Protein Family IF00694

Metagenome Isolate
202 Members
52 Samples
201 Scaffolds
570.41 Avg Length

🧬 Representative Sequence

ID
3300002450|JGI24695J34938_10036765|JGI24695J34938_100367651
Length
636 aa
Sequence
MPFKYLTNVPRLFGSTIKQVKSNKLEISMPSRHIFLSTFCEKWLHVVACCDIIGFKMRCVIMYLKKATSKKTGRTHLSIAHGYRNSAGKSTSKTIKILGYLDELEKEYDDPIAHFTAVAAEMDKERLANKTISVTLEKDGQLERGAANRKNYGHVVFSKIYHELELDRFFKNARRHENFKFNTDAIMRLLVYTRLLYPGSKRAAILNKDMFFDNFNFSLDDVYDALTHFDKISSSVQQHLHEQVTRQYNRETDLVYYDVSNYYFEIDKQDEFRKKGAEKNNRKDPIVQMGLLLDKGGLPISYKLFPGNTHDSQTLMPVLSDIKKNFGVNRIISVADKGLNSGDNIAYATVLGDGYIYSKSVRGASAEFKKWMFDNDGYRYGADGFKIKSMVVPDALINVTTKHVGKRKYKKEHRVEQKWVVFYSKKYAERARHKREEAIAKAMKMIENPSKYRRTFDYGAAGYIKNLKVDKNSGEIISLDDTLILDIEKIKAEEMYDGYYAIVTSELDDTDEHIVDMYRGLWRIEDSFKVTKSVLGTRPIYLQLEEHINAHFLTCFISLLIARLVELRLGGKYTIANITDSLRKVACSNIDQNHWLFDYADEITDDMNAVFATDFGKRVMTLKEIKKNLGETKQR*

📊 Sample Types

Isolate 0.5%
Metagenome 99.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 57.7%
Kalotermitidae 26.9%
Unclassified 5.8%
Rhinotermitidae 3.8%
Termopsidae 3.8%
Passalidae 1.9%

🌳 Taxonomy

Archaea 0
Bacteria 187
Eukaryota 0
Viruses 0
Unclassified 15

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
2 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
3 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
4 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
5 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
6 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
7 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
8 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
9 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
10 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
11 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
12 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
13 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
14 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
15 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
16 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
17 2820324456 Unclassified Firmicutes Nt197P3bin80 Isolate Unclassified
18 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
19 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
20 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
21 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
22 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
23 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
24 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
25 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
26 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
27 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
28 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
29 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
30 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
31 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
32 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
33 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
34 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
35 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
36 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
37 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
