Protein Family IF00697

Metagenome Isolate
125 Members
39 Samples
120 Scaffolds
469.82 Avg Length

🧬 Representative Sequence

ID
3300002450|JGI24695J34938_10038037|JGI24695J34938_100380372
Length
472 aa
Sequence
MDISFYSLGAAEEVTGSKHVIEIDGKSYLIDCGAFQGRRAEANEKNRKFGIAADKIEAAILTHGHYDHCGLLPLLVKNGYTGNIYATPASRDIASLIMMDSANIQARDAEYLRKQAKKKGEKFDWEPLYSEKDAIAATSQFLGVSYNRPIHISSDVKLEFFDAGHILGSALVMLTAKKDGKEVNILATGDLGRKGKPIIRDPATKTPPPDYIILESTYGDRLHENAEAAFDKLAEITQRMVKKRGKILIPAFAIERTQELVYYFHLLVDEGIIPEIPIFVDSPMATNATTIYQVHPECYGEEIKAAFIKHHKNPFGFNALHFTSSVTESKALNSRPGPFIIISADGMCEAGRIQHHLIHXIGDPNTTILTVGYMAQHTLGRRIRDKATEVXIHGMTLKRRAAVEEVNAFSAHADYAEATGWLKALDTSRLKTIFLVHGEPKAQSAFRKHLIGSGFPNVEIVKYGDVYNLNG*

📊 Sample Types

Isolate 4.0%
Metagenome 96.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 35.9%
Termitidae 35.9%
Unclassified 15.4%
Rhinotermitidae 7.7%
Termopsidae 5.1%

