Protein Family IF00661

Metagenome Isolate
128 Members
52 Samples
118 Scaffolds
360.83 Avg Length

🧬 Representative Sequence

ID
3300002450|JGI24695J34938_10014345|JGI24695J34938_100143453
Length
395 aa
Sequence
LKYSACFGKITVDDQHLDMFCFHWGFAMDTRAVLGFFSPWIVYAVITLLHVALPAMRRKGYVRHEHTGKLMEYKLNGHLVLPGTILLWLVLGYIQLVPWTWLYEIRWYGLAGAVTLGILFTLIIVLPWPAKRKNILADLWFGRLKDPQCKKGNLLIDTKMWLYLVGAVMLQLNVLSCLTYHWQMAYYLQDFDFNPGLLMGVAMITFFVWDYLSFEGVHLYTYDFIAERVGFKLGFGCLAFYPFFYTIAIWSTAHLPNPGHPMWLNVLFILVFVSGWVLARGANLQKYYFKISPAKKFLGIKPKVLTDEKYSLLVNGWWGKSRHINYLGEILMACGIALAAGYPGVLWVWLYPLYYVCLLFTRQVDDDKICGAKYGELWEKYKKKVKYRIIPYIY*

πŸ“Š Sample Types

Isolate 7.8%
Metagenome 92.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 46.0%
Unclassified 22.0%
Kalotermitidae 20.0%
Rhinotermitidae 6.0%
Termopsidae 6.0%

