Protein Family IF00661
Metagenome
Isolate
128
Members
52
Samples
118
Scaffolds
360.83
Avg Length
Representative Sequence
- ID
- 3300002450|JGI24695J34938_10014345|JGI24695J34938_100143453
- Length
- 395 aa
- Sequence
- LKYSACFGKITVDDQHLDMFCFHWGFAMDTRAVLGFFSPWIVYAVITLLHVALPAMRRKGYVRHEHTGKLMEYKLNGHLVLPGTILLWLVLGYIQLVPWTWLYEIRWYGLAGAVTLGILFTLIIVLPWPAKRKNILADLWFGRLKDPQCKKGNLLIDTKMWLYLVGAVMLQLNVLSCLTYHWQMAYYLQDFDFNPGLLMGVAMITFFVWDYLSFEGVHLYTYDFIAERVGFKLGFGCLAFYPFFYTIAIWSTAHLPNPGHPMWLNVLFILVFVSGWVLARGANLQKYYFKISPAKKFLGIKPKVLTDEKYSLLVNGWWGKSRHINYLGEILMACGIALAAGYPGVLWVWLYPLYYVCLLFTRQVDDDKICGAKYGELWEKYKKKVKYRIIPYIY*
Sample Types
Isolate
7.8%
Metagenome
92.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
46.0%
Unclassified
22.0%
Kalotermitidae
20.0%
Rhinotermitidae
6.0%
Termopsidae
6.0%
Taxonomy
Archaea
0
Bacteria
108
Eukaryota
0
Viruses
0
Unclassified
20
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 2 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 3 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 4 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 5 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 6 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 7 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 8 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 9 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 10 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 11 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 12 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 13 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 14 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 15 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 16 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 17 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 18 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 19 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 20 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 21 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 22 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 23 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 24 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 25 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 26 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 27 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 28 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 29 | 2820899690 | Unclassified Actinobacteria Emb289P4bin9 | Isolate | Unclassified |
| 30 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 31 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 32 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 33 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 34 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 35 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 36 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 37 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 38 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 39 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 40 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 41 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 42 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 43 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 44 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 45 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 46 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 47 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 48 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 49 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 50 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 51 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 52 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_194127 | 3300042656 | Bacteria | 14271 |
| 2 | Ga0466703_031350 | 3300042636 | Bacteria | 3119 |
