Protein Family IF00665
Metagenome
Isolate
111
Members
50
Samples
108
Scaffolds
200.13
Avg Length
Representative Sequence
- ID
- 3300002450|JGI24695J34938_10015447|JGI24695J34938_100154473
- Length
- 211 aa
- Sequence
- MVTLERPKLLIVAGPNGSGKTSVTGKILKHEWIEGCEYINPDNIAHDIFGDWNSPDAVMKAVRYATDLREECIVSGRSLIFETVLSAPDKISFVQQAKQKGYFIRLFFISTDTPQINAARIARRVMTGGHDVPIPKIISRYYKSIANCEILAPVVDRLYVYDNSVENVFPQLLFRADDGKLTKQYAPVRDWAGIIFQAVASEDFQSRQSS*
Sample Types
Isolate
2.7%
Metagenome
97.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
56.2%
Kalotermitidae
16.7%
Unclassified
10.4%
Termopsidae
8.3%
Rhinotermitidae
4.2%
Passalidae
4.2%
Taxonomy
Archaea
1
Bacteria
89
Eukaryota
0
Viruses
0
Unclassified
21
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 2 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 3 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 4 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 5 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 6 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 7 | 2820171952 | Unclassified Planctomycetes Th196P3bin88 | Isolate | Unclassified |
| 8 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 9 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 10 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 11 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 12 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 13 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 14 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 15 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 16 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 17 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 18 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 19 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 20 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 21 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 22 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 23 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 24 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 25 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 26 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 27 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 28 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 29 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 30 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 31 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 32 | 2820201435 | Unclassified Planctomycetes Cu122P5bin25 | Isolate | Unclassified |
| 33 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 34 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 35 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 36 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 37 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 38 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 39 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 40 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 