🌳 Taxonomy

Archaea 0
Bacteria 123
Eukaryota 0
Viruses 0
Unclassified 2

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
2 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
3 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
4 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
5 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
6 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
7 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
8 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
9 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
10 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
11 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
12 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
13 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
14 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
15 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
16 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
17 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
18 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
19 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
20 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
21 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
22 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
23 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
24 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
25 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
26 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
27 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
28 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
29 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
30 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
31 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
32 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
33 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
34 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
35 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
36 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
37 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
38 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
39 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_238128 3300042612 Bacteria 14245
2 Ga0466705_384625 3300042612 Bacteria 2289
3 Ga0466707_409540 3300042601 Bacteria 1740
4 Ga0466716_303248 3300042605 Bacteria 7783
5 Ga0466719_045829 3300042606 Bacteria 7595
6 Ga0466704_058484 3300042643 Bacteria 10605
7 Ga0466704_170992 3300042643 Unclassified 6876
8 Ga0466709_049864 3300042648 Bacteria 4339
9 Ga0466709_116657 3300042648 Bacteria 9050
10 Ga0466712_060985 3300042614 Bacteria 1477
11 Ga0123357_10010795 3300009784 Bacteria 11653
12 Ga0123356_10152424 3300010049 Bacteria 2297
13 Ga0123353_10243438 3300010167 Bacteria 2792
14 Ga0415639_085203 3300038395 Bacteria 6061
15 Ga0466691_092917 3300042593 Bacteria 16380
16 Ga0466694_244595 3300042594 Bacteria 2088
17 Ga0466696_027634 3300042596 Bacteria 23130
18 Ga0466696_342909 3300042596 Bacteria 12307
19 Ga0466705_090456 3300042612 Bacteria 5959
20 Ga0466716_045202 3300042605 Bacteria 7053
21 Ga0466719_045159 3300042606 Bacteria 3033
22 Ga0466719_209838 3300042606 Bacteria 13035
23 Ga0466722_127491 3300042609 Bacteria 4581
24 Ga0466703_146211 3300042636 Bacteria 3038
25 Ga0466703_427125 3300042636 Bacteria 22449
26 Ga0466704_052200 3300042643 Bacteria 11935
27 Ga0466727_337447 3300042655 Bacteria 7717
28 Ga0466712_060125 3300042614 Bacteria 2052
29 Ga0466723_072096 3300042618 Bacteria 8728
30 Ga0466728_020291 3300042620 Bacteria 11173
31 Ga0466690_140903 3300042590 Bacteria 4746
32 Ga0466691_048192 3300042593 Bacteria 4096
33 Ga0466705_093439 3300042612 Bacteria 8984
34 Ga0466704_017222 3300042643 Bacteria 5650
35 Ga0466709_334003 3300042648 Bacteria 9072
36 Ga0466708_082196 3300042652 Bacteria 10790