| 3 | Ga0466708_314653 | 3300042652 | Unclassified | 2292 |
| 4 | Ga0466708_332073 | 3300042652 | Bacteria | 2832 |
| 5 | Ga0466726_015961 | 3300042619 | Bacteria | 12630 |
| 6 | Ga0466726_100390 | 3300042619 | Unclassified | 1737 |
| 7 | Ga0415639_102615 | 3300038395 | Bacteria | 2484 |
| 8 | Ga0466692_014731 | 3300042591 | Bacteria | 6266 |
| 9 | Ga0466694_290608 | 3300042594 | Bacteria | 1760 |
| 10 | Ga0466696_440693 | 3300042596 | Bacteria | 4222 |
| 11 | Ga0123357_10043859 | 3300009784 | Bacteria | 6073 |
| 12 | Ga0123356_10000347 | 3300010049 | Bacteria | 53419 |
| 13 | Ga0466713_077253 | 3300042602 | Bacteria | 4636 |
| 14 | Ga0466720_019106 | 3300042607 | Bacteria | 4203 |
| 15 | AustNasuHG_c1000894 | 3300000089 | Bacteria | 10770 |
| 16 | Ga0072941_1225186 | 3300005201 | Unclassified | 2649 |
| 17 | Ga0466733_035473 | 3300042659 | Bacteria | 3899 |
| 18 | Ga0466733_202744 | 3300042659 | Bacteria | 1112 |
| 19 | Ga0466704_164360 | 3300042643 | Bacteria | 2506 |
| 20 | Ga0466704_223677 | 3300042643 | Bacteria | 60624 |
| 21 | Ga0466704_234381 | 3300042643 | Unclassified | 2949 |
| 22 | Ga0466727_187459 | 3300042655 | Bacteria | 10031 |
| 23 | Ga0466727_232302 | 3300042655 | Bacteria | 3136 |
| 24 | Ga0264413_108801 | 3300024493 | Bacteria | 7039 |
| 25 | Ga0466692_127478 | 3300042591 | Bacteria | 5991 |
| 26 | Ga0466691_050116 | 3300042593 | Bacteria | 8731 |
| 27 | Ga0466694_005840 | 3300042594 | Bacteria | 106514 |
| 28 | Ga0466694_307475 | 3300042594 | Bacteria | 21455 |
| 29 | Ga0123357_10041671 | 3300009784 | Bacteria | 6244 |
| 30 | Ga0123355_10045087 | 3300009826 | Bacteria | 7172 |
| 31 | Ga0123356_10015425 | 3300010049 | Bacteria | 7325 |
| 32 | Ga0123353_10157088 | 3300010167 | Bacteria | 3624 |
| 33 | Ga0466717_087572 | 3300042604 | Unclassified | 1762 |
| 34 | Ga0466722_227357 | 3300042609 | Bacteria | 4941 |
| 35 | JGI24695J34938_10002766 | 3300002450 | Bacteria | 12883 |
| 36 | Ga0072941_1008539 | 3300005201 | Bacteria | 19799 |
| 37 | Ga0466705_264604 | 3300042612 | Bacteria | 11921 |
| 38 | Ga0466732_382113 | 3300042656 | Bacteria | 18383 |
| 39 | Ga0466732_398637 | 3300042656 | Bacteria | 2400 |
| 40 | Ga0466731_399476 | 3300042622 | Unclassified | 1708 |
| 41 | Ga0466702_243639 | 3300042635 | Bacteria | 2276 |
| 42 | Ga0466702_466320 | 3300042635 | Bacteria | 5761 |
| 43 | Ga0466703_090445 | 3300042636 | Bacteria | 53496 |
| 44 | Ga0466694_315036 | 3300042594 | Bacteria | 3707 |
| 45 | Ga0123357_10222468 | 3300009784 | Bacteria | 2090 |
| 46 | Ga0123353_10346177 | 3300010167 | Bacteria | 2242 |
| 47 | Ga0466720_164728 | 3300042607 | Unclassified | 2488 |
| 48 | JGI24695J34938_10012447 | 3300002450 | Bacteria | 4506 |
| 49 | JGI24695J34938_10052606 | 3300002450 | Bacteria | 1776 |
| 50 | Ga0072941_1013718 | 3300005201 | Bacteria | 3306 |
| 51 | Ga0466711_359607 | 3300042615 | Bacteria | 14591 |
| 52 | Ga0466715_228029 | 3300042616 | Bacteria | 3876 |
| 53 | Ga0123356_10019625 | 3300010049 | Unclassified | 6405 |
| 54 | Ga0466707_188207 | 3300042601 | Bacteria | 2444 |
| 55 | Ga0466720_053320 | 3300042607 | Unclassified | 8455 |
| 56 | Ga0466720_178546 | 3300042607 | Bacteria | 2012 |
| 57 | AustNasuHG_c1013110 | 3300000089 | Bacteria | 2849 |
| 58 | JGI24695J34938_10012131 | 3300002450 | Bacteria | 4588 |
| 59 | JGI24695J34938_10048049 | 3300002450 | Bacteria | 1881 |
| 60 | Ga0466735_001515 | 3300042624 | Unclassified | 1866 |
| 61 | Ga0466704_471343 | 3300042643 | Bacteria | 26146 |
| 62 | Ga0466712_106716 | 3300042614 | Bacteria | 19386 |
| 63 | Ga0466715_252314 | 3300042616 | Bacteria | 2609 |
| 64 | Ga0466692_162332 | 3300042591 | Unclassified | 1813 |
| 65 | Ga0466699_417920 | 3300042597 | Bacteria | 13952 |
| 66 | Ga0123357_10176566 | 3300009784 | Bacteria | 2509 |
| 67 | Ga0123356_10041427 | 3300010049 | Bacteria | 4291 |
| 68 | Ga0466698_257622 | 3300042610 | Unclassified | 1686 |
| 69 | AustNasuHG_c1034454 | 3300000089 | Bacteria | 1355 |
