Protein Family IF00681

Metagenome Isolate
120 Members
38 Samples
112 Scaffolds
289.28 Avg Length

🧬 Representative Sequence

ID
3300002450|JGI24695J34938_10023735|JGI24695J34938_100237352
Length
320 aa
Sequence
MLNYNSASDLRAFLDREGLGMQKKFGQNFLINPQIRQALVEALDAKDGDEVWEIGPGLGAMTALLLEKGLKVKAFEIDLGFIRILKSMFLNSEKFELIEGDALKTWPSQDTAHFLLGNLPYNIAAALIADLIEKGRTFSRMVVTVQKEVALRMAASAGSPDYSSFSVVCASVYNVKTLMTIRPSSFFPQPNVDSMGVLLERREQACAENFAAKRGYPDCFYPLVRSLFESRRKTLKNNLLTFLSSRLGRINTRKGSDSSGDADRRIEGREKLKEICNAVLKENSLNGGERAEKLEFDAFLSIAKTIQNMPLLNSDVNCR*

📊 Sample Types

Isolate 6.7%
Metagenome 93.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 61.1%
Unclassified 22.2%
Rhinotermitidae 5.6%
Kalotermitidae 5.6%
Termopsidae 5.6%

🌳 Taxonomy

Archaea 0
Bacteria 110
Eukaryota 0
Viruses 1
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
2 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
3 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
4 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
5 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
6 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
7 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
8 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
9 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
10 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
11 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
12 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
13 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
14 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
15 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
16 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
17 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
18 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
19 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
20 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
21 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
22 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
23 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
24 2781125641 Treponema sp. Co191P1bin27 Isolate Unclassified
25 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
26 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
27 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
28 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
29 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
30 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
31 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
32 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
33 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
34 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
35 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
36 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
37 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
38 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466712_096882 3300042614 Bacteria 42313
2 Ga0466712_178804 3300042614 Bacteria 13952
3 Ga0466718_030118 3300042617 Bacteria 5179
4 Ga0466718_108588 3300042617 Bacteria 22533
5 Ga0466732_091318 3300042656 Bacteria 8624
6 Ga0123356_10007118 3300010049 Bacteria 11207
7 Ga0123356_10101457 3300010049 Bacteria 2761
8 JGI24698J34947_10001607 3300002449 Bacteria 12014
9 JGI24698J34947_10062990 3300002449 Unclassified 1819
10 JGI24695J34938_10004887 3300002450 Bacteria 8585
11 JGI24699J35502_11059321 3300002509 Bacteria 1724
12 Ga0072941_1011521 3300005201 Bacteria 14651
13 Ga0415639_022188 3300038395 Bacteria 15573
14 Ga0415639_072901 3300038395 Bacteria 6473
15 Ga0466699_103536 3300042597 Bacteria 10825
16 Ga0466731_317461 3300042622 Bacteria 4069
17 Ga0466712_259619 3300042614 Bacteria 4259
18 Ga0466711_077645 3300042615 Bacteria 24912
19 Ga0466718_047845 3300042617 Bacteria 2513
20 Ga0466733_103879 3300042659 Bacteria 22213
21 JGI24698J34947_10041270 3300002449 Bacteria 2377
22 JGI24695J34938_10000568 3300002450 Bacteria 35544
23 JGI24695J34938_10085241 3300002450 Bacteria 1301
24 Ga0072941_1028098 3300005201 Bacteria 10487
25 Ga0466720_044575 3300042607 Unclassified 8488