41 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 42 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 43 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 44 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 45 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 46 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 47 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 48 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 49 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 50 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24698J34947_10085796 | 3300002449 | Bacteria | 1461 |
| 2 | JGI24695J34938_10071381 | 3300002450 | Archaea | 1451 |
| 3 | JGI24702J35022_10006231 | 3300002462 | Bacteria | 6910 |
| 4 | JGI24705J35276_12138333 | 3300002504 | Bacteria | 1131 |
| 5 | JGI24696J40584_12708189 | 3300002834 | Unclassified | 745 |
| 6 | Ga0068302_10432688 | 3300005071 | Bacteria | 1284 |
| 7 | Ga0123353_11775520 | 3300010167 | Unclassified | 768 |
| 8 | Ga0466656_183597 | 3300042550 | Unclassified | 1485 |
| 9 | Ga0466692_159735 | 3300042591 | Unclassified | 3002 |
| 10 | Ga0466691_026195 | 3300042593 | Bacteria | 1022 |
| 11 | Ga0466691_070306 | 3300042593 | Unclassified | 2158 |
| 12 | Ga0466717_009467 | 3300042604 | Bacteria | 1501 |
| 13 | Ga0466719_039005 | 3300042606 | Bacteria | 4296 |
| 14 | Ga0466734_001138 | 3300042623 | Bacteria | 1595 |
| 15 | Ga0466702_227093 | 3300042635 | Bacteria | 1252 |
| 16 | Ga0466704_116766 | 3300042643 | Bacteria | 5768 |
| 17 | Ga0466708_133524 | 3300042652 | Bacteria | 5088 |
| 18 | IMNBL1DRAFT_c0016271 | 3300000062 | Unclassified | 3191 |
| 19 | JGI24695J34938_10015447 | 3300002450 | Bacteria | 3919 |
| 20 | Ga0072941_1251973 | 3300005201 | Bacteria | 1079 |
| 21 | Ga0123356_10132613 | 3300010049 | Bacteria | 2444 |
| 22 | Ga0123354_10232519 | 3300010882 | Bacteria | 1922 |
| 23 | Ga0123354_10315103 | 3300010882 | Bacteria | 1454 |
| 24 | Ga0466710_404052 | 3300042613 | Unclassified | 1436 |
| 25 | Ga0466657_390579 | 3300042582 | Unclassified | 1468 |
| 26 | Ga0466692_115412 | 3300042591 | Bacteria | 2445 |
| 27 | Ga0466707_038273 | 3300042601 | Unclassified | 1430 |
| 28 | Ga0466719_493888 | 3300042606 | Bacteria | 1634 |
| 29 | Ga0466735_061379 | 3300042624 | Bacteria | 2567 |
| 30 | Ga0466703_006705 | 3300042636 | Bacteria | 6097 |
| 31 | Ga0466708_026268 | 3300042652 | Bacteria | 10701 |
| 32 | Ga0466732_195053 | 3300042656 | Bacteria | 2044 |
| 33 | 2227094710 | 2225789004 | Bacteria | 9724 |
| 34 | JGI24702J35022_10015293 | 3300002462 | Bacteria | 4227 |
| 35 | Ga0123356_10384437 | 3300010049 | Bacteria | 1537 |
| 36 | Ga0123354_10468974 | 3300010882 | Unclassified | 1005 |
| 37 | Ga0264413_105182 | 3300024493 | Bacteria | 2035 |
| 38 | Ga0466692_135893 | 3300042591 | Unclassified | 1654 |
| 39 | Ga0466693_282214 | 3300042592 | Unclassified | 1451 |
| 40 | Ga0466693_444120 | 3300042592 | Unclassified | 1427 |
| 41 | Ga0466691_053829 | 3300042593 | Bacteria | 6426 |