🌳 Taxonomy

Archaea 0
Bacteria 108
Eukaryota 0
Viruses 0
Unclassified 20

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
2 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
3 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
4 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
5 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
6 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
7 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
8 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
9 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
10 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
11 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
12 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
13 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
14 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
15 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
16 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
17 2781125683 Treponema sp. Lab288P1bin34 Isolate Unclassified
18 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
19 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
20 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
21 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
22 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
23 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
24 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
25 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
26 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
27 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
28 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
29 2820899690 Unclassified Actinobacteria Emb289P4bin9 Isolate Unclassified
30 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
31 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
32 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
33 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
34 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
35 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
36 2781125633 Treponema sp. Co191P1bin38 Isolate Unclassified
37 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
38 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
39 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
40 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
41 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
42 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
43 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
44 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
45 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
46 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
47 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
48 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
49 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
50 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
51 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
52 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_194127 3300042656 Bacteria 14271
2 Ga0466703_031350 3300042636 Bacteria 3119
3 Ga0466708_314653 3300042652 Unclassified 2292
4 Ga0466708_332073 3300042652 Bacteria 2832
5 Ga0466726_015961 3300042619 Bacteria 12630
6 Ga0466726_100390 3300042619 Unclassified 1737
7 Ga0415639_102615 3300038395 Bacteria 2484
8 Ga0466692_014731 3300042591 Bacteria 6266
9 Ga0466694_290608 3300042594 Bacteria 1760
10 Ga0466696_440693 3300042596 Bacteria 4222
11 Ga0123357_10043859 3300009784 Bacteria 6073
12 Ga0123356_10000347 3300010049 Bacteria 53419
13 Ga0466713_077253 3300042602 Bacteria 4636
14 Ga0466720_019106 3300042607 Bacteria 4203
15 AustNasuHG_c1000894 3300000089 Bacteria 10770
16 Ga0072941_1225186 3300005201 Unclassified 2649
17 Ga0466733_035473 3300042659 Bacteria 3899
18 Ga0466733_202744 3300042659 Bacteria 1112
19 Ga0466704_164360 3300042643 Bacteria 2506
20 Ga0466704_223677 3300042643 Bacteria 60624
21 Ga0466704_234381 3300042643 Unclassified 2949
22 Ga0466727_187459 3300042655 Bacteria 10031
23 Ga0466727_232302 3300042655 Bacteria 3136
24 Ga0264413_108801 3300024493 Bacteria 7039
25 Ga0466692_127478 3300042591 Bacteria 5991
26 Ga0466691_050116 3300042593 Bacteria 8731
27 Ga0466694_005840 3300042594 Bacteria 106514
28 Ga0466694_307475 3300042594 Bacteria 21455