26 Ga0466693_002405 3300042592 Bacteria 54310
27 Ga0466699_218119 3300042597 Bacteria 9194
28 Ga0466718_057860 3300042617 Bacteria 1272
29 Ga0466718_100918 3300042617 Bacteria 2585
30 Ga0123356_10105052 3300010049 Unclassified 2716
31 JGI24698J34947_10024741 3300002449 Bacteria 3203
32 JGI24695J34938_10018390 3300002450 Bacteria 3496
33 Ga0072940_1011847 3300005200 Bacteria 6605
34 Ga0072940_1015170 3300005200 Viruses 3508
35 Ga0072941_1039342 3300005201 Bacteria 6234
36 Ga0072941_1064238 3300005201 Unclassified 5316
37 Ga0466720_004303 3300042607 Bacteria 5202
38 Ga0466720_112006 3300042607 Bacteria 11619
39 Ga0466721_066164 3300042608 Bacteria 16548
40 Ga0264413_104053 3300024493 Bacteria 17683
41 Ga0466727_165610 3300042655 Bacteria 2003
42 Ga0466727_341116 3300042655 Bacteria 1977
43 Ga0466712_039522 3300042614 Bacteria 3679
44 Ga0466712_147933 3300042614 Unclassified 1935
45 Ga0466712_178555 3300042614 Bacteria 2120
46 Ga0466712_314425 3300042614 Bacteria 25648
47 Ga0466733_072759 3300042659 Bacteria 51080
48 Ga0123356_10710073 3300010049 Bacteria 1175
49 Ga0123353_10017028 3300010167 Bacteria 10656
50 Ga0466694_072740 3300042594 Bacteria 1909
51 Ga0466712_257317 3300042614 Bacteria 24558
52 Ga0466726_154604 3300042619 Bacteria 2071
53 Ga0123356_10006624 3300010049 Bacteria 11673
54 AustNasuHG_c1003074 3300000089 Bacteria 6023
55 AustNasuHG_c1005691 3300000089 Bacteria 4456
56 JGI24695J34938_10001618 3300002450 Bacteria 18841
57 JGI24695J34938_10007977 3300002450 Bacteria 6109
58 Ga0072940_1010697 3300005200 Bacteria 3744
59 Ga0466720_068357 3300042607 Bacteria 11333
60 Ga0415639_194886 3300038395 Bacteria 1044
61 Ga0466699_036221 3300042597 Bacteria 24269
62 Ga0466699_325728 3300042597 Bacteria 11474
63 Ga0466702_227304 3300042635 Bacteria 1934
64 Ga0466703_355616 3300042636 Bacteria 14095
65 Ga0466712_202426 3300042614 Bacteria 1118
66 Ga0466712_228681 3300042614 Bacteria 33247
67 Ga0466718_022853 3300042617 Bacteria 49734
68 Ga0466718_087439 3300042617 Unclassified 1070
69 Ga0123356_10016221 3300010049 Bacteria 7114
70 AustNasuHG_c1000235 3300000089 Bacteria 18680
71 AustNasuHG_c1015522 3300000089 Bacteria 2568
72 JGI24698J34947_10042146 3300002449 Bacteria 2347
73 JGI24695J34938_10002123 3300002450 Bacteria 15503
74 Ga0466720_004667 3300042607 Bacteria 1734
75 Ga0466720_193677 3300042607 Bacteria 15489
76 Ga0466722_056894 3300042609 Bacteria 11763
77 Ga0466698_234626 3300042610 Bacteria 14737
78 Ga0264413_125962 3300024493 Bacteria 10124
79 Ga0466718_023623 3300042617 Bacteria 3086
80 Ga0466718_087067 3300042617 Bacteria 1853
81 Ga0466732_069322 3300042656 Bacteria 4875
82 Ga0123356_10004241 3300010049 Bacteria 14836
83 Ga0123356_10126698 3300010049 Bacteria 2494
84 Ga0123356_10538842 3300010049 Bacteria 1327
85 AustNasuHG_c1031341 3300000089 Bacteria 1505
86 JGI24698J34947_10041282 3300002449 Bacteria 2377
87 JGI24695J34938_10003237 3300002450 Bacteria 11526
88 Ga0072941_1039344 3300005201 Bacteria 6989
89 Ga0072941_1039346 3300005201 Bacteria 5071
90 Ga0264413_100418 3300024493 Bacteria 17878
91 Ga0264413_112928 3300024493 Bacteria 7544
92 Ga0415639_031736 3300038395 Bacteria 8247
93 Ga0466695_181079 3300042595 Bacteria 41133
94 Ga0466699_207373 3300042597 Bacteria 8131
95 Ga0466712_027725 3300042614 Bacteria 34997
96 Ga0123355_10033636 3300009826 Unclassified 8326
97 Ga0123356_10000788 3300010049 Bacteria 35154
98 Ga0123353_10006753 3300010167 Bacteria 15373
99 AustNasuHG_c1007529 3300000089 Bacteria 3869
100 JGI24698J34947_10000007 3300002449 Bacteria 54610
101 JGI24698J34947_10038655 3300002449 Bacteria 2474
102 JGI24695J34938_10002563 3300002450 Bacteria 13699
103 JGI24695J34938_10006132 3300002450 Bacteria 7315
104 JGI24695J34938_10023735 3300002450 Bacteria 2953
105 Ga0072940_1033740 3300005200 Unclassified 3415
106 Ga0072941_1011779 3300005201 Bacteria 29388
107 Ga0072941_1039341 3300005201 Bacteria 5000
108 Ga0072941_1039343 3300005201 Bacteria 2083
109 Ga0072941_1148402 3300005201 Bacteria 1769
110 Ga0466692_151223 3300042591 Unclassified 6370
111 Ga0466694_190357 3300042594 Bacteria 6672
112 Ga0466702_174234 3300042635 Bacteria 1659