38 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
39 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
40 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
41 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
42 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
43 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
44 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
45 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
46 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
47 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
48 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
49 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
50 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
51 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
52 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_233946 3300042611 Bacteria 2200
2 Ga0466733_088214 3300042659 Unclassified 3317
3 Ga0466702_120834 3300042635 Unclassified 2315
4 Ga0466725_004157 3300042654 Unclassified 2124
5 Ga0466725_457729 3300042654 Bacteria 2351
6 Ga0466691_114491 3300042593 Bacteria 2484
7 Ga0466696_273766 3300042596 Bacteria 2959
8 Ga0466710_253308 3300042613 Bacteria 2891
9 Ga0466718_012934 3300042617 Bacteria 1933
10 Ga0466723_007149 3300042618 Bacteria 2761
11 Ga0466728_138107 3300042620 Bacteria 3010
12 Ga0466700_205344 3300042600 Bacteria 1980
13 Ga0466714_011175 3300042603 Bacteria 3799
14 Ga0466717_193703 3300042604 Bacteria 2100
15 Ga0466716_367116 3300042605 Bacteria 4323
16 Ga0466716_548194 3300042605 Unclassified 2203
17 Ga0466719_060152 3300042606 Bacteria 3525
18 Ga0466722_232848 3300042609 Bacteria 2662
19 Ga0123357_10198320 3300009784 Bacteria 2292
20 Ga0123355_10218638 3300009826 Bacteria 2745
21 Ga0123355_10272349 3300009826 Bacteria 2350
22 Ga0123356_10079291 3300010049 Unclassified 3101
23 Ga0123356_10195903 3300010049 Bacteria 2056
24 Ga0123353_10105809 3300010167 Bacteria 4534
25 Ga0123353_10293795 3300010167 Bacteria 2486
26 Ga0123353_10341334 3300010167 Unclassified 2262
27 Ga0123354_10181041 3300010882 Bacteria 2406
28 JGI24702J35022_10016116 3300002462 Bacteria 4103
29 Ga0068305_10412525 3300005083 Bacteria 2220
30 Ga0466697_120253 3300042611 Bacteria 3020
31 Ga0466705_248609 3300042612 Bacteria 3097
32 Ga0466705_341258 3300042612 Bacteria 2433
33 Ga0466705_383531 3300042612 Bacteria 2178
34 Ga0466729_274272 3300042621 Bacteria 2931
35 Ga0466731_217067 3300042622 Bacteria 2001
36 Ga0466734_014050 3300042623 Bacteria 2330
37 Ga0466703_120391 3300042636 Bacteria 2960
38 Ga0466725_450549 3300042654 Bacteria 2592
39 Ga0466656_053294 3300042550 Bacteria 1806
40 Ga0466693_007011 3300042592 Bacteria 1984
41 Ga0466693_145604 3300042592 Bacteria 3224
42 Ga0466694_217456 3300042594 Unclassified 2211
43 Ga0466696_021245 3300042596 Bacteria 2270
44 Ga0466696_021761 3300042596 Bacteria 2535
45 Ga0466710_008282 3300042613 Bacteria 2496
46 Ga0466707_264622 3300042601 Bacteria 1640
47 Ga0466707_390891 3300042601 Bacteria 2413
48 Ga0466697_025597 3300042611 Bacteria 3709
49 Ga0123356_10093124 3300010049 Bacteria 2875
50 Ga0123356_10111940 3300010049 Bacteria 2638
51 Ga0123356_10126056 3300010049 Bacteria 2500
52 Ga0123353_10267790 3300010167 Bacteria 2634
53 Ga0123353_10375330 3300010167 Bacteria 2130
