Protein Family IF00680

Metagenome Isolate
148 Members
43 Samples
140 Scaffolds
390.52 Avg Length

🧬 Representative Sequence

ID
3300002450|JGI24695J34938_10023409|JGI24695J34938_100234092
Length
393 aa
Sequence
MAAPQPCFIHADIDAFYASVEQLDRPEYRGKPVIVGGLPGDRRSVVSAASYEARGFGVHSAMPLAQALKLCPDGIFLRGNMGRYRKKSAEIMAIFDEFSPSVRQLSIDEAFIDITGTGGLFGPPKEAAGKIKERVSREAGVTVSVGVSSNKYLAKIASGMSKPDGLYLIPAGGEEAFMRALPAEKIWGTGSATHELFRKHGIKTGDDIYRLSQGILASLFGKAKGLFLYRAVRGEGAAFEEERETRSISSERTFAFDLHDEFAMESVLFDLCQSLIWRLLEGKWRSRTVSVKIRYGDFSTEAARESRXEYVKTLNXLYDRLLGLFRRKYRKGRGLRLLGAGLMNLEDGTELQGELFGDDAEKDRRLEKAILDINKKFPDAALRRGRSWLAEQ*

📊 Sample Types

Isolate 5.4%
Metagenome 94.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 33.3%
Termitidae 26.2%
Unclassified 23.8%
Rhinotermitidae 7.1%
Termopsidae 7.1%
Hodotermitidae 2.4%