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042594 Ga0466694_072740 Ga0466694_072740_34_825 263
2 3300042591 Ga0466692_151223 Ga0466692_151223_3206_4024 272
3 3300042594 Ga0466694_190357 Ga0466694_190357_1464_2288 274
4 3300042597 Ga0466699_103536 Ga0466699_103536_4056_4883 275
5 3300042597 Ga0466699_207373 Ga0466699_207373_4751_5578 275
6 3300042615 Ga0466711_077645 Ga0466711_077645_12163_12993 276
7 3300010049 Ga0123356_10007118 Ga0123356_1000711815 279
8 3300042597 Ga0466699_218119 Ga0466699_218119_714_1553 279
9 3300042597 Ga0466699_325728 Ga0466699_325728_714_1553 279
10 3300042617 Ga0466718_057860 Ga0466718_057860_225_1064 279
11 3300042617 Ga0466718_108588 Ga0466718_108588_2317_3156 279
12 3300042659 Ga0466733_103879 Ga0466733_103879_15933_16775 280
13 3300005200 Ga0072940_1033740 Ga0072940_10337402 281
14 3300024493 Ga0264413_112928 Ga0264413_1129284 281
15 3300042607 Ga0466720_004667 Ga0466720_004667_379_1224 281
16 3300042607 Ga0466720_044575 Ga0466720_044575_2017_2862 281
17 3300042607 Ga0466720_112006 Ga0466720_112006_10325_11170 281
18 3300042595 Ga0466695_181079 Ga0466695_181079_14591_15439 282
19 3300042617 Ga0466718_023623 Ga0466718_023623_853_1701 282
20 iso_pr_bacteria 2781125659 2781328519 282
21 3300010049 Ga0123356_10006624 Ga0123356_100066241 283
22 3300010049 Ga0123356_10016221 Ga0123356_100162218 283
23 3300010167 Ga0123353_10006753 Ga0123353_1000675323 283
24 3300042617 Ga0466718_022853 Ga0466718_022853_18868_19719 283
25 iso_pr_bacteria 2781125634 2781274003 283
26 iso_pr_bacteria 2781125663 2781338995 283
27 3300002450 JGI24695J34938_10004887 JGI24695J34938_100048877 284
28 3300005201 Ga0072941_1064238 Ga0072941_10642384 284
29 3300010049 Ga0123356_10105052 Ga0123356_101050523 284
30 3300042610 Ga0466698_234626 Ga0466698_234626_13215_14069 284
31 3300042614 Ga0466712_178804 Ga0466712_178804_5945_6799 284
32 3300002449 JGI24698J34947_10024741 JGI24698J34947_100247412 285
33 3300038395 Ga0415639_022188 Ga0415639_022188_7646_8503 285
34 3300042614 Ga0466712_314425 Ga0466712_314425_6016_6873 285
35 3300042617 Ga0466718_100918 Ga0466718_100918_10_888 285
36 3300002449 JGI24698J34947_10062990 JGI24698J34947_100629902 286
37 3300010167 Ga0123353_10017028 Ga0123353_100170286 286
38 3300042617 Ga0466718_087067 Ga0466718_087067_72_932 286
39 3300042617 Ga0466718_087439 Ga0466718_087439_72_932 286
40 3300000089 AustNasuHG_c1003074 AustNasuHG_10030745 287
41 3300000089 AustNasuHG_c1007529 AustNasuHG_10075295 287
42 3300002449 JGI24698J34947_10042146 JGI24698J34947_100421462 287
43 3300024493 Ga0264413_125962 Ga0264413_1259627 287
44 3300042614 Ga0466712_257317 Ga0466712_257317_5174_6037 287
45 3300042617 Ga0466718_047845 Ga0466718_047845_729_1592 287
46 3300042656 Ga0466732_091318 Ga0466732_091318_6346_7209 287
47 3300002449 JGI24698J34947_10041270 JGI24698J34947_100412702 288
48 3300002450 JGI24695J34938_10006132 JGI24695J34938_100061322 288
49 3300005200 Ga0072940_1010697 Ga0072940_10106974 288
50 3300005200 Ga0072940_1015170 Ga0072940_10151703 288
51 3300010049 Ga0123356_10000788 Ga0123356_1000078816 288
52 3300010049 Ga0123356_10004241 Ga0123356_100042416 288
53 3300024493 Ga0264413_100418 Ga0264413_10041812 288
54 3300042607 Ga0466720_004303 Ga0466720_004303_1075_1941 288
55 3300042607 Ga0466720_068357 Ga0466720_068357_10420_11286 288
56 3300042607 Ga0466720_193677 Ga0466720_193677_14576_15442 288
57 3300042635 Ga0466702_174234 Ga0466702_174234_723_1589 288
58 iso_pr_bacteria 2781125648 2781305676 288
59 3300000089 AustNasuHG_c1000235 AustNasuHG_100023516 289
60 3300000089 AustNasuHG_c1005691 AustNasuHG_10056912 289