54 Ga0123353_10404043 3300010167 Bacteria 2031
55 JGI24695J34938_10043136 3300002450 Bacteria 2014
56 JGI24705J35276_12215182 3300002504 Bacteria 1992
57 JGI24705J35276_12223833 3300002504 Bacteria 2548
58 Ga0466705_100390 3300042612 Bacteria 2585
59 Ga0466729_296430 3300042621 Bacteria 2327
60 Ga0466731_008018 3300042622 Bacteria 2385
61 Ga0466734_016258 3300042623 Bacteria 3154
62 Ga0466734_150661 3300042623 Bacteria 2247
63 Ga0466735_036217 3300042624 Bacteria 2180
64 Ga0466702_331096 3300042635 Bacteria 2169
65 Ga0466703_320718 3300042636 Bacteria 5813
66 Ga0466704_099316 3300042643 Bacteria 2255
67 Ga0466724_21655 3300042649 Bacteria 2149
68 Ga0466725_215339 3300042654 Bacteria 2228
69 Ga0466727_243606 3300042655 Bacteria 2081
70 Ga0415639_155533 3300038395 Bacteria 2349
71 Ga0466656_353676 3300042550 Bacteria 1993
72 Ga0466657_333625 3300042582 Bacteria 1893
73 Ga0466694_113666 3300042594 Unclassified 5027
74 Ga0466710_002162 3300042613 Bacteria 2936
75 Ga0466728_360204 3300042620 Bacteria 2151
76 Ga0466700_458069 3300042600 Bacteria 2068
77 Ga0123356_10086274 3300010049 Bacteria 2979
78 Ga0123356_10128246 3300010049 Bacteria 2481
79 Ga0123356_10138130 3300010049 Unclassified 2400
80 Ga0123353_10335159 3300010167 Bacteria 2288
81 Ga0123353_10352719 3300010167 Bacteria 2216
82 Ga0123354_10147668 3300010882 Unclassified 2868
83 2227570742 2225789004 Bacteria 2616
84 Ga0466705_018596 3300042612 Bacteria 2163
85 Ga0466733_122948 3300042659 Bacteria 2946
86 Ga0466734_148969 3300042623 Bacteria 2243
87 Ga0466734_163663 3300042623 Bacteria 2292
88 Ga0466704_543231 3300042643 Bacteria 2396
89 Ga0466657_053539 3300042582 Bacteria 2168
90 Ga0466657_192203 3300042582 Bacteria 1961
91 Ga0466690_318262 3300042590 Bacteria 3891
92 Ga0466693_301153 3300042592 Bacteria 2563
93 Ga0466696_252316 3300042596 Bacteria 2688
94 Ga0466711_398143 3300042615 Bacteria 2116
95 Ga0466723_045788 3300042618 Bacteria 4925
96 Ga0466723_061446 3300042618 Bacteria 3425
97 Ga0466700_038517 3300042600 Bacteria 2193
98 Ga0466714_053244 3300042603 Bacteria 2095
99 Ga0123355_10239922 3300009826 Bacteria 2570
100 Ga0123353_10340217 3300010167 Bacteria 2266
101 JGI24702J35022_10019271 3300002462 Bacteria 3710
102 Ga0466697_111831 3300042611 Bacteria 3050
103 Ga0466729_309295 3300042621 Bacteria 2056
104 Ga0466734_056746 3300042623 Bacteria 2133
105 Ga0466734_111974 3300042623 Bacteria 2074
106 Ga0466702_091861 3300042635 Bacteria 2177
107 Ga0466708_305064 3300042652 Bacteria 3057
108 Ga0466708_338515 3300042652 Bacteria 3513
109 Ga0466725_100614 3300042654 Bacteria 2330
110 Ga0466656_275528 3300042550 Bacteria 1926
111 Ga0466701_012954 3300042598 Bacteria 2476
112 Ga0466718_166037 3300042617 Bacteria 2345
113 Ga0466729_136962 3300042621 Bacteria 2296
114 Ga0466700_016488 3300042600 Bacteria 2840
115 Ga0466700_176320 3300042600 Bacteria 2501
116 Ga0466716_492156 3300042605 Bacteria 4025
117 Ga0466721_389566 3300042608 Bacteria 2140
118 Ga0466722_059513 3300042609 Bacteria 2696
119 Ga0123357_10136701 3300009784 Bacteria 3028
120 Ga0123356_10176931 3300010049 Bacteria 2151
121 Ga0123353_10330182 3300010167 Unclassified 2309
122 JGI24695J34938_10031889 3300002450 Unclassified 2440
123 JGI24702J35022_10048944 3300002462 Bacteria 2251
