3300042616 | Ga0466715_539001 | Ga0466715_539001_1845_2603 | 252 |
| 130 | 3300042618 | Ga0466723_267346 | Ga0466723_267346_106_864 | 252 |
| 131 | 3300042619 | Ga0466726_403200 | Ga0466726_403200_3883_4641 | 252 |
| 132 | 3300042643 | Ga0466704_001675 | Ga0466704_001675_2160_2918 | 252 |
| 133 | 3300042643 | Ga0466704_238811 | Ga0466704_238811_98_856 | 252 |
| 134 | 3300042643 | Ga0466704_351944 | Ga0466704_351944_2664_3422 | 252 |
| 135 | 3300042652 | Ga0466708_087036 | Ga0466708_087036_1458_2216 | 252 |
| 136 | 3300042652 | Ga0466708_221792 | Ga0466708_221792_769_1527 | 252 |
| 137 | 3300042610 | Ga0466698_387115 | Ga0466698_387115_419_1180 | 253 |
| 138 | iso_pr_bacteria | 2778260935 | 2778344973 | 253 |
| 139 | iso_pr_bacteria | 2820785563 | 2820786627 | 253 |
| 140 | 3300002450 | JGI24695J34938_10002147 | JGI24695J34938_100021475 | 254 |
| 141 | 3300009826 | Ga0123355_10000860 | Ga0123355_1000086010 | 254 |
| 142 | 3300042624 | Ga0466735_193052 | Ga0466735_193052_284_1048 | 254 |
| 143 | 3300042656 | Ga0466732_175028 | Ga0466732_175028_722_1486 | 254 |
| 144 | 3300005200 | Ga0072940_1482549 | Ga0072940_14825491 | 255 |
| 145 | 3300010049 | Ga0123356_10703127 | Ga0123356_107031271 | 255 |
| 146 | 3300042613 | Ga0466710_270179 | Ga0466710_270179_546_1316 | 256 |
| 147 | 3300042595 | Ga0466695_057067 | Ga0466695_057067_1917_2690 | 257 |
| 148 | 3300042635 | Ga0466702_253270 | Ga0466702_253270_259_1032 | 257 |
| 149 | 3300002462 | JGI24702J35022_10021150 | JGI24702J35022_100211504 | 258 |
| 150 | 3300042617 | Ga0466718_123812 | Ga0466718_123812_486_1262 | 258 |
| 151 | 3300002462 | JGI24702J35022_10002804 | JGI24702J35022_100028047 | 259 |
| 152 | 3300042612 | Ga0466705_036681 | Ga0466705_036681_1506_2285 | 259 |
| 153 | 3300042616 | Ga0466715_278886 | Ga0466715_278886_622_1401 | 259 |
| 154 | 3300010167 | Ga0123353_10034596 | Ga0123353_100345965 | 260 |
| 155 | 3300042624 | Ga0466735_202570 | Ga0466735_202570_462_1247 | 261 |
| 156 | 3300042611 | Ga0466697_008153 | Ga0466697_008153_132_932 | 266 |
| 157 | 3300002450 | JGI24695J34938_10045238 | JGI24695J34938_100452382 | 267 |
| 158 | 3300042594 | Ga0466694_227105 | Ga0466694_227105_3168_4007 | 279 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF07505 | DUF5131 | Protein of unknown function (DUF5131) | 3 | 240 | 0.99 |
Structural Annotation β Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5g2p-assembly1.cif.gz_B | The crystal structure of a S-selective transaminase from Arthrobacter sp. | 0.718 | 168 | 208 |
| 1dhp-assembly1.cif.gz_A | DIHYDRODIPICOLINATE SYNTHASE | 0.651 | 83 | 178 |
| 4rh1-assembly1.cif.gz_A | Spore photoproduct lyase C140A/S76C mutant with bound AdoMet and dinucleoside spore photoproduct | 0.644 | 5 | 178 |
| 2eo0-assembly2.cif.gz_A | Crystal Structure of Holliday Junction Resolvase ST1444 | 0.63 | 174 | 208 |
| 4fhg-assembly1.cif.gz_A | Spore photoproduct lyase C140S mutant | 0.613 | 1 | 180 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6YA42_4_243_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9474 | 4 | 240 | 3.20.20.70 |
| 3b46A02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.7069 | 170 | 208 | 3.40.640.10 |
| af_P0A9N8_2_153_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.6021 | 57 | 109 | 3.20.20.70 |
| af_O69731_1_206_3.20.20.80 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.5975 | 67 | 182 | 3.20.20.80 |
| af_Q54KM6_55_307_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.5916 | 51 | 112 | 3.40.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q4AIK0-F1-model_v4 | Uncharacterized/unreviewed | 0.9938 | 124 | 240 | |
| AF-A0A7X9BVT4-F1-model_v4 | Uncharacterized/unreviewed | 0.9903 | 1 | 233 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.84 | 0.88 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.