29 Ga0123357_10041671 3300009784 Bacteria 6244
30 Ga0123355_10045087 3300009826 Bacteria 7172
31 Ga0123356_10015425 3300010049 Bacteria 7325
32 Ga0123353_10157088 3300010167 Bacteria 3624
33 Ga0466717_087572 3300042604 Unclassified 1762
34 Ga0466722_227357 3300042609 Bacteria 4941
35 JGI24695J34938_10002766 3300002450 Bacteria 12883
36 Ga0072941_1008539 3300005201 Bacteria 19799
37 Ga0466705_264604 3300042612 Bacteria 11921
38 Ga0466732_382113 3300042656 Bacteria 18383
39 Ga0466732_398637 3300042656 Bacteria 2400
40 Ga0466731_399476 3300042622 Unclassified 1708
41 Ga0466702_243639 3300042635 Bacteria 2276
42 Ga0466702_466320 3300042635 Bacteria 5761
43 Ga0466703_090445 3300042636 Bacteria 53496
44 Ga0466694_315036 3300042594 Bacteria 3707
45 Ga0123357_10222468 3300009784 Bacteria 2090
46 Ga0123353_10346177 3300010167 Bacteria 2242
47 Ga0466720_164728 3300042607 Unclassified 2488
48 JGI24695J34938_10012447 3300002450 Bacteria 4506
49 JGI24695J34938_10052606 3300002450 Bacteria 1776
50 Ga0072941_1013718 3300005201 Bacteria 3306
51 Ga0466711_359607 3300042615 Bacteria 14591
52 Ga0466715_228029 3300042616 Bacteria 3876
53 Ga0123356_10019625 3300010049 Unclassified 6405
54 Ga0466707_188207 3300042601 Bacteria 2444
55 Ga0466720_053320 3300042607 Unclassified 8455
56 Ga0466720_178546 3300042607 Bacteria 2012
57 AustNasuHG_c1013110 3300000089 Bacteria 2849
58 JGI24695J34938_10012131 3300002450 Bacteria 4588
59 JGI24695J34938_10048049 3300002450 Bacteria 1881
60 Ga0466735_001515 3300042624 Unclassified 1866
61 Ga0466704_471343 3300042643 Bacteria 26146
62 Ga0466712_106716 3300042614 Bacteria 19386
63 Ga0466715_252314 3300042616 Bacteria 2609
64 Ga0466692_162332 3300042591 Unclassified 1813
65 Ga0466699_417920 3300042597 Bacteria 13952
66 Ga0123357_10176566 3300009784 Bacteria 2509
67 Ga0123356_10041427 3300010049 Bacteria 4291
68 Ga0466698_257622 3300042610 Unclassified 1686
69 AustNasuHG_c1034454 3300000089 Bacteria 1355
70 JGI24695J34938_10003115 3300002450 Bacteria 11839
71 JGI24695J34938_10005312 3300002450 Bacteria 8081
72 JGI24702J35022_10112552 3300002462 Bacteria 1497
73 Ga0072941_1257473 3300005201 Unclassified 1170
74 Ga0466732_179723 3300042656 Bacteria 33126
75 Ga0466733_222652 3300042659 Bacteria 9297
76 Ga0466703_398152 3300042636 Bacteria 5127
77 Ga0466704_129775 3300042643 Bacteria 7647
78 Ga0466715_038842 3300042616 Bacteria 3055
79 Ga0466723_310461 3300042618 Bacteria 15924
80 Ga0466692_169984 3300042591 Bacteria 1776
81 Ga0466693_128816 3300042592 Bacteria 39215
82 Ga0466696_400362 3300042596 Bacteria 4309
83 Ga0466701_013913 3300042598 Bacteria 5747
84 Ga0123357_10034507 3300009784 Bacteria 6879
85 Ga0123353_10327348 3300010167 Bacteria 2322
86 Ga0466701_041932 3300042598 Bacteria 42746
87 Ga0466720_016072 3300042607 Unclassified 3288
88 Ga0466720_097559 3300042607 Bacteria 11725
89 Ga0466721_018710 3300042608 Bacteria 2237
90 JGI24698J34947_10014721 3300002449 Bacteria 4261
91 JGI24695J34938_10000369 3300002450 Bacteria 44536
92 JGI24695J34938_10001087 3300002450 Bacteria 24560
93 JGI24695J34938_10003220 3300002450 Bacteria 11564
94 Ga0072941_1013719 3300005201 Bacteria 5327
95 Ga0072941_1131468 3300005201 Bacteria 2331
96 Ga0466705_188506 3300042612 Bacteria 6263
97 Ga0466735_157949 3300042624 Unclassified 2576
98 Ga0466702_237616 3300042635 Bacteria 1924
99 Ga0466699_151960 3300042597 Bacteria 2263
100 Ga0123353_10059197 3300010167 Bacteria 6142
101 Ga0123353_10300974 3300010167 Bacteria 2448
102 Ga0123354_10284063 3300010882 Unclassified 1601
103 AustNasuHG_c1021719 3300000089 Unclassified 2073
104 JGI24698J34947_10068587 3300002449 Bacteria 1715
105 JGI24695J34938_10001209 3300002450 Bacteria 22895
106 Ga0466705_019927 3300042612 Unclassified 1327
107 Ga0466731_170078 3300042622 Bacteria 2069
108 Ga0466726_092026 3300042619 Bacteria 16239
109 Ga0466729_161140 3300042621 Unclassified 1826
110 Ga0466699_215053 3300042597 Bacteria 9440
111 Ga0123354_10026234 3300010882 Bacteria 9189
112 Ga0466707_223481 3300042601 Bacteria 1821
113 Ga0466719_264404 3300042606 Bacteria 4820
114 Ga0466698_327020 3300042610 Unclassified 1679
115 JGI24695J34938_10000033 3300002450 Bacteria 103928
116 JGI24695J34938_10000779 3300002450 Bacteria 29860
117 JGI24695J34938_10014345 3300002450 Bacteria 4112
118 Ga0072941_1002307 3300005201 Bacteria 25899