124 JGI24705J35276_12213647 3300002504 Unclassified 1931
125 JGI24700J35501_10876212 3300002508 Bacteria 2347
126 Ga0068305_10009653 3300005083 Bacteria 2422
127 Ga0466705_156778 3300042612 Bacteria 3017
128 Ga0466705_354663 3300042612 Bacteria 4209
129 Ga0466734_009169 3300042623 Bacteria 2312
130 Ga0466735_071419 3300042624 Bacteria 2761
131 Ga0466703_005098 3300042636 Bacteria 4329
132 Ga0466703_318337 3300042636 Bacteria 3203
133 Ga0466708_152114 3300042652 Bacteria 4261
134 Ga0466725_257552 3300042654 Bacteria 2701
135 Ga0466725_379002 3300042654 Bacteria 2570
136 Ga0466693_078927 3300042592 Bacteria 2169
137 Ga0466693_338502 3300042592 Bacteria 2442
138 Ga0466715_507823 3300042616 Bacteria 2398
139 Ga0466718_060661 3300042617 Bacteria 2583
140 Ga0466718_161185 3300042617 Bacteria 2335
141 Ga0466728_036434 3300042620 Bacteria 2328
142 Ga0466700_160039 3300042600 Bacteria 2043
143 Ga0466721_164386 3300042608 Bacteria 2481
144 Ga0466698_282649 3300042610 Unclassified 2925
145 Ga0123355_10340954 3300009826 Bacteria 1996
146 Ga0123356_10183752 3300010049 Bacteria 2115
147 Ga0123356_10186989 3300010049 Bacteria 2099
148 Ga0123353_10306690 3300010167 Bacteria 2419
149 Ga0123353_10319114 3300010167 Bacteria 2359
150 Ga0123353_10359534 3300010167 Bacteria 2189
151 Ga0123353_10399554 3300010167 Bacteria 2046
152 Ga0123353_10470529 3300010167 Bacteria 1843
153 Ga0123354_10169473 3300010882 Bacteria 2549
154 JGI24696J40584_12948505 3300002834 Bacteria 2009
155 Ga0466705_127093 3300042612 Bacteria 1631
156 Ga0466734_080897 3300042623 Bacteria 2775
157 Ga0466734_136660 3300042623 Bacteria 2124
158 Ga0466703_209313 3300042636 Bacteria 2134
159 Ga0466703_269797 3300042636 Bacteria 11024
160 Ga0466704_117417 3300042643 Bacteria 2521
161 Ga0466704_135507 3300042643 Bacteria 2174
162 Ga0466657_400010 3300042582 Bacteria 2144
163 Ga0466693_103825 3300042592 Bacteria 2039
164 Ga0466693_159289 3300042592 Bacteria 2233
165 Ga0466723_269590 3300042618 Bacteria 7901
166 Ga0466700_121935 3300042600 Bacteria 2134
167 JGI24695J34938_10036765 3300002450 Bacteria 2230
168 JGI24702J35022_10035704 3300002462 Bacteria 2658
169 Ga0466733_106548 3300042659 Bacteria 2794
170 Ga0466735_175112 3300042624 Bacteria 2137
171 Ga0466702_052047 3300042635 Bacteria 2694
172 Ga0466709_345495 3300042648 Bacteria 2279
173 Ga0466708_255569 3300042652 Bacteria 2210
174 Ga0466727_142082 3300042655 Bacteria 2966
175 Ga0466727_229183 3300042655 Bacteria 3053
176 Ga0466656_134004 3300042550 Bacteria 2871
177 Ga0466656_145453 3300042550 Bacteria 2138
178 Ga0466656_337191 3300042550 Bacteria 2305
179 Ga0466691_057662 3300042593 Bacteria 3166
180 Ga0466696_152006 3300042596 Bacteria 2239
181 Ga0466696_282968 3300042596 Bacteria 2203
182 Ga0466710_142790 3300042613 Bacteria 2167
183 Ga0466710_205503 3300042613 Bacteria 2411
184 Ga0466711_155976 3300042615 Bacteria 2975
185 Ga0466715_092337 3300042616 Bacteria 1864
186 Ga0466718_030895 3300042617 Bacteria 2185
187 Ga0466701_043145 3300042598 Bacteria 2105
188 Ga0466701_059404 3300042598 Bacteria 2007
189 Ga0466714_049384 3300042603 Bacteria 2939
190 Ga0466719_292498 3300042606 Bacteria 4235
191 Ga0466697_012202 3300042611 Bacteria 2744
192 Ga0123357_10223325 3300009784 Bacteria 2084