37 Ga0466723_126281 3300042618 Bacteria 6517
38 Ga0466723_344729 3300042618 Bacteria 2098
39 Ga0466726_363216 3300042619 Bacteria 1922
40 JGI24698J34947_10003697 3300002449 Bacteria 8322
41 Ga0123353_10236946 3300010167 Bacteria 2839
42 Ga0123354_10109433 3300010882 Bacteria 3661
43 Ga0466694_097362 3300042594 Bacteria 3291
44 Ga0466696_108645 3300042596 Bacteria 3065
45 Ga0466703_105319 3300042636 Bacteria 11490
46 Ga0466703_333259 3300042636 Bacteria 21872
47 Ga0466703_394768 3300042636 Bacteria 12728
48 Ga0466704_264950 3300042643 Bacteria 2671
49 Ga0466708_160776 3300042652 Bacteria 7921
50 Ga0466715_015169 3300042616 Bacteria 13317
51 JGI24698J34947_10000062 3300002449 Bacteria 33537
52 Ga0466696_038234 3300042596 Bacteria 10450
53 Ga0466696_039136 3300042596 Bacteria 3571
54 Ga0466696_100942 3300042596 Bacteria 13778
55 Ga0466696_483735 3300042596 Bacteria 5647
56 Ga0466704_553586 3300042643 Bacteria 8283
57 Ga0466709_184677 3300042648 Bacteria 6455
58 Ga0466708_185260 3300042652 Bacteria 27851
59 Ga0466708_309923 3300042652 Bacteria 15251
60 Ga0466705_478322 3300042612 Bacteria 2750
61 Ga0466711_140753 3300042615 Bacteria 2134
62 Ga0466718_027167 3300042617 Bacteria 2021
63 Ga0466726_375457 3300042619 Bacteria 4528
64 Ga0466728_115466 3300042620 Bacteria 2335
65 JGI24698J34947_10005137 3300002449 Bacteria 7171
66 JGI24698J34947_10020384 3300002449 Bacteria 3571
67 Ga0123357_10047596 3300009784 Bacteria 5811
68 Ga0466690_308869 3300042590 Bacteria 2732
69 Ga0466692_082745 3300042591 Bacteria 4359
70 Ga0466691_157463 3300042593 Bacteria 7532
71 Ga0466703_001130 3300042636 Bacteria 12075
72 Ga0466703_173126 3300042636 Bacteria 3253
73 Ga0466704_127033 3300042643 Bacteria 3075
74 Ga0466704_264549 3300042643 Bacteria 13510
75 Ga0466708_122619 3300042652 Bacteria 14870
76 Ga0466708_239688 3300042652 Bacteria 4777
77 Ga0466715_376037 3300042616 Bacteria 6156
78 Ga0466715_416570 3300042616 Bacteria 4263
79 Ga0466723_051587 3300042618 Bacteria 6859
80 Ga0466728_033874 3300042620 Bacteria 17572
81 Ga0466728_100704 3300042620 Bacteria 2209
82 Ga0466729_118870 3300042621 Bacteria 2754
83 JGI24698J34947_10002456 3300002449 Bacteria 9994
84 JGI24695J34938_10038037 3300002450 Bacteria 2181
85 JGI24702J35022_10000471 3300002462 Bacteria 24271
86 Ga0466690_381369 3300042590 Bacteria 3917
87 Ga0466712_135877 3300042614 Bacteria 43910
88 Ga0466718_107737 3300042617 Bacteria 57891
89 Ga0466723_218986 3300042618 Bacteria 5605
90 Ga0466728_283116 3300042620 Bacteria 14972
91 JGI24702J35022_10014153 3300002462 Bacteria 4405
92 JGI24702J35022_10019251 3300002462 Bacteria 3713
93 Ga0123353_10116452 3300010167 Bacteria 4300
94 Ga0123354_10211361 3300010882 Bacteria 2095
95 Ga0466692_058889 3300042591 Bacteria 41705
96 Ga0466693_376574 3300042592 Bacteria 10876
97 Ga0466691_030035 3300042593 Bacteria 13573
98 Ga0466694_151076 3300042594 Bacteria 2145
99 Ga0466705_102753 3300042612 Unclassified 3244
100 Ga0466707_357899 3300042601 Bacteria 2127
101 Ga0466716_224053 3300042605 Bacteria 6035
102 Ga0466719_457762 3300042606 Bacteria 12202
103 Ga0466703_365703 3300042636 Bacteria 3026
104 Ga0466704_480269 3300042643 Bacteria 7058
105 Ga0466709_093376 3300042648 Bacteria 8279
106 Ga0466712_053470 3300042614 Bacteria 21567
107 Ga0466711_273382 3300042615 Bacteria 13808
108 Ga0466715_266587 3300042616 Bacteria 13713
109 Ga0466715_271739 3300042616 Bacteria 19479
110 Ga0466723_314266 3300042618 Bacteria 2896
111 Ga0466723_318382 3300042618 Bacteria 7015
112 Ga0466728_258477 3300042620 Bacteria 15917
113 Ga0466729_135712 3300042621 Bacteria 2409
114 JGI24702J35022_10036995 3300002462 Bacteria 2608
115 Ga0123353_10217159 3300010167 Bacteria 2994
116 Ga0123353_10247360 3300010167 Bacteria 2765
117 Ga0123353_10372199 3300010167 Bacteria 2141
118 Ga0466694_401871 3300042594 Bacteria 8423
119 Ga0466695_406261 3300042595 Bacteria 8431
120 Ga0466699_003870 3300042597 Bacteria 6783