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042659 Ga0466733_202744 Ga0466733_202744_109_1035 308
2 3300042652 Ga0466708_314653 Ga0466708_314653_1177_2256 333
3 3300042624 Ga0466735_001515 Ga0466735_001515_331_1458 336
4 3300042624 Ga0466735_157949 Ga0466735_157949_21_1100 338
5 3300042594 Ga0466694_290608 Ga0466694_290608_639_1658 339
6 3300042643 Ga0466704_223677 Ga0466704_223677_37157_38176 339
7 3300042602 Ga0466713_077253 Ga0466713_077253_3488_4567 347
8 3300042622 Ga0466731_170078 Ga0466731_170078_491_1561 356
9 3300042643 Ga0466704_129775 Ga0466704_129775_6003_7109 356
10 3300042659 Ga0466733_035473 Ga0466733_035473_19_1089 356
11 3300042610 Ga0466698_257622 Ga0466698_257622_504_1577 357
12 3300002449 JGI24698J34947_10014721 JGI24698J34947_100147214 358
13 3300038395 Ga0415639_102615 Ga0415639_102615_535_1611 358
14 3300042607 Ga0466720_019106 Ga0466720_019106_1192_2268 358
15 3300042607 Ga0466720_053320 Ga0466720_053320_7239_8315 358
16 3300042607 Ga0466720_097559 Ga0466720_097559_4558_5634 358
17 3300042656 Ga0466732_398637 Ga0466732_398637_683_1759 358
18 3300042659 Ga0466733_222652 Ga0466733_222652_901_1977 358
19 iso_pr_bacteria 2820899690 2820900150 358
20 3300009784 Ga0123357_10034507 Ga0123357_100345075 359
21 3300009784 Ga0123357_10043859 Ga0123357_100438594 359
22 3300009784 Ga0123357_10176566 Ga0123357_101765663 359
23 3300009784 Ga0123357_10222468 Ga0123357_102224681 359
24 3300010049 Ga0123356_10000347 Ga0123356_100003478 359
25 3300010167 Ga0123353_10157088 Ga0123353_101570882 359
26 3300010167 Ga0123353_10300974 Ga0123353_103009742 359
27 3300010167 Ga0123353_10327348 Ga0123353_103273481 359
28 3300010167 Ga0123353_10346177 Ga0123353_103461773 359
29 3300010882 Ga0123354_10026234 Ga0123354_100262344 359
30 3300010882 Ga0123354_10284063 Ga0123354_102840631 359
31 3300042591 Ga0466692_127478 Ga0466692_127478_2295_3374 359
32 3300042591 Ga0466692_169984 Ga0466692_169984_179_1258 359
33 3300042593 Ga0466691_050116 Ga0466691_050116_1679_2758 359
34 3300042594 Ga0466694_307475 Ga0466694_307475_5129_6208 359
35 3300042594 Ga0466694_315036 Ga0466694_315036_1072_2151 359
36 3300042596 Ga0466696_400362 Ga0466696_400362_2327_3406 359
37 3300042596 Ga0466696_440693 Ga0466696_440693_475_1554 359
38 3300042597 Ga0466699_151960 Ga0466699_151960_98_1177 359
39 3300042597 Ga0466699_215053 Ga0466699_215053_1302_2381 359
40 3300042597 Ga0466699_417920 Ga0466699_417920_2935_4014 359
41 3300042598 Ga0466701_013913 Ga0466701_013913_3308_4387 359
42 3300042598 Ga0466701_041932 Ga0466701_041932_31131_32210 359
43 3300042601 Ga0466707_188207 Ga0466707_188207_981_2060 359
44 3300042601 Ga0466707_223481 Ga0466707_223481_199_1278 359
45 3300042604 Ga0466717_087572 Ga0466717_087572_595_1674 359
46 3300042606 Ga0466719_264404 Ga0466719_264404_2208_3287 359
47 3300042607 Ga0466720_016072 Ga0466720_016072_717_1796 359
48 3300042607 Ga0466720_164728 Ga0466720_164728_1379_2458 359
49 3300042609 Ga0466722_227357 Ga0466722_227357_2861_3940 359
50 3300042612 Ga0466705_019927 Ga0466705_019927_208_1287 359
51 3300042612 Ga0466705_188506 Ga0466705_188506_5129_6208 359
52 3300042612 Ga0466705_264604 Ga0466705_264604_9334_10413 359
53 3300042614 Ga0466712_106716 Ga0466712_106716_15808_16887 359
54 3300042616 Ga0466715_038842 Ga0466715_038842_1266_2345 359
55 3300042616 Ga0466715_228029 Ga0466715_228029_1160_2239 359
56 3300042616 Ga0466715_252314 Ga0466715_252314_149_1228 359
57 3300042618 Ga0466723_310461 Ga0466723_310461_7615_8694 359
58 3300042619 Ga0466726_015961 Ga0466726_015961_1326_2405 359
59 3300042619 Ga0466726_092026 Ga0466726_092026_3394_4500 359
60 3300042619 Ga0466726_100390 Ga0466726_100390_102_1181 359
61 3300042636 Ga0466703_090445 Ga0466703_090445_48775_49854 359
62 3300042636 Ga0466703_398152 Ga0466703_398152_870_1949 359
63 3300042643 Ga0466704_164360 Ga0466704_164360_1248_2327 359
64 3300042643 Ga0466704_234381 Ga0466704_234381_1452_2531 359
65 3300042643 Ga0466704_471343 Ga0466704_471343_10399_11478 359