🌳 Taxonomy

Archaea 0
Bacteria 143
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125633 Treponema sp. Co191P1bin38 Isolate Unclassified
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
6 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
7 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 2740892545 Fibrobacteria bacterium GUT31 IN01_31 Isolate Unclassified
10 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
11 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
12 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
13 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
14 2772190978 Treponema sp. Nt197P3bin57 Isolate Unclassified
15 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
16 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
17 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
18 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
19 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
20 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
21 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
22 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
23 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
24 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
25 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
26 2781125683 Treponema sp. Lab288P1bin34 Isolate Unclassified
27 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
28 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
29 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
30 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
31 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
32 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
33 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
34 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
35 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
36 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
37 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
38 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
39 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
40 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
41 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
42 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
43 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 JGI24698J34947_10020972 3300002449 Bacteria 3518
2 Ga0466711_163489 3300042615 Bacteria 4033
3 Ga0466711_306143 3300042615 Bacteria 4346
4 Ga0466715_638349 3300042616 Bacteria 1894
5 Ga0466723_064779 3300042618 Bacteria 8705
6 Ga0466723_081246 3300042618 Bacteria 7643
7 Ga0466728_255307 3300042620 Bacteria 4349
8 Ga0466706_079557 3300042599 Bacteria 1830
9 Ga0466706_279736 3300042599 Bacteria 1589
10 Ga0466713_097285 3300042602 Bacteria 16045
11 Ga0466716_088306 3300042605 Bacteria 10529
12 Ga0466716_273641 3300042605 Bacteria 14136
13 Ga0466719_115079 3300042606 Unclassified 3048
14 Ga0466698_322120 3300042610 Bacteria 1635
15 Ga0123353_10166674 3300010167 Bacteria 3501
16 Ga0123353_10439668 3300010167 Bacteria 1925
17 Ga0466696_030607 3300042596 Bacteria 3367
18 Ga0466696_326426 3300042596 Bacteria 1966
19 Ga0466699_442849 3300042597 Bacteria 14490
20 Ga0466705_348785 3300042612 Bacteria 46858
21 Ga0466735_138359 3300042624 Bacteria 1960
22 Ga0466704_153334 3300042643 Bacteria 11123
23 Ga0466704_245155 3300042643 Bacteria 10978
24 Ga0466709_226965 3300042648 Bacteria 29188
25 Ga0466708_015433 3300042652 Bacteria 6109
26 Ga0466708_412680 3300042652 Bacteria 4411
27 Ga0466727_299510 3300042655 Bacteria 3602
28 JGI24695J34938_10002080 3300002450 Bacteria 15709
29 Ga0466712_209494 3300042614 Bacteria 2019
30 Ga0466715_126583 3300042616 Bacteria 15102
31 Ga0466723_172604 3300042618 Bacteria 6876
32 Ga0466728_001176 3300042620 Bacteria 2024
33 Ga0466716_510528 3300042605 Bacteria 2083
34 Ga0466719_222490 3300042606 Bacteria 4211
35 Ga0466722_230963 3300042609 Bacteria 1622
36 Ga0466698_346284 3300042610 Bacteria 3188
37 Ga0466691_060576 3300042593 Bacteria 4098
38 Ga0466699_294829 3300042597 Bacteria 18693
39 Ga0466703_234743 3300042636 Bacteria 1790
40 Ga0466703_378241 3300042636 Bacteria 14654
41 Ga0466704_111099 3300042643 Bacteria 2628
42 Ga0466704_461388 3300042643 Bacteria 6680
43 Ga0466727_239321 3300042655 Bacteria 2941
44 JGI24698J34947_10005707 3300002449 Bacteria 6826
45 JGI24698J34947_10014185 3300002449 Bacteria 4338