| 42 | Ga0466696_132627 | 3300042596 | Bacteria | 7794 |
| 43 | Ga0466701_042885 | 3300042598 | Bacteria | 1533 |
| 44 | Ga0466701_071045 | 3300042598 | Bacteria | 3548 |
| 45 | Ga0466717_099969 | 3300042604 | Unclassified | 1128 |
| 46 | Ga0466721_129961 | 3300042608 | Bacteria | 1196 |
| 47 | Ga0466704_166162 | 3300042643 | Bacteria | 7682 |
| 48 | Ga0466733_222069 | 3300042659 | Bacteria | 1175 |
| 49 | JGI24696J40584_12729301 | 3300002834 | Bacteria | 768 |
| 50 | Ga0123357_10187126 | 3300009784 | Bacteria | 2399 |
| 51 | Ga0123356_10713874 | 3300010049 | Bacteria | 1172 |
| 52 | Ga0123353_10314081 | 3300010167 | Bacteria | 2383 |
| 53 | Ga0123353_10875044 | 3300010167 | Bacteria | 1227 |
| 54 | Ga0123354_10217988 | 3300010882 | Bacteria | 2038 |
| 55 | Ga0466695_393179 | 3300042595 | Bacteria | 1720 |
| 56 | Ga0466699_294966 | 3300042597 | Bacteria | 1060 |
| 57 | Ga0466700_022560 | 3300042600 | Bacteria | 3116 |
| 58 | Ga0466713_037582 | 3300042602 | Bacteria | 14048 |
| 59 | Ga0466719_240936 | 3300042606 | Bacteria | 1010 |
| 60 | Ga0466702_300178 | 3300042635 | Unclassified | 1200 |
| 61 | Ga0466703_232329 | 3300042636 | Bacteria | 1338 |
| 62 | IMNBL1DRAFT_c0071721 | 3300000062 | Bacteria | 997 |
| 63 | JGI24695J34938_10059155 | 3300002450 | Bacteria | 1640 |
| 64 | JGI24702J35022_10006961 | 3300002462 | Bacteria | 6500 |
| 65 | Ga0123353_10018294 | 3300010167 | Bacteria | 10354 |
| 66 | Ga0123353_10597696 | 3300010167 | Bacteria | 1578 |
| 67 | Ga0466693_007240 | 3300042592 | Unclassified | 1213 |
| 68 | Ga0466707_323029 | 3300042601 | Bacteria | 6297 |
| 69 | Ga0466714_041039 | 3300042603 | Bacteria | 123706 |
| 70 | Ga0466722_074082 | 3300042609 | Bacteria | 11396 |
| 71 | Ga0466722_186866 | 3300042609 | Bacteria | 1608 |
| 72 | Ga0466722_200721 | 3300042609 | Unclassified | 1429 |
| 73 | JGI24695J34938_10079065 | 3300002450 | Bacteria | 1361 |
| 74 | JGI24702J35022_10032753 | 3300002462 | Bacteria | 2781 |
| 75 | Ga0123356_10290558 | 3300010049 | Bacteria | 1735 |
| 76 | Ga0123353_10062637 | 3300010167 | Bacteria | 5965 |
| 77 | Ga0123354_10002568 | 3300010882 | Bacteria | 24173 |
| 78 | Ga0466710_172880 | 3300042613 | Bacteria | 1496 |
| 79 | Ga0466711_027562 | 3300042615 | Bacteria | 1689 |
| 80 | Ga0466717_065389 | 3300042604 | Unclassified | 2013 |
| 81 | Ga0466719_538449 | 3300042606 | Bacteria | 1734 |
| 82 | Ga0466698_167444 | 3300042610 | Unclassified | 1078 |
| 83 | Ga0466734_056077 | 3300042623 | Bacteria | 3099 |
| 84 | Ga0466734_147820 | 3300042623 | Bacteria | 1027 |
| 85 | Ga0466727_350542 | 3300042655 | Bacteria | 1134 |
| 86 | Ga0466733_167867 | 3300042659 | Bacteria | 6643 |
| 87 | Ga0123354_10001526 | 3300010882 | Bacteria | 28355 |
| 88 | Ga0123354_10270362 | 3300010882 | Bacteria | 1675 |
| 89 | Ga0123354_10273909 | 3300010882 | Bacteria | 1655 |
| 90 | Ga0466712_012280 | 3300042614 | Bacteria | 4191 |
| 91 | Ga0466726_461753 | 3300042619 | Bacteria | 1128 |
| 92 | Ga0466701_015670 | 3300042598 | Bacteria | 2002 |
| 93 | Ga0466719_024220 | 3300042606 | Unclassified | 1557 |