61 3300000089 AustNasuHG_c1015522 AustNasuHG_10155222 289
62 3300002450 JGI24695J34938_10002563 JGI24695J34938_100025635 289
63 3300002509 JGI24699J35502_11059321 JGI24699J35502_110593212 289
64 3300005201 Ga0072941_1011521 Ga0072941_10115219 289
65 3300010049 Ga0123356_10710073 Ga0123356_107100732 289
66 3300042592 Ga0466693_002405 Ga0466693_002405_15123_16046 289
67 3300042614 Ga0466712_147933 Ga0466712_147933_521_1390 289
68 iso_pr_bacteria 2781125635 2781276319 289
69 iso_pr_bacteria 2781125645 2781298647 289
70 3300002449 JGI24698J34947_10001607 JGI24698J34947_100016077 290
71 3300002449 JGI24698J34947_10038655 JGI24698J34947_100386552 290
72 3300002450 JGI24695J34938_10007977 JGI24695J34938_100079772 290
73 3300005201 Ga0072941_1028098 Ga0072941_10280987 290
74 3300005201 Ga0072941_1039344 Ga0072941_10393444 290
75 3300024493 Ga0264413_104053 Ga0264413_10405315 290
76 3300042614 Ga0466712_096882 Ga0466712_096882_33556_34428 290
77 3300000089 AustNasuHG_c1031341 AustNasuHG_10313412 291
78 3300005201 Ga0072941_1039341 Ga0072941_10393412 291
79 3300005201 Ga0072941_1039342 Ga0072941_10393424 291
80 3300005201 Ga0072941_1039343 Ga0072941_10393432 291
81 3300005201 Ga0072941_1039346 Ga0072941_10393464 291
82 3300005201 Ga0072941_1148402 Ga0072941_11484022 291
83 3300042614 Ga0466712_027725 Ga0466712_027725_8227_9102 291
84 3300042614 Ga0466712_228681 Ga0466712_228681_11201_12076 291
85 3300042614 Ga0466712_259619 Ga0466712_259619_3359_4234 291
86 3300042655 Ga0466727_341116 Ga0466727_341116_541_1416 291
87 3300002449 JGI24698J34947_10000007 JGI24698J34947_1000000739 292
88 3300002449 JGI24698J34947_10041282 JGI24698J34947_100412822 292
89 3300005201 Ga0072941_1011779 Ga0072941_10117795 292
90 3300010049 Ga0123356_10126698 Ga0123356_101266983 292
91 3300042597 Ga0466699_036221 Ga0466699_036221_18715_19593 292
92 3300002450 JGI24695J34938_10085241 JGI24695J34938_100852412 293
93 3300005200 Ga0072940_1011847 Ga0072940_10118474 293
94 3300042614 Ga0466712_039522 Ga0466712_039522_882_1763 293
95 3300042614 Ga0466712_178555 Ga0466712_178555_683_1564 293
96 3300042614 Ga0466712_202426 Ga0466712_202426_151_1032 293
97 3300042622 Ga0466731_317461 Ga0466731_317461_385_1266 293
98 3300042655 Ga0466727_165610 Ga0466727_165610_699_1580 293
99 3300042617 Ga0466718_030118 Ga0466718_030118_1464_2351 295
100 3300042619 Ga0466726_154604 Ga0466726_154604_799_1686 295
101 3300042636 Ga0466703_355616 Ga0466703_355616_4631_5518 295
102 3300042656 Ga0466732_069322 Ga0466732_069322_3549_4436 295
103 3300002450 JGI24695J34938_10003237 JGI24695J34938_100032373 296
104 3300010049 Ga0123356_10101457 Ga0123356_101014572 297
105 3300042608 Ga0466721_066164 Ga0466721_066164_11493_12386 297
106 3300042609 Ga0466722_056894 Ga0466722_056894_1689_2582 297
107 3300042635 Ga0466702_227304 Ga0466702_227304_727_1620 297
108 3300002450 JGI24695J34938_10000568 JGI24695J34938_1000056811 300
109 3300010049 Ga0123356_10538842 Ga0123356_105388422 301
110 iso_pr_bacteria 2781125641 2781290087 302
111 iso_pr_bacteria 2781125656 2781320815 302
112 3300002450 JGI24695J34938_10001618 JGI24695J34938_1000161811 303
113 3300009826 Ga0123355_10033636 Ga0123355_100336364 303
114 3300038395 Ga0415639_194886 Ga0415639_194886_109_1023 304
115 3300038395 Ga0415639_031736 Ga0415639_031736_4008_4931 307
116 3300038395 Ga0415639_072901 Ga0415639_072901_3238_4164 308
117 3300002450 JGI24695J34938_10002123 JGI24695J34938_1000212312 311
118 3300002450 JGI24695J34938_10018390 JGI24695J34938_100183905 311
119 3300002450 JGI24695J34938_10023735 JGI24695J34938_100237352 320
120 3300042659 Ga0466733_072759 Ga0466733_072759_4751_5713 320