46 JGI24698J34947_10067001 3300002449 Bacteria 1744
47 JGI24695J34938_10023409 3300002450 Bacteria 2979
48 Ga0466715_432675 3300042616 Bacteria 9741
49 Ga0466707_049510 3300042601 Bacteria 2754
50 Ga0466719_370207 3300042606 Bacteria 8784
51 Ga0466719_386754 3300042606 Bacteria 3543
52 Ga0466698_424751 3300042610 Bacteria 3575
53 Ga0466692_175784 3300042591 Bacteria 25241
54 Ga0466694_072581 3300042594 Bacteria 5254
55 Ga0466696_092521 3300042596 Bacteria 1628
56 Ga0466699_051175 3300042597 Bacteria 3881
57 Ga0466699_272280 3300042597 Bacteria 5548
58 Ga0466705_036306 3300042612 Bacteria 2172
59 Ga0466703_404866 3300042636 Bacteria 2481
60 Ga0466704_499057 3300042643 Bacteria 60887
61 Ga0466709_306938 3300042648 Bacteria 2857
62 JGI24695J34938_10006515 3300002450 Bacteria 6985
63 Ga0466715_107156 3300042616 Bacteria 23208
64 Ga0466715_194393 3300042616 Bacteria 13618
65 Ga0466715_408473 3300042616 Bacteria 5939
66 Ga0466729_001776 3300042621 Unclassified 1733
67 Ga0466707_071139 3300042601 Bacteria 1380
68 Ga0466707_386951 3300042601 Bacteria 2469
69 Ga0466713_049428 3300042602 Bacteria 7612
70 Ga0466719_108800 3300042606 Bacteria 4559
71 Ga0466722_100265 3300042609 Bacteria 3983
72 Ga0466691_094859 3300042593 Bacteria 1818
73 Ga0466735_177155 3300042624 Bacteria 11713
74 Ga0466735_190653 3300042624 Bacteria 14106
75 Ga0466703_406661 3300042636 Bacteria 5679
76 Ga0466703_419539 3300042636 Bacteria 6998
77 Ga0466704_057294 3300042643 Bacteria 2894
78 JGI24698J34947_10019600 3300002449 Bacteria 3646
79 JGI24698J34947_10041856 3300002449 Unclassified 2357
80 JGI24695J34938_10004264 3300002450 Bacteria 9472
81 Ga0072941_1000038 3300005201 Bacteria 14911
82 Ga0072941_1001002 3300005201 Bacteria 23705
83 Ga0072941_1004513 3300005201 Bacteria 10301
84 Ga0466711_325246 3300042615 Unclassified 6997
85 Ga0466715_111332 3300042616 Bacteria 4670
86 Ga0466715_198886 3300042616 Bacteria 9412
87 Ga0466723_066824 3300042618 Bacteria 21336
88 Ga0466726_131517 3300042619 Bacteria 1524
89 Ga0466707_014796 3300042601 Bacteria 2332
90 Ga0466716_297730 3300042605 Bacteria 1318
91 Ga0466722_077472 3300042609 Bacteria 5674
92 Ga0466696_062671 3300042596 Bacteria 7091
93 Ga0466696_168948 3300042596 Bacteria 1637
94 Ga0466699_234584 3300042597 Bacteria 5833
95 Ga0466699_269090 3300042597 Bacteria 15052
96 Ga0466699_332337 3300042597 Bacteria 18397
97 Ga0466704_355510 3300042643 Bacteria 5519
98 Ga0466709_138202 3300042648 Unclassified 9282
99 Ga0466708_127532 3300042652 Bacteria 8006
100 Ga0466727_246530 3300042655 Bacteria 3687
101 Ga0466712_056081 3300042614 Bacteria 2672
102 Ga0466712_074428 3300042614 Bacteria 10981
103 Ga0466711_007779 3300042615 Bacteria 22172
104 Ga0466711_038255 3300042615 Bacteria 11945
105 Ga0466733_007578 3300042659 Bacteria 2305
106 Ga0466716_359382 3300042605 Bacteria 1977
107 Ga0466722_129785 3300042609 Bacteria 10733
108 Ga0466690_045501 3300042590 Bacteria 20295
109 Ga0466696_123277 3300042596 Bacteria 3065
110 Ga0466699_073912 3300042597 Bacteria 1284
111 Ga0466708_051008 3300042652 Bacteria 11008
112 Ga0466727_244841 3300042655 Bacteria 2662
113 Ga0466727_264712 3300042655 Bacteria 1716
114 JGI24702J35022_10008830 3300002462 Bacteria 5689
115 Ga0466715_058920 3300042616 Bacteria 8916
116 Ga0466715_217033 3300042616 Bacteria 3611
117 Ga0466723_292948 3300042618 Bacteria 3022
118 Ga0466723_372229 3300042618 Bacteria 25615
119 Ga0466728_078365 3300042620 Bacteria 3714
120 Ga0466692_179170 3300042591 Bacteria 1614
121 Ga0466691_027350 3300042593 Bacteria 4725
122 Ga0466705_071228 3300042612 Bacteria 13707
123 Ga0466705_192632 3300042612 Bacteria 3010
124 Ga0466735_067852 3300042624 Bacteria 4649
125 Ga0466703_427429 3300042636 Bacteria 2660
126 Ga0466708_369443 3300042652 Bacteria 17120
127 Ga0466712_165976 3300042614 Bacteria 6828
128 Ga0466711_007352 3300042615 Bacteria 10471
129 Ga0466719_188046 3300042606 Bacteria 38254
130 Ga0466719_427105 3300042606 Bacteria 2716
131 Ga0123357_10156505 3300009784 Bacteria 2747
132 Ga0123354_10157614 3300010882 Bacteria 2714
133 Ga0466696_036964 3300042596 Bacteria 6133
134 Ga0466696_126903 3300042596 Bacteria 19136
135 Ga0466699_001476 3300042597 Bacteria 19710
136 Ga0466699_077342 3300042597 Bacteria 9347
137 Ga0466705_322397 3300042612 Bacteria 1653
138 Ga0466735_054816 3300042624 Bacteria 1603
139 Ga0466704_184778 3300042643 Bacteria 18637
140 Ga0466708_006474 3300042652 Bacteria 14186