| 94 | Ga0466709_330746 | 3300042648 | Bacteria | 30118 |
| 95 | JGI24702J35022_10032539 | 3300002462 | Bacteria | 2792 |
| 96 | JGI24699J35502_11132846 | 3300002509 | Bacteria | 7764 |
| 97 | JGI24696J40584_12919915 | 3300002834 | Bacteria | 1337 |
| 98 | Ga0072941_1135620 | 3300005201 | Bacteria | 4179 |
| 99 | Ga0123356_10149056 | 3300010049 | Bacteria | 2320 |
| 100 | Ga0123356_10730566 | 3300010049 | Bacteria | 1160 |
| 101 | Ga0123356_10747371 | 3300010049 | Bacteria | 1148 |
| 102 | Ga0123354_10363778 | 3300010882 | Unclassified | 1272 |
| 103 | Ga0466695_182397 | 3300042595 | Bacteria | 1078 |
| 104 | Ga0466722_170206 | 3300042609 | Bacteria | 13530 |
| 105 | Ga0466735_044405 | 3300042624 | Bacteria | 1219 |
| 106 | Ga0466703_093022 | 3300042636 | Bacteria | 1475 |
| 107 | Ga0466703_128442 | 3300042636 | Bacteria | 1643 |
| 108 | Ga0466727_001164 | 3300042655 | Bacteria | 7744 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | iso_pr_bacteria | 2820171952 | 2820173540 | 169 |
| 2 | 3300042623 | Ga0466734_001138 | Ga0466734_001138_12_533 | 173 |
| 3 | 3300010882 | Ga0123354_10002568 | Ga0123354_1000256812 | 188 |
| 4 | 3300042636 | Ga0466703_232329 | Ga0466703_232329_498_1085 | 195 |
| 5 | 3300002834 | JGI24696J40584_12729301 | JGI24696J40584_127293012 | 197 |
| 6 | 3300042550 | Ga0466656_183597 | Ga0466656_183597_447_1040 | 197 |
| 7 | 3300042595 | Ga0466695_182397 | Ga0466695_182397_281_874 | 197 |
| 8 | 3300042595 | Ga0466695_393179 | Ga0466695_393179_830_1423 | 197 |
| 9 | 3300042600 | Ga0466700_022560 | Ga0466700_022560_2325_2918 | 197 |
| 10 | 3300042604 | Ga0466717_009467 | Ga0466717_009467_398_991 | 197 |
| 11 | 3300042609 | Ga0466722_200721 | Ga0466722_200721_573_1166 | 197 |
| 12 | 3300042613 | Ga0466710_172880 | Ga0466710_172880_482_1075 | 197 |
| 13 | 3300042613 | Ga0466710_404052 | Ga0466710_404052_252_845 | 197 |
| 14 | 3300042614 | Ga0466712_012280 | Ga0466712_012280_139_732 | 197 |
| 15 | 3300042635 | Ga0466702_227093 | Ga0466702_227093_425_1018 | 197 |
| 16 | 3300042635 | Ga0466702_300178 | Ga0466702_300178_392_985 | 197 |
| 17 | 3300042636 | Ga0466703_006705 | Ga0466703_006705_2846_3439 | 197 |
| 18 | 3300042636 | Ga0466703_093022 | Ga0466703_093022_546_1139 | 197 |
| 19 | 3300042656 | Ga0466732_195053 | Ga0466732_195053_312_905 | 197 |
| 20 | 3300042659 | Ga0466733_167867 | Ga0466733_167867_2513_3106 | 197 |
| 21 | 2225789004 | 2227094710 | 2227475438 | 198 |
| 22 | 3300002462 | JGI24702J35022_10015293 | JGI24702J35022_100152936 | 198 |
| 23 | 3300002462 | JGI24702J35022_10032753 | JGI24702J35022_100327533 | 198 |
| 24 | 3300002504 | JGI24705J35276_12138333 | JGI24705J35276_121383331 | 198 |
| 25 | 3300002834 | JGI24696J40584_12919915 | JGI24696J40584_129199152 | 198 |
| 26 | 3300010167 | Ga0123353_11775520 | Ga0123353_117755202 | 198 |
| 27 | 3300010882 | Ga0123354_10232519 | Ga0123354_102325193 | 198 |
| 28 | 3300010882 | Ga0123354_10315103 | Ga0123354_103151033 | 198 |
| 29 | 3300010882 | Ga0123354_10363778 | Ga0123354_103637783 | 198 |