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042619 Ga0466726_363216 Ga0466726_363216_547_1896 449
2 3300042590 Ga0466690_381369 Ga0466690_381369_1967_3370 467
3 3300042596 Ga0466696_038234 Ga0466696_038234_8197_9600 467
4 3300042596 Ga0466696_483735 Ga0466696_483735_3395_4798 467
5 3300042605 Ga0466716_303248 Ga0466716_303248_1392_2795 467
6 3300042606 Ga0466719_209838 Ga0466719_209838_5766_7169 467
7 3300042612 Ga0466705_090456 Ga0466705_090456_2746_4149 467
8 3300042612 Ga0466705_384625 Ga0466705_384625_361_1764 467
9 3300042616 Ga0466715_015169 Ga0466715_015169_9953_11356 467
10 3300042618 Ga0466723_126281 Ga0466723_126281_925_2328 467
11 3300042620 Ga0466728_033874 Ga0466728_033874_10701_12104 467
12 3300042636 Ga0466703_333259 Ga0466703_333259_11630_13033 467
13 3300042643 Ga0466704_058484 Ga0466704_058484_5873_7276 467
14 3300042648 Ga0466709_184677 Ga0466709_184677_941_2344 467
15 3300042648 Ga0466709_334003 Ga0466709_334003_1197_2600 467
16 3300042652 Ga0466708_160776 Ga0466708_160776_30_1433 467
17 3300042655 Ga0466727_337447 Ga0466727_337447_4011_5414 467
18 3300042590 Ga0466690_140903 Ga0466690_140903_372_1778 468
19 3300042591 Ga0466692_058889 Ga0466692_058889_38895_40301 468
20 3300042593 Ga0466691_030035 Ga0466691_030035_10800_12206 468
21 3300042596 Ga0466696_342909 Ga0466696_342909_10003_11409 468
22 3300042614 Ga0466712_135877 Ga0466712_135877_2994_4400 468
23 3300042618 Ga0466723_318382 Ga0466723_318382_747_2153 468
24 3300042618 Ga0466723_344729 Ga0466723_344729_513_1919 468
25 3300042620 Ga0466728_020291 Ga0466728_020291_792_2198 468
26 3300042620 Ga0466728_100704 Ga0466728_100704_232_1638 468
27 3300042643 Ga0466704_017222 Ga0466704_017222_3517_4923 468
28 3300042643 Ga0466704_264549 Ga0466704_264549_4860_6266 468
29 3300042643 Ga0466704_264950 Ga0466704_264950_325_1731 468
30 3300042648 Ga0466709_116657 Ga0466709_116657_1833_3239 468
31 3300042590 Ga0466690_308869 Ga0466690_308869_1217_2626 469
32 3300042591 Ga0466692_082745 Ga0466692_082745_2929_4338 469
33 3300042593 Ga0466691_048192 Ga0466691_048192_2301_3710 469
34 3300042593 Ga0466691_092917 Ga0466691_092917_6231_7640 469
35 3300042595 Ga0466695_406261 Ga0466695_406261_3550_4959 469
36 3300042596 Ga0466696_027634 Ga0466696_027634_16612_18021 469
37 3300042596 Ga0466696_100942 Ga0466696_100942_1760_3169 469
38 3300042596 Ga0466696_108645 Ga0466696_108645_1619_3028 469
39 3300042597 Ga0466699_003870 Ga0466699_003870_5302_6711 469
40 3300042601 Ga0466707_357899 Ga0466707_357899_708_2117 469
41 3300042601 Ga0466707_409540 Ga0466707_409540_123_1532 469
42 3300042605 Ga0466716_045202 Ga0466716_045202_937_2346 469
43 3300042605 Ga0466716_224053 Ga0466716_224053_4387_5796 469
44 3300042606 Ga0466719_045159 Ga0466719_045159_1154_2563 469
45 3300042606 Ga0466719_457762 Ga0466719_457762_410_1819 469
46 3300042609 Ga0466722_127491 Ga0466722_127491_2478_3887 469
47 3300042612 Ga0466705_093439 Ga0466705_093439_7223_8632 469
48 3300042612 Ga0466705_102753 Ga0466705_102753_383_1792 469
49 3300042614 Ga0466712_060125 Ga0466712_060125_381_1790 469
50 3300042615 Ga0466711_140753 Ga0466711_140753_273_1682 469
51 3300042615 Ga0466711_273382 Ga0466711_273382_10433_11842 469
52 3300042616 Ga0466715_266587 Ga0466715_266587_11857_13266 469
53 3300042616 Ga0466715_271739 Ga0466715_271739_14483_15892 469
54 3300042616 Ga0466715_376037 Ga0466715_376037_3618_5027 469
55 3300042616 Ga0466715_416570 Ga0466715_416570_2383_3792 469
56 3300042618 Ga0466723_051587 Ga0466723_051587_1879_3288 469
57 3300042618 Ga0466723_072096 Ga0466723_072096_3557_4966 469
58 3300042618 Ga0466723_218986 Ga0466723_218986_1601_3010 469
59 3300042619 Ga0466726_375457 Ga0466726_375457_2428_3837 469
60 3300042620 Ga0466728_115466 Ga0466728_115466_294_1703 469
61 3300042620 Ga0466728_258477 Ga0466728_258477_14258_15667 469
62 3300042620 Ga0466728_283116 Ga0466728_283116_10084_11493 469
63 3300042621 Ga0466729_118870 Ga0466729_118870_75_1484 469
64 3300042636 Ga0466703_001130 Ga0466703_001130_2505_3914 469
65 3300042636 Ga0466703_105319 Ga0466703_105319_4684_6093 469