193 Ga0123356_10061643 3300010049 Bacteria 3503
194 Ga0123356_10111417 3300010049 Bacteria 2644
195 Ga0123356_10150729 3300010049 Unclassified 2308
196 Ga0123356_10223321 3300010049 Bacteria 1942
197 Ga0123353_10210890 3300010167 Bacteria 3046
198 Ga0123353_10249211 3300010167 Bacteria 2752
199 Ga0123353_10329732 3300010167 Bacteria 2311
200 JGI24702J35022_10063853 3300002462 Bacteria 1973
201 JGI24705J35276_12226513 3300002504 Bacteria 2867

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042605 Ga0466716_548194 Ga0466716_548194_294_1883 508
2 3300042601 Ga0466707_264622 Ga0466707_264622_25_1569 514
3 3300042655 Ga0466727_142082 Ga0466727_142082_218_1762 514
4 3300010049 Ga0123356_10223321 Ga0123356_102233211 519
5 3300042598 Ga0466701_043145 Ga0466701_043145_220_1947 527
6 3300042600 Ga0466700_160039 Ga0466700_160039_253_1971 527
7 3300009784 Ga0123357_10223325 Ga0123357_102233252 528
8 3300042612 Ga0466705_127093 Ga0466705_127093_19_1605 528
9 3300042550 Ga0466656_145453 Ga0466656_145453_334_2034 529
10 3300042601 Ga0466707_390891 Ga0466707_390891_229_1947 530
11 3300042611 Ga0466697_111831 Ga0466697_111831_1054_2652 532
12 3300010049 Ga0123356_10176931 Ga0123356_101769311 534
13 3300038395 Ga0415639_155533 Ga0415639_155533_120_1727 535
14 3300010049 Ga0123356_10195903 Ga0123356_101959031 539
15 3300042590 Ga0466690_318262 Ga0466690_318262_1406_3028 540
16 3300042618 Ga0466723_007149 Ga0466723_007149_468_2090 540
17 3300042648 Ga0466709_345495 Ga0466709_345495_97_1719 540
18 3300010167 Ga0123353_10470529 Ga0123353_104705291 541
19 3300042603 Ga0466714_053244 Ga0466714_053244_186_1910 542
20 3300010049 Ga0123356_10086274 Ga0123356_100862742 544
21 3300042635 Ga0466702_052047 Ga0466702_052047_431_2071 546
22 3300042620 Ga0466728_360204 Ga0466728_360204_192_1835 547
23 3300042636 Ga0466703_320718 Ga0466703_320718_150_1916 547
24 3300010049 Ga0123356_10093124 Ga0123356_100931242 549
25 3300010167 Ga0123353_10359534 Ga0123353_103595341 549
26 3300042623 Ga0466734_016258 Ga0466734_016258_400_2106 549
27 3300042621 Ga0466729_274272 Ga0466729_274272_270_1994 553
28 3300042609 Ga0466722_232848 Ga0466722_232848_97_1824 554
29 3300042652 Ga0466708_338515 Ga0466708_338515_1580_3244 554
30 3300042550 Ga0466656_053294 Ga0466656_053294_21_1694 557
31 3300042654 Ga0466725_004157 Ga0466725_004157_241_1968 557
32 3300010167 Ga0123353_10399554 Ga0123353_103995541 558
33 3300010167 Ga0123353_10375330 Ga0123353_103753302 559
34 3300042600 Ga0466700_016488 Ga0466700_016488_562_2286 559
35 3300042608 Ga0466721_389566 Ga0466721_389566_227_1987 559
36 3300042592 Ga0466693_103825 Ga0466693_103825_101_1807 560
37 3300042592 Ga0466693_159289 Ga0466693_159289_196_1905 560
38 3300042623 Ga0466734_150661 Ga0466734_150661_183_1901 560
39 3300002462 JGI24702J35022_10016116 JGI24702J35022_100161164 561
40 3300042623 Ga0466734_111974 Ga0466734_111974_83_1819 561
41 3300042600 Ga0466700_176320 Ga0466700_176320_614_2338 563
42 3300042613 Ga0466710_002162 Ga0466710_002162_824_2551 563
43 3300002462 JGI24702J35022_10048944 JGI24702J35022_100489441 564
44 3300042611 Ga0466697_233946 Ga0466697_233946_158_1885 564
45 3300042594 Ga0466694_113666 Ga0466694_113666_3121_4845 565
46 3300010167 Ga0123353_10249211 Ga0123353_102492112 566