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300005201 Ga0072941_1000038 Ga0072941_10000383 366
2 3300042609 Ga0466722_230963 Ga0466722_230963_398_1534 378
3 iso_pr_bacteria 2781125683 2781412115 380
4 3300042619 Ga0466726_131517 Ga0466726_131517_45_1190 381
5 3300042624 Ga0466735_177155 Ga0466735_177155_8631_9782 383
6 3300042605 Ga0466716_273641 Ga0466716_273641_6956_8110 384
7 3300042593 Ga0466691_060576 Ga0466691_060576_615_1772 385
8 3300042614 Ga0466712_209494 Ga0466712_209494_342_1499 385
9 3300042620 Ga0466728_078365 Ga0466728_078365_1593_2750 385
10 3300042655 Ga0466727_299510 Ga0466727_299510_672_1829 385
11 3300002449 JGI24698J34947_10041856 JGI24698J34947_100418563 386
12 3300042597 Ga0466699_077342 Ga0466699_077342_171_1331 386
13 3300042597 Ga0466699_234584 Ga0466699_234584_151_1311 386
14 3300042597 Ga0466699_294829 Ga0466699_294829_666_1826 386
15 3300042597 Ga0466699_442849 Ga0466699_442849_12710_13870 386
16 3300042616 Ga0466715_217033 Ga0466715_217033_105_1265 386
17 3300042652 Ga0466708_051008 Ga0466708_051008_5819_6979 386
18 3300042655 Ga0466727_239321 Ga0466727_239321_53_1213 386
19 iso_pr_bacteria 2740892545 2743908481 386
20 iso_pr_bacteria 2781125640 2781287764 386
21 3300002449 JGI24698J34947_10019600 JGI24698J34947_100196004 387
22 3300005201 Ga0072941_1004513 Ga0072941_10045132 387
23 3300010167 Ga0123353_10166674 Ga0123353_101666744 387
24 3300042593 Ga0466691_027350 Ga0466691_027350_2089_3252 387
25 3300042596 Ga0466696_030607 Ga0466696_030607_1905_3068 387
26 3300042596 Ga0466696_126903 Ga0466696_126903_8413_9576 387
27 3300042596 Ga0466696_326426 Ga0466696_326426_311_1474 387
28 3300042599 Ga0466706_079557 Ga0466706_079557_161_1324 387
29 3300042606 Ga0466719_115079 Ga0466719_115079_618_1781 387
30 3300042606 Ga0466719_370207 Ga0466719_370207_3829_4992 387
31 3300042612 Ga0466705_192632 Ga0466705_192632_1706_2869 387
32 3300042615 Ga0466711_306143 Ga0466711_306143_586_1749 387
33 3300042616 Ga0466715_058920 Ga0466715_058920_2113_3276 387
34 3300042616 Ga0466715_194393 Ga0466715_194393_5888_7051 387
35 3300042618 Ga0466723_372229 Ga0466723_372229_24044_25207 387
36 3300042643 Ga0466704_245155 Ga0466704_245155_525_1688 387
37 3300042648 Ga0466709_138202 Ga0466709_138202_429_1592 387
38 3300042652 Ga0466708_006474 Ga0466708_006474_443_1606 387
39 iso_pr_bacteria 2781125631 2781267751 387
40 3300002462 JGI24702J35022_10008830 JGI24702J35022_100088302 388
41 3300005201 Ga0072941_1001002 Ga0072941_10010024 388
42 3300042597 Ga0466699_332337 Ga0466699_332337_14338_15504 388
43 3300042612 Ga0466705_071228 Ga0466705_071228_4680_5846 388
44 3300042612 Ga0466705_348785 Ga0466705_348785_45063_46253 388
45 3300042615 Ga0466711_007352 Ga0466711_007352_2025_3191 388
46 3300042615 Ga0466711_163489 Ga0466711_163489_1288_2454 388
47 3300042636 Ga0466703_378241 Ga0466703_378241_12780_13946 388
48 3300042643 Ga0466704_499057 Ga0466704_499057_59299_60489 388
49 iso_pr_bacteria 2781125633 2781272273 388
50 3300002450 JGI24695J34938_10002080 JGI24695J34938_100020807 389
51 3300042591 Ga0466692_179170 Ga0466692_179170_156_1325 389
52 3300042597 Ga0466699_073912 Ga0466699_073912_58_1227 389
53 3300042597 Ga0466699_269090 Ga0466699_269090_939_2108 389
54 3300042597 Ga0466699_272280 Ga0466699_272280_978_2147 389
55 3300042601 Ga0466707_071139 Ga0466707_071139_56_1225 389
56 3300042605 Ga0466716_510528 Ga0466716_510528_692_1861 389
57 3300042606 Ga0466719_188046 Ga0466719_188046_23254_24423 389
58 3300042610 Ga0466698_346284 Ga0466698_346284_1625_2794 389
59 3300042614 Ga0466712_074428 Ga0466712_074428_2035_3204 389
60 3300042614 Ga0466712_165976 Ga0466712_165976_489_1658 389
61 3300042618 Ga0466723_066824 Ga0466723_066824_14196_15365 389
62 3300042618 Ga0466723_081246 Ga0466723_081246_5001_6170 389
63 3300042620 Ga0466728_001176 Ga0466728_001176_528_1697 389
64 3300042624 Ga0466735_054816 Ga0466735_054816_340_1509 389
65 3300042624 Ga0466735_138359 Ga0466735_138359_623_1792 389
66 3300042636 Ga0466703_234743 Ga0466703_234743_307_1476 389
67 3300042643 Ga0466704_184778 Ga0466704_184778_14378_15547 389
68 3300042648 Ga0466709_226965 Ga0466709_226965_6604_7773 389
69 3300042652 Ga0466708_015433 Ga0466708_015433_4321_5490 389
70 3300042652 Ga0466708_127532 Ga0466708_127532_1686_2855 389
71 3300042659 Ga0466733_007578 Ga0466733_007578_818_1987 389
72 iso_pr_bacteria 2772190978 2773730014 389
73 iso_pr_bacteria 2781125687 2781422248 389
74 3300002449 JGI24698J34947_10005707 JGI24698J34947_100057072 390
75 3300002449 JGI24698J34947_10020972 JGI24698J34947_100209721 390