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00398 RrnaAD Ribosomal RNA adenine dimethylase 22 245 0.91

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
3fte-assembly1.cif.gz_A Crystal structure of A. aeolicus KsgA in complex with RNA 0.902 34 309
3tqs-assembly2.cif.gz_B Structure of the dimethyladenosine transferase (ksgA) from Coxiella burnetii 0.901 27 304
4jxj-assembly1.cif.gz_A Crystal Structure of Ribosomal RNA small subunit methyltransferase A from Rickettsia bellii Determined by Iodide SAD Phasing 0.89 35 306
3fuv-assembly2.cif.gz_B Apo-form of T. thermophilus 16S rRNA A1518 and A1519 methyltransferase (KsgA) in space group P43212 0.889 6 305
6ifv-assembly2.cif.gz_B C-terminal truncated KsgA from Bacillus subtilis 168 0.887 5 202
IDDescriptionScoreStartEndSuperfamily
af_Q58435_1_185_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.943 20 203 3.40.50.150
4jxjA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9419 35 203 3.40.50.150
3fuxB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9272 6 201 3.40.50.150
af_Q54QK7_28_214_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9242 20 204 3.40.50.150
af_P9WH07_6_221_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9201 8 203 3.40.50.150
IDDescriptionScoreStartEndGO Terms
AF-A0A7T7XRX7-F1-model_v4 Ribosomal RNA small subunit methyltransferase A 0.9516 21 305 GO:0005829
GO:0052908
GO:0003723

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.87 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.