47 3300042600 Ga0466700_205344 Ga0466700_205344_93_1823 566
48 3300042612 Ga0466705_156778 Ga0466705_156778_973_2727 566
49 3300042635 Ga0466702_120834 Ga0466702_120834_117_2132 566
50 3300002462 JGI24702J35022_10035704 JGI24702J35022_100357042 567
51 3300010049 Ga0123356_10111417 Ga0123356_101114171 567
52 3300010167 Ga0123353_10306690 Ga0123353_103066902 567
53 3300042611 Ga0466697_012202 Ga0466697_012202_719_2422 567
54 3300042654 Ga0466725_450549 Ga0466725_450549_230_1933 567
55 3300002508 JGI24700J35501_10876212 JGI24700J35501_108762122 568
56 3300010167 Ga0123353_10267790 Ga0123353_102677902 568
57 3300042582 Ga0466657_053539 Ga0466657_053539_154_1881 568
58 3300042605 Ga0466716_367116 Ga0466716_367116_1464_3188 568
59 3300042617 Ga0466718_060661 Ga0466718_060661_281_1987 568
60 3300042618 Ga0466723_045788 Ga0466723_045788_2670_4409 568
61 3300042654 Ga0466725_379002 Ga0466725_379002_196_1923 568
62 3300042615 Ga0466711_398143 Ga0466711_398143_359_2068 569
63 3300042636 Ga0466703_005098 Ga0466703_005098_1652_3436 569
64 3300042636 Ga0466703_120391 Ga0466703_120391_99_1823 569
65 3300042649 Ga0466724_21655 Ga0466724_21655_242_1999 569
66 3300042655 Ga0466727_229183 Ga0466727_229183_647_2371 569
67 3300010049 Ga0123356_10150729 Ga0123356_101507291 570
68 3300042550 Ga0466656_275528 Ga0466656_275528_20_1768 570
69 3300042600 Ga0466700_038517 Ga0466700_038517_204_1931 570
70 3300042610 Ga0466698_282649 Ga0466698_282649_282_1994 570
71 3300042623 Ga0466734_056746 Ga0466734_056746_179_1939 570
72 3300042594 Ga0466694_217456 Ga0466694_217456_353_2068 571
73 3300042654 Ga0466725_100614 Ga0466725_100614_430_2145 571
74 3300009826 Ga0123355_10272349 Ga0123355_102723492 572
75 3300042592 Ga0466693_301153 Ga0466693_301153_468_2186 572
76 3300042618 Ga0466723_061446 Ga0466723_061446_1117_2835 572
77 3300042652 Ga0466708_152114 Ga0466708_152114_795_2513 572
78 3300042550 Ga0466656_337191 Ga0466656_337191_311_2032 573
79 3300042550 Ga0466656_353676 Ga0466656_353676_153_1874 573
80 3300042592 Ga0466693_078927 Ga0466693_078927_289_2010 573
81 3300042598 Ga0466701_012954 Ga0466701_012954_324_2045 573
82 3300042612 Ga0466705_383531 Ga0466705_383531_278_1999 573
83 3300042621 Ga0466729_136962 Ga0466729_136962_253_1974 573
84 3300042622 Ga0466731_008018 Ga0466731_008018_427_2196 573
85 3300010049 Ga0123356_10079291 Ga0123356_100792911 574
86 3300010167 Ga0123353_10335159 Ga0123353_103351593 574
87 3300042582 Ga0466657_192203 Ga0466657_192203_96_1820 574
88 3300042582 Ga0466657_333625 Ga0466657_333625_38_1762 574
89 3300042592 Ga0466693_007011 Ga0466693_007011_67_1791 574
90 3300042592 Ga0466693_145604 Ga0466693_145604_819_2543 574
91 3300042596 Ga0466696_021245 Ga0466696_021245_272_1996 574
92 3300042596 Ga0466696_282968 Ga0466696_282968_99_1823 574
93 3300042600 Ga0466700_121935 Ga0466700_121935_219_1943 574
94 3300042604 Ga0466717_193703 Ga0466717_193703_210_1934 574
95 3300042609 Ga0466722_059513 Ga0466722_059513_494_2218 574
96 3300042612 Ga0466705_018596 Ga0466705_018596_218_1942 574
97 3300042612 Ga0466705_100390 Ga0466705_100390_166_1890 574
98 3300042612 Ga0466705_341258 Ga0466705_341258_425_2149 574
99 3300042613 Ga0466710_008282 Ga0466710_008282_295_2019 574