66 3300042636 Ga0466703_146211 Ga0466703_146211_1336_2745 469
67 3300042636 Ga0466703_173126 Ga0466703_173126_1267_2676 469
68 3300042636 Ga0466703_394768 Ga0466703_394768_1537_2946 469
69 3300042636 Ga0466703_427125 Ga0466703_427125_14611_16020 469
70 3300042643 Ga0466704_052200 Ga0466704_052200_7526_8935 469
71 3300042643 Ga0466704_127033 Ga0466704_127033_741_2150 469
72 3300042643 Ga0466704_170992 Ga0466704_170992_1127_2536 469
73 3300042643 Ga0466704_480269 Ga0466704_480269_3547_4956 469
74 3300042648 Ga0466709_049864 Ga0466709_049864_788_2197 469
75 3300042648 Ga0466709_093376 Ga0466709_093376_5339_6748 469
76 3300042652 Ga0466708_082196 Ga0466708_082196_1765_3174 469
77 3300042652 Ga0466708_122619 Ga0466708_122619_9074_10483 469
78 3300042652 Ga0466708_239688 Ga0466708_239688_2293_3702 469
79 3300042652 Ga0466708_309923 Ga0466708_309923_11004_12413 469
80 iso_pr_bacteria 2781125694 2781435985 469
81 iso_pr_bacteria 650716099 650877526 469
82 3300002449 JGI24698J34947_10000062 JGI24698J34947_1000006230 470
83 3300002449 JGI24698J34947_10020384 JGI24698J34947_100203842 470
84 3300010049 Ga0123356_10152424 Ga0123356_101524242 470
85 3300010167 Ga0123353_10116452 Ga0123353_101164522 470
86 3300010167 Ga0123353_10243438 Ga0123353_102434382 470
87 3300010167 Ga0123353_10372199 Ga0123353_103721993 470
88 3300010882 Ga0123354_10109433 Ga0123354_101094332 470
89 3300038395 Ga0415639_085203 Ga0415639_085203_924_2336 470
90 3300042594 Ga0466694_151076 Ga0466694_151076_240_1652 470
91 3300042594 Ga0466694_244595 Ga0466694_244595_68_1480 470
92 3300042594 Ga0466694_401871 Ga0466694_401871_2391_3803 470
93 3300042612 Ga0466705_478322 Ga0466705_478322_696_2108 470
94 3300042614 Ga0466712_053470 Ga0466712_053470_14243_15655 470
95 3300042614 Ga0466712_060985 Ga0466712_060985_36_1448 470
96 3300042617 Ga0466718_027167 Ga0466718_027167_103_1515 470
97 iso_pr_bacteria 2781125697 2781443697 470
98 3300002449 JGI24698J34947_10003697 JGI24698J34947_100036974 471
99 3300002449 JGI24698J34947_10005137 JGI24698J34947_100051372 471
100 3300002462 JGI24702J35022_10019251 JGI24702J35022_100192513 471
101 3300002462 JGI24702J35022_10036995 JGI24702J35022_100369952 471
102 3300009784 Ga0123357_10010795 Ga0123357_100107954 471
103 3300009784 Ga0123357_10047596 Ga0123357_100475964 471
104 3300010167 Ga0123353_10217159 Ga0123353_102171592 471
105 3300010167 Ga0123353_10236946 Ga0123353_102369462 471
106 3300010167 Ga0123353_10247360 Ga0123353_102473603 471
107 3300042592 Ga0466693_376574 Ga0466693_376574_6192_7607 471
108 3300042612 Ga0466705_238128 Ga0466705_238128_12625_14040 471
109 3300042621 Ga0466729_135712 Ga0466729_135712_853_2268 471
110 3300042636 Ga0466703_365703 Ga0466703_365703_32_1447 471
111 iso_pr_bacteria 2781125690 2781427173 471
112 3300002450 JGI24695J34938_10038037 JGI24695J34938_100380372 472
113 3300002462 JGI24702J35022_10014153 JGI24702J35022_100141534 472
114 3300010882 Ga0123354_10211361 Ga0123354_102113612 472
115 3300042596 Ga0466696_039136 Ga0466696_039136_396_1814 472
116 3300042606 Ga0466719_045829 Ga0466719_045829_2777_4195 472
117 3300002462 JGI24702J35022_10000471 JGI24702J35022_100004716 474
118 3300042593 Ga0466691_157463 Ga0466691_157463_5485_6915 476
119 3300002449 JGI24698J34947_10002456 JGI24698J34947_100024566 477
120 3300042643 Ga0466704_553586 Ga0466704_553586_442_1875 477
121 3300042618 Ga0466723_314266 Ga0466723_314266_813_2252 479
122 3300042594 Ga0466694_097362 Ga0466694_097362_1531_2979 482
123 iso_pr_bacteria 2781125632 2781271648 482
124 3300042617 Ga0466718_107737 Ga0466718_107737_48365_49840 491
125 3300042652 Ga0466708_185260 Ga0466708_185260_8128_9606 492

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF10996 Beta-Casp Beta-Casp domain 257 383 0.99
PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain 397 454 0.91
PF00753 Lactamase_B Metallo-beta-lactamase superfamily 20 85 0.9
PF16661 Lactamase_B_6 Metallo-beta-lactamase superfamily domain 21 178 0.83
PF12706 Lactamase_B_2 Beta-lactamase superfamily domain 28 90 0.71

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.