| 30 | 3300010882 | Ga0123354_10468974 | Ga0123354_104689742 | 198 |
| 31 | 3300042592 | Ga0466693_444120 | Ga0466693_444120_642_1238 | 198 |
| 32 | 3300042601 | Ga0466707_323029 | Ga0466707_323029_4711_5307 | 198 |
| 33 | 3300042602 | Ga0466713_037582 | Ga0466713_037582_7323_7919 | 198 |
| 34 | 3300042615 | Ga0466711_027562 | Ga0466711_027562_65_661 | 198 |
| 35 | 3300042655 | Ga0466727_350542 | Ga0466727_350542_145_741 | 198 |
| 36 | 3300000062 | IMNBL1DRAFT_c0016271 | IMNBL1DRAFT_00162714 | 199 |
| 37 | 3300002462 | JGI24702J35022_10006231 | JGI24702J35022_100062314 | 199 |
| 38 | 3300002834 | JGI24696J40584_12708189 | JGI24696J40584_127081891 | 199 |
| 39 | 3300010049 | Ga0123356_10747371 | Ga0123356_107473711 | 199 |
| 40 | 3300010167 | Ga0123353_10314081 | Ga0123353_103140812 | 199 |
| 41 | 3300010167 | Ga0123353_10597696 | Ga0123353_105976962 | 199 |
| 42 | 3300010882 | Ga0123354_10273909 | Ga0123354_102739092 | 199 |
| 43 | 3300042591 | Ga0466692_135893 | Ga0466692_135893_919_1518 | 199 |
| 44 | 3300042601 | Ga0466707_038273 | Ga0466707_038273_496_1095 | 199 |
| 45 | 3300042604 | Ga0466717_099969 | Ga0466717_099969_381_980 | 199 |
| 46 | 3300042606 | Ga0466719_240936 | Ga0466719_240936_349_948 | 199 |
| 47 | 3300042606 | Ga0466719_493888 | Ga0466719_493888_537_1136 | 199 |
| 48 | 3300042652 | Ga0466708_133524 | Ga0466708_133524_4256_4855 | 199 |
| 49 | 3300042659 | Ga0466733_222069 | Ga0466733_222069_249_848 | 199 |
| 50 | iso_pr_bacteria | 2820201435 | 2820204401 | 199 |
| 51 | iso_pr_bacteria | 2820759988 | 2820760356 | 199 |
| 52 | 3300002509 | JGI24699J35502_11132846 | JGI24699J35502_111328464 | 200 |
| 53 | 3300005201 | Ga0072941_1251973 | Ga0072941_12519732 | 200 |
| 54 | 3300009784 | Ga0123357_10187126 | Ga0123357_101871262 | 200 |
| 55 | 3300010049 | Ga0123356_10713874 | Ga0123356_107138742 | 200 |
| 56 | 3300010049 | Ga0123356_10730566 | Ga0123356_107305661 | 200 |
| 57 | 3300010882 | Ga0123354_10001526 | Ga0123354_1000152620 | 200 |
| 58 | 3300010882 | Ga0123354_10217988 | Ga0123354_102179882 | 200 |
| 59 | 3300024493 | Ga0264413_105182 | Ga0264413_1051822 | 200 |
| 60 | 3300042593 | Ga0466691_053829 | Ga0466691_053829_5377_5979 | 200 |
| 61 | 3300042606 | Ga0466719_024220 | Ga0466719_024220_69_671 | 200 |
| 62 | 3300042608 | Ga0466721_129961 | Ga0466721_129961_277_879 | 200 |
| 63 | 3300042623 | Ga0466734_147820 | Ga0466734_147820_360_962 | 200 |
| 64 | 3300042624 | Ga0466735_061379 | Ga0466735_061379_932_1534 | 200 |
| 65 | 3300042636 | Ga0466703_128442 | Ga0466703_128442_744_1346 | 200 |
| 66 | 3300000062 | IMNBL1DRAFT_c0071721 | IMNBL1DRAFT_00717212 | 201 |
| 67 | 3300002449 | JGI24698J34947_10085796 | JGI24698J34947_100857963 | 201 |
| 68 | 3300002450 | JGI24695J34938_10059155 | JGI24695J34938_100591552 | 201 |
| 69 | 3300005071 | Ga0068302_10432688 | Ga0068302_104326882 | 201 |
| 70 | 3300010049 | Ga0123356_10290558 | Ga0123356_102905582 | 201 |
| 71 | 3300010167 | Ga0123353_10018294 | Ga0123353_1001829413 | 201 |