100 3300042616 Ga0466715_092337 Ga0466715_092337_121_1845 574
101 3300042616 Ga0466715_507823 Ga0466715_507823_505_2229 574
102 3300042617 Ga0466718_012934 Ga0466718_012934_99_1823 574
103 3300042620 Ga0466728_138107 Ga0466728_138107_350_2074 574
104 3300042621 Ga0466729_296430 Ga0466729_296430_114_1838 574
105 3300042621 Ga0466729_309295 Ga0466729_309295_67_1791 574
106 3300042623 Ga0466734_080897 Ga0466734_080897_689_2413 574
107 3300042623 Ga0466734_148969 Ga0466734_148969_191_1915 574
108 3300042624 Ga0466735_036217 Ga0466735_036217_181_1905 574
109 3300042624 Ga0466735_175112 Ga0466735_175112_199_1923 574
110 3300042636 Ga0466703_209313 Ga0466703_209313_180_1904 574
111 3300042643 Ga0466704_099316 Ga0466704_099316_255_1979 574
112 3300042643 Ga0466704_117417 Ga0466704_117417_699_2423 574
113 3300042643 Ga0466704_135507 Ga0466704_135507_166_1890 574
114 3300042654 Ga0466725_257552 Ga0466725_257552_746_2470 574
115 3300002450 JGI24695J34938_10043136 JGI24695J34938_100431361 575
116 3300002462 JGI24702J35022_10063853 JGI24702J35022_100638531 575
117 3300002504 JGI24705J35276_12213647 JGI24705J35276_122136471 575
118 3300002504 JGI24705J35276_12223833 JGI24705J35276_122238331 575
119 3300002834 JGI24696J40584_12948505 JGI24696J40584_129485051 575
120 3300005083 Ga0068305_10412525 Ga0068305_104125252 575
121 3300009784 Ga0123357_10198320 Ga0123357_101983201 575
122 3300010049 Ga0123356_10111940 Ga0123356_101119402 575
123 3300010049 Ga0123356_10128246 Ga0123356_101282461 575
124 3300010049 Ga0123356_10138130 Ga0123356_101381302 575
125 3300010049 Ga0123356_10186989 Ga0123356_101869891 575
126 3300010167 Ga0123353_10329732 Ga0123353_103297322 575
127 3300010167 Ga0123353_10340217 Ga0123353_103402172 575
128 3300042550 Ga0466656_134004 Ga0466656_134004_270_1997 575
129 3300042582 Ga0466657_400010 Ga0466657_400010_239_1966 575
130 3300042600 Ga0466700_458069 Ga0466700_458069_99_1826 575
131 3300042603 Ga0466714_011175 Ga0466714_011175_136_1863 575
132 3300042603 Ga0466714_049384 Ga0466714_049384_904_2631 575
133 3300042611 Ga0466697_025597 Ga0466697_025597_1715_3442 575
134 3300042613 Ga0466710_142790 Ga0466710_142790_182_1909 575
135 3300042613 Ga0466710_253308 Ga0466710_253308_1095_2822 575
136 3300042617 Ga0466718_166037 Ga0466718_166037_254_2014 575
137 3300042620 Ga0466728_036434 Ga0466728_036434_306_2033 575
138 3300042622 Ga0466731_217067 Ga0466731_217067_68_1795 575
139 3300042623 Ga0466734_136660 Ga0466734_136660_229_1956 575
140 3300042623 Ga0466734_163663 Ga0466734_163663_198_1925 575
141 3300042654 Ga0466725_457729 Ga0466725_457729_241_1968 575
142 3300002462 JGI24702J35022_10019271 JGI24702J35022_100192712 576
143 3300009784 Ga0123357_10136701 Ga0123357_101367012 576
144 3300010049 Ga0123356_10126056 Ga0123356_101260561 576
145 3300010882 Ga0123354_10181041 Ga0123354_101810411 576
146 3300005083 Ga0068305_10009653 Ga0068305_100096533 577
147 3300010167 Ga0123353_10210890 Ga0123353_102108902 577
148 3300042643 Ga0466704_543231 Ga0466704_543231_101_1855 577
149 3300042635 Ga0466702_091861 Ga0466702_091861_298_2100 579
150 3300042652 Ga0466708_255569 Ga0466708_255569_214_1956 580
151 3300002504 JGI24705J35276_12226513 JGI24705J35276_122265132 581
152 3300010167 Ga0123353_10293795 Ga0123353_102937952 581