76 3300002449 JGI24698J34947_10067001 JGI24698J34947_100670012 390
77 3300009784 Ga0123357_10156505 Ga0123357_101565053 390
78 3300010167 Ga0123353_10439668 Ga0123353_104396682 390
79 3300010882 Ga0123354_10157614 Ga0123354_101576142 390
80 3300042596 Ga0466696_092521 Ga0466696_092521_131_1303 390
81 3300042596 Ga0466696_168948 Ga0466696_168948_396_1568 390
82 3300042597 Ga0466699_001476 Ga0466699_001476_16713_17885 390
83 3300042605 Ga0466716_088306 Ga0466716_088306_5343_6515 390
84 3300042606 Ga0466719_427105 Ga0466719_427105_1140_2312 390
85 3300042612 Ga0466705_036306 Ga0466705_036306_791_1963 390
86 3300042612 Ga0466705_322397 Ga0466705_322397_467_1639 390
87 3300042614 Ga0466712_056081 Ga0466712_056081_1362_2534 390
88 3300042616 Ga0466715_408473 Ga0466715_408473_4301_5473 390
89 3300042618 Ga0466723_064779 Ga0466723_064779_180_1352 390
90 3300042624 Ga0466735_067852 Ga0466735_067852_830_2002 390
91 3300042624 Ga0466735_190653 Ga0466735_190653_760_1932 390
92 3300042636 Ga0466703_404866 Ga0466703_404866_368_1540 390
93 3300042643 Ga0466704_057294 Ga0466704_057294_1464_2636 390
94 3300042643 Ga0466704_153334 Ga0466704_153334_1595_2767 390
95 3300042643 Ga0466704_355510 Ga0466704_355510_2964_4136 390
96 3300042648 Ga0466709_306938 Ga0466709_306938_1428_2600 390
97 3300042652 Ga0466708_412680 Ga0466708_412680_291_1463 390
98 3300042655 Ga0466727_244841 Ga0466727_244841_1373_2545 390
99 3300042655 Ga0466727_246530 Ga0466727_246530_653_1825 390
100 3300042591 Ga0466692_175784 Ga0466692_175784_12798_13973 391
101 3300042593 Ga0466691_094859 Ga0466691_094859_436_1611 391
102 3300042596 Ga0466696_062671 Ga0466696_062671_4686_5861 391
103 3300042597 Ga0466699_051175 Ga0466699_051175_1604_2779 391
104 3300042602 Ga0466713_049428 Ga0466713_049428_450_1625 391
105 3300042602 Ga0466713_097285 Ga0466713_097285_139_1314 391
106 3300042605 Ga0466716_297730 Ga0466716_297730_78_1253 391
107 3300042609 Ga0466722_100265 Ga0466722_100265_1318_2493 391
108 3300042615 Ga0466711_325246 Ga0466711_325246_192_1367 391
109 3300042616 Ga0466715_198886 Ga0466715_198886_3426_4601 391
110 3300042618 Ga0466723_172604 Ga0466723_172604_5276_6451 391
111 3300042618 Ga0466723_292948 Ga0466723_292948_91_1266 391
112 3300042636 Ga0466703_427429 Ga0466703_427429_504_1679 391
113 3300002450 JGI24695J34938_10006515 JGI24695J34938_100065152 392
114 3300042590 Ga0466690_045501 Ga0466690_045501_18761_19939 392
115 3300042594 Ga0466694_072581 Ga0466694_072581_239_1417 392
116 3300042609 Ga0466722_129785 Ga0466722_129785_8071_9249 392
117 3300042616 Ga0466715_638349 Ga0466715_638349_431_1609 392
118 3300042643 Ga0466704_111099 Ga0466704_111099_1316_2494 392
119 3300042652 Ga0466708_369443 Ga0466708_369443_11095_12273 392
120 3300042655 Ga0466727_264712 Ga0466727_264712_162_1340 392
121 3300002450 JGI24695J34938_10004264 JGI24695J34938_100042647 393
122 3300002450 JGI24695J34938_10023409 JGI24695J34938_100234092 393
123 3300042596 Ga0466696_036964 Ga0466696_036964_2615_3796 393
124 3300042601 Ga0466707_014796 Ga0466707_014796_33_1214 393
125 3300042620 Ga0466728_255307 Ga0466728_255307_481_1662 393
126 3300042621 Ga0466729_001776 Ga0466729_001776_510_1691 393
127 3300042636 Ga0466703_419539 Ga0466703_419539_543_1724 393
128 iso_pr_bacteria 2781125690 2781427171 393
129 3300002449 JGI24698J34947_10014185 JGI24698J34947_100141854 394
130 3300042601 Ga0466707_049510 Ga0466707_049510_244_1428 394
131 3300042601 Ga0466707_386951 Ga0466707_386951_748_1932 394
132 3300042616 Ga0466715_107156 Ga0466715_107156_8217_9401 394
133 3300042616 Ga0466715_432675 Ga0466715_432675_7037_8221 394
134 3300042616 Ga0466715_126583 Ga0466715_126583_7070_8257 395
135 3300042606 Ga0466719_386754 Ga0466719_386754_2045_3235 396
136 3300042606 Ga0466719_222490 Ga0466719_222490_1439_2632 397
137 3300042636 Ga0466703_406661 Ga0466703_406661_374_1567 397
138 3300042610 Ga0466698_424751 Ga0466698_424751_395_1591 398
139 3300042610 Ga0466698_322120 Ga0466698_322120_373_1572 399
140 3300042615 Ga0466711_038255 Ga0466711_038255_4236_5444 402
141 3300042599 Ga0466706_279736 Ga0466706_279736_349_1560 403
142 3300042596 Ga0466696_123277 Ga0466696_123277_299_1516 405
143 3300042605 Ga0466716_359382 Ga0466716_359382_484_1701 405
144 3300042616 Ga0466715_111332 Ga0466715_111332_800_2017 405
145 3300042643 Ga0466704_461388 Ga0466704_461388_4830_6053 407
146 3300042609 Ga0466722_077472 Ga0466722_077472_4220_5458 412
147 3300042615 Ga0466711_007779 Ga0466711_007779_10134_11372 412
148 3300042606 Ga0466719_108800 Ga0466719_108800_3008_4360 450