66 3300042652 Ga0466708_332073 Ga0466708_332073_1343_2422 359
67 3300042655 Ga0466727_187459 Ga0466727_187459_2029_3108 359
68 3300042655 Ga0466727_232302 Ga0466727_232302_1127_2206 359
69 iso_pr_bacteria 2781125629 2781264003 359
70 iso_pr_bacteria 2820899690 2820900217 359
71 3300000089 AustNasuHG_c1000894 AustNasuHG_10008944 360
72 3300000089 AustNasuHG_c1013110 AustNasuHG_10131102 360
73 3300000089 AustNasuHG_c1021719 AustNasuHG_10217192 360
74 3300000089 AustNasuHG_c1034454 AustNasuHG_10344542 360
75 3300005201 Ga0072941_1131468 Ga0072941_11314683 360
76 3300005201 Ga0072941_1225186 Ga0072941_12251861 360
77 3300009784 Ga0123357_10041671 Ga0123357_100416717 360
78 3300010049 Ga0123356_10041427 Ga0123356_100414273 360
79 3300024493 Ga0264413_108801 Ga0264413_1088016 360
80 3300042607 Ga0466720_178546 Ga0466720_178546_86_1168 360
81 3300042608 Ga0466721_018710 Ga0466721_018710_128_1210 360
82 3300042622 Ga0466731_399476 Ga0466731_399476_432_1514 360
83 3300042635 Ga0466702_466320 Ga0466702_466320_4593_5675 360
84 3300042656 Ga0466732_179723 Ga0466732_179723_29147_30229 360
85 3300042656 Ga0466732_382113 Ga0466732_382113_10357_11439 360
86 3300005201 Ga0072941_1257473 Ga0072941_12574731 361
87 3300042591 Ga0466692_014731 Ga0466692_014731_3126_4211 361
88 3300042591 Ga0466692_162332 Ga0466692_162332_527_1612 361
89 3300042592 Ga0466693_128816 Ga0466693_128816_8612_9697 361
90 3300042610 Ga0466698_327020 Ga0466698_327020_371_1456 361
91 3300042621 Ga0466729_161140 Ga0466729_161140_350_1435 361
92 3300042635 Ga0466702_243639 Ga0466702_243639_730_1815 361
93 3300002450 JGI24695J34938_10005312 JGI24695J34938_100053123 362
94 3300042636 Ga0466703_031350 Ga0466703_031350_1725_2813 362
95 3300002450 JGI24695J34938_10002766 JGI24695J34938_100027664 363
96 3300002450 JGI24695J34938_10048049 JGI24695J34938_100480492 363
97 3300002462 JGI24702J35022_10112552 JGI24702J35022_101125522 363
98 3300010167 Ga0123353_10059197 Ga0123353_100591972 363
99 3300042615 Ga0466711_359607 Ga0466711_359607_484_1575 363
100 iso_pr_bacteria 2781125640 2781288735 363
101 3300002449 JGI24698J34947_10068587 JGI24698J34947_100685872 364
102 3300005201 Ga0072941_1013718 Ga0072941_10137184 364
103 3300042594 Ga0466694_005840 Ga0466694_005840_64912_66006 364
104 iso_pr_bacteria 2781125638 2781284664 365
105 3300002450 JGI24695J34938_10000033 JGI24695J34938_1000003356 366
106 3300002450 JGI24695J34938_10001209 JGI24695J34938_1000120913 366
107 3300002450 JGI24695J34938_10003220 JGI24695J34938_1000322010 366
108 3300002450 JGI24695J34938_10012447 JGI24695J34938_100124474 366
109 3300002450 JGI24695J34938_10052606 JGI24695J34938_100526062 366
110 3300010049 Ga0123356_10015425 Ga0123356_100154253 366
111 3300042635 Ga0466702_237616 Ga0466702_237616_500_1600 366
112 iso_pr_bacteria 2781125647 2781303438 368
113 iso_pr_bacteria 2781125683 2781411696 368
114 3300002450 JGI24695J34938_10001087 JGI24695J34938_1000108716 369
115 3300005201 Ga0072941_1002307 Ga0072941_10023076 369
116 3300005201 Ga0072941_1008539 Ga0072941_10085392 369
117 3300005201 Ga0072941_1013719 Ga0072941_10137192 369
118 iso_pr_bacteria 2781125659 2781328617 371
119 3300010049 Ga0123356_10019625 Ga0123356_100196251 372
120 iso_pr_bacteria 2781125633 2781273127 374
121 3300002450 JGI24695J34938_10000779 JGI24695J34938_100007798 378
122 3300002450 JGI24695J34938_10003115 JGI24695J34938_100031154 378
123 iso_pr_bacteria 2781125648 2781304917 378
124 3300002450 JGI24695J34938_10000369 JGI24695J34938_1000036926 379
125 3300002450 JGI24695J34938_10012131 JGI24695J34938_100121313 379
126 3300042656 Ga0466732_194127 Ga0466732_194127_2192_3349 385
127 3300002450 JGI24695J34938_10014345 JGI24695J34938_100143453 395
128 3300009826 Ga0123355_10045087 Ga0123355_100450875 399

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01222 ERG4_ERG24 Ergosterol biosynthesis ERG4/ERG24 family 29 394 0.83
PF06966 DUF1295 Protein of unknown function (DUF1295) 257 384 0.73

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.