| 72 | 3300010167 | Ga0123353_10875044 | Ga0123353_108750442 | 201 |
| 73 | 3300042592 | Ga0466693_007240 | Ga0466693_007240_366_971 | 201 |
| 74 | 3300042596 | Ga0466696_132627 | Ga0466696_132627_6415_7020 | 201 |
| 75 | 3300042598 | Ga0466701_042885 | Ga0466701_042885_333_938 | 201 |
| 76 | 3300042603 | Ga0466714_041039 | Ga0466714_041039_94687_95292 | 201 |
| 77 | 3300042606 | Ga0466719_039005 | Ga0466719_039005_1957_2562 | 201 |
| 78 | 3300042619 | Ga0466726_461753 | Ga0466726_461753_114_719 | 201 |
| 79 | 3300010049 | Ga0123356_10149056 | Ga0123356_101490562 | 202 |
| 80 | 3300010049 | Ga0123356_10384437 | Ga0123356_103844372 | 202 |
| 81 | 3300042598 | Ga0466701_071045 | Ga0466701_071045_2411_3019 | 202 |
| 82 | 3300042623 | Ga0466734_056077 | Ga0466734_056077_548_1156 | 202 |
| 83 | 3300042624 | Ga0466735_044405 | Ga0466735_044405_116_724 | 202 |
| 84 | 3300042652 | Ga0466708_026268 | Ga0466708_026268_7489_8097 | 202 |
| 85 | 3300005201 | Ga0072941_1135620 | Ga0072941_11356204 | 203 |
| 86 | 3300010882 | Ga0123354_10270362 | Ga0123354_102703622 | 203 |
| 87 | 3300042591 | Ga0466692_115412 | Ga0466692_115412_124_735 | 203 |
| 88 | 3300042606 | Ga0466719_538449 | Ga0466719_538449_849_1460 | 203 |
| 89 | 3300042648 | Ga0466709_330746 | Ga0466709_330746_22596_23207 | 203 |
| 90 | 3300002462 | JGI24702J35022_10006961 | JGI24702J35022_100069614 | 204 |
| 91 | 3300010049 | Ga0123356_10132613 | Ga0123356_101326133 | 204 |
| 92 | 3300042582 | Ga0466657_390579 | Ga0466657_390579_207_821 | 204 |
| 93 | 3300042591 | Ga0466692_159735 | Ga0466692_159735_1241_1855 | 204 |
| 94 | 3300042592 | Ga0466693_282214 | Ga0466693_282214_280_894 | 204 |
| 95 | 3300042598 | Ga0466701_015670 | Ga0466701_015670_538_1152 | 204 |
| 96 | 3300010167 | Ga0123353_10062637 | Ga0123353_100626374 | 205 |
| 97 | 3300042604 | Ga0466717_065389 | Ga0466717_065389_360_977 | 205 |
| 98 | 3300042609 | Ga0466722_170206 | Ga0466722_170206_5050_5667 | 205 |
| 99 | 3300042609 | Ga0466722_186866 | Ga0466722_186866_444_1061 | 205 |
| 100 | 3300042643 | Ga0466704_116766 | Ga0466704_116766_1655_2272 | 205 |
| 101 | 3300042643 | Ga0466704_166162 | Ga0466704_166162_6140_6757 | 205 |
| 102 | 3300042593 | Ga0466691_070306 | Ga0466691_070306_361_981 | 206 |
| 103 | 3300042655 | Ga0466727_001164 | Ga0466727_001164_2514_3134 | 206 |
| 104 | 3300042593 | Ga0466691_026195 | Ga0466691_026195_214_837 | 207 |
| 105 | 3300042610 | Ga0466698_167444 | Ga0466698_167444_370_993 | 207 |
| 106 | 3300002450 | JGI24695J34938_10071381 | JGI24695J34938_100713813 | 208 |
| 107 | 3300002462 | JGI24702J35022_10032539 | JGI24702J35022_100325392 | 208 |
| 108 | 3300002450 | JGI24695J34938_10079065 | JGI24695J34938_100790652 | 209 |
| 109 | 3300042609 | Ga0466722_074082 | Ga0466722_074082_10427_11056 | 209 |
| 110 | 3300002450 | JGI24695J34938_10015447 | JGI24695J34938_100154473 | 211 |
| 111 | 3300042597 | Ga0466699_294966 | Ga0466699_294966_325_981 | 218 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.9 | 0.9 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.