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00817 IMS impB/mucB/samB family 12 158 0.97
PF11799 IMS_C impB/mucB/samB family C-terminal domain 246 355 0.94

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00817 GO:0006281 DNA repair BP

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
4dez-assembly1.cif.gz_A Structure of MsDpo4 0.925 6 236
1im4-assembly1.cif.gz_A Crystal Structure of a DinB Homolog (DBH) Lesion Bypass DNA Polymerase Catalytic Fragment from Sulfolobus solfataricus 0.898 3 204
8ouy-assembly1.cif.gz_A Human RAD51B-RAD51C-RAD51D-XRCC2 (BCDX2) complex, 3.4 A resolution 0.867 182 221
8faz-assembly1.cif.gz_B Cryo-EM structure of the human BCDX2 complex 0.832 188 221
2bke-assembly1.cif.gz_A Conformational Flexibility Revealed by the Crystal Structure of a Crenarchaeal RadA 0.807 181 233
IDDescriptionScoreStartEndSuperfamily
af_Q2FWZ5_4_63_3.40.1170.60 Alpha Beta;3-Layer(aba) Sandwich;MutS, DNA mismatch repair protein, domain I; 0.9706 16 76 3.40.1170.60
af_Q2FWZ5_229_340_3.30.1490.100 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;DNA polymerase, Y-family, little finger domain 0.952 242 349 3.30.1490.100
af_O74944_370_477_3.30.1490.100 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;DNA polymerase, Y-family, little finger domain 0.9493 242 349 3.30.1490.100
af_P34409_148_297_3.30.70.270 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.9469 77 168 3.30.70.270
af_Q2FWZ5_64_170_3.30.70.270 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.9391 80 181 3.30.70.270
IDDescriptionScoreStartEndGO Terms
AF-A0A849FMY7-F1-model_v4 Uncharacterized/unreviewed 0.9684 6 122
AF-A0A7V1SLS1-F1-model_v4 Uncharacterized/unreviewed 0.9676 4 222

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.73 0.78 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.