153 3300010167 Ga0123353_10319114 Ga0123353_103191142 581
154 3300042596 Ga0466696_021761 Ga0466696_021761_264_2009 581
155 3300042606 Ga0466719_292498 Ga0466719_292498_2423_4168 581
156 3300042623 Ga0466734_009169 Ga0466734_009169_249_1994 581
157 3300042635 Ga0466702_331096 Ga0466702_331096_215_1963 582
158 3300042655 Ga0466727_243606 Ga0466727_243606_141_1928 582
159 3300042659 Ga0466733_106548 Ga0466733_106548_978_2726 582
160 3300042659 Ga0466733_122948 Ga0466733_122948_463_2211 582
161 3300010049 Ga0123356_10183752 Ga0123356_101837521 583
162 3300042596 Ga0466696_152006 Ga0466696_152006_252_2003 583
163 3300042596 Ga0466696_273766 Ga0466696_273766_910_2661 583
164 3300042598 Ga0466701_059404 Ga0466701_059404_23_1774 583
165 3300042606 Ga0466719_060152 Ga0466719_060152_1674_3425 583
166 3300042636 Ga0466703_269797 Ga0466703_269797_9128_10879 583
167 2225789004 2227570742 2228115554 584
168 3300009826 Ga0123355_10239922 Ga0123355_102399222 584
169 3300010049 Ga0123356_10061643 Ga0123356_100616433 584
170 3300010167 Ga0123353_10352719 Ga0123353_103527191 584
171 3300010882 Ga0123354_10147668 Ga0123354_101476682 584
172 3300042592 Ga0466693_338502 Ga0466693_338502_408_2162 584
173 3300042605 Ga0466716_492156 Ga0466716_492156_2105_3859 584
174 3300042608 Ga0466721_164386 Ga0466721_164386_340_2094 584
175 3300042613 Ga0466710_205503 Ga0466710_205503_218_1972 584
176 3300042617 Ga0466718_030895 Ga0466718_030895_65_1819 584
177 3300042618 Ga0466723_269590 Ga0466723_269590_5777_7531 584
178 3300042623 Ga0466734_014050 Ga0466734_014050_213_1967 584
179 3300042624 Ga0466735_071419 Ga0466735_071419_997_2751 584
180 3300042636 Ga0466703_318337 Ga0466703_318337_730_2484 584
181 3300042652 Ga0466708_305064 Ga0466708_305064_670_2424 584
182 iso_pr_bacteria 2820324456 2820327036 584
183 3300002504 JGI24705J35276_12215182 JGI24705J35276_122151821 585
184 3300010167 Ga0123353_10330182 Ga0123353_103301821 585
185 3300010882 Ga0123354_10169473 Ga0123354_101694732 585
186 3300042596 Ga0466696_252316 Ga0466696_252316_535_2292 585
187 3300042659 Ga0466733_088214 Ga0466733_088214_288_2045 585
188 3300010167 Ga0123353_10105809 Ga0123353_101058092 586
189 3300042617 Ga0466718_161185 Ga0466718_161185_211_1971 586
190 3300042611 Ga0466697_120253 Ga0466697_120253_915_2678 587
191 3300042654 Ga0466725_215339 Ga0466725_215339_327_2090 587
192 3300009826 Ga0123355_10340954 Ga0123355_103409541 590
193 3300010167 Ga0123353_10341334 Ga0123353_103413341 590
194 3300009826 Ga0123355_10218638 Ga0123355_102186383 595
195 3300042593 Ga0466691_057662 Ga0466691_057662_167_1957 596
196 3300042615 Ga0466711_155976 Ga0466711_155976_297_2087 596
197 3300042612 Ga0466705_248609 Ga0466705_248609_1227_3020 597
198 3300042593 Ga0466691_114491 Ga0466691_114491_582_2378 598
199 3300010167 Ga0123353_10404043 Ga0123353_104040431 603
200 3300042612 Ga0466705_354663 Ga0466705_354663_818_2677 607
201 3300002450 JGI24695J34938_10031889 JGI24695J34938_100318892 608
202 3300002450 JGI24695J34938_10036765 JGI24695J34938_100367651 636

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01609 DDE_Tnp_1 Transposase DDE domain 268 560 0.86

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.8 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.