| 70 | JGI24695J34938_10003115 | 3300002450 | Bacteria | 11839 |
| 71 | JGI24695J34938_10005312 | 3300002450 | Bacteria | 8081 |
| 72 | JGI24702J35022_10112552 | 3300002462 | Bacteria | 1497 |
| 73 | Ga0072941_1257473 | 3300005201 | Unclassified | 1170 |
| 74 | Ga0466732_179723 | 3300042656 | Bacteria | 33126 |
| 75 | Ga0466733_222652 | 3300042659 | Bacteria | 9297 |
| 76 | Ga0466703_398152 | 3300042636 | Bacteria | 5127 |
| 77 | Ga0466704_129775 | 3300042643 | Bacteria | 7647 |
| 78 | Ga0466715_038842 | 3300042616 | Bacteria | 3055 |
| 79 | Ga0466723_310461 | 3300042618 | Bacteria | 15924 |
| 80 | Ga0466692_169984 | 3300042591 | Bacteria | 1776 |
| 81 | Ga0466693_128816 | 3300042592 | Bacteria | 39215 |
| 82 | Ga0466696_400362 | 3300042596 | Bacteria | 4309 |
| 83 | Ga0466701_013913 | 3300042598 | Bacteria | 5747 |
| 84 | Ga0123357_10034507 | 3300009784 | Bacteria | 6879 |
| 85 | Ga0123353_10327348 | 3300010167 | Bacteria | 2322 |
| 86 | Ga0466701_041932 | 3300042598 | Bacteria | 42746 |
| 87 | Ga0466720_016072 | 3300042607 | Unclassified | 3288 |
| 88 | Ga0466720_097559 | 3300042607 | Bacteria | 11725 |
| 89 | Ga0466721_018710 | 3300042608 | Bacteria | 2237 |
| 90 | JGI24698J34947_10014721 | 3300002449 | Bacteria | 4261 |
| 91 | JGI24695J34938_10000369 | 3300002450 | Bacteria | 44536 |
| 92 | JGI24695J34938_10001087 | 3300002450 | Bacteria | 24560 |
| 93 | JGI24695J34938_10003220 | 3300002450 | Bacteria | 11564 |
| 94 | Ga0072941_1013719 | 3300005201 | Bacteria | 5327 |
| 95 | Ga0072941_1131468 | 3300005201 | Bacteria | 2331 |
| 96 | Ga0466705_188506 | 3300042612 | Bacteria | 6263 |
| 97 | Ga0466735_157949 | 3300042624 | Unclassified | 2576 |
| 98 | Ga0466702_237616 | 3300042635 | Bacteria | 1924 |
| 99 | Ga0466699_151960 | 3300042597 | Bacteria | 2263 |
| 100 | Ga0123353_10059197 | 3300010167 | Bacteria | 6142 |
| 101 | Ga0123353_10300974 | 3300010167 | Bacteria | 2448 |
| 102 | Ga0123354_10284063 | 3300010882 | Unclassified | 1601 |
| 103 | AustNasuHG_c1021719 | 3300000089 | Unclassified | 2073 |
| 104 | JGI24698J34947_10068587 | 3300002449 | Bacteria | 1715 |
| 105 | JGI24695J34938_10001209 | 3300002450 | Bacteria | 22895 |
| 106 | Ga0466705_019927 | 3300042612 | Unclassified | 1327 |
| 107 | Ga0466731_170078 | 3300042622 | Bacteria | 2069 |
| 108 | Ga0466726_092026 | 3300042619 | Bacteria | 16239 |
| 109 | Ga0466729_161140 | 3300042621 | Unclassified | 1826 |
| 110 | Ga0466699_215053 | 3300042597 | Bacteria | 9440 |
| 111 | Ga0123354_10026234 | 3300010882 | Bacteria | 9189 |
| 112 | Ga0466707_223481 | 3300042601 | Bacteria | 1821 |
| 113 | Ga0466719_264404 | 3300042606 | Bacteria | 4820 |
| 114 | Ga0466698_327020 | 3300042610 | Unclassified | 1679 |
| 115 | JGI24695J34938_10000033 | 3300002450 | Bacteria | 103928 |
| 116 | JGI24695J34938_10000779 | 3300002450 | Bacteria | 29860 |
| 117 | JGI24695J34938_10014345 | 3300002450 | Bacteria | 4112 |
| 118 | Ga0072941_1002307 | 3300005201 | Bacteria | 25899 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042659 | Ga0466733_202744 | Ga0466733_202744_109_1035 | 308 |
| 2 | 3300042652 | Ga0466708_314653 | Ga0466708_314653_1177_2256 | 333 |
| 3 | 3300042624 | Ga0466735_001515 | Ga0466735_001515_331_1458 | 336 |
| 4 | 3300042624 | Ga0466735_157949 | Ga0466735_157949_21_1100 | 338 |
| 5 | 3300042594 | Ga0466694_290608 | Ga0466694_290608_639_1658 | 339 |
| 6 | 3300042643 | Ga0466704_223677 | Ga0466704_223677_37157_38176 | 339 |
| 7 | 3300042602 | Ga0466713_077253 | Ga0466713_077253_3488_4567 | 347 |
| 8 | 3300042622 | Ga0466731_170078 | Ga0466731_170078_491_1561 | 356 |
| 9 | 3300042643 | Ga0466704_129775 | Ga0466704_129775_6003_7109 | 356 |
| 10 | 3300042659 | Ga0466733_035473 | Ga0466733_035473_19_1089 | 356 |
| 11 | 3300042610 | Ga0466698_257622 | Ga0466698_257622_504_1577 | 357 |
| 12 | 3300002449 | JGI24698J34947_10014721 | JGI24698J34947_100147214 | 358 |
| 13 | 3300038395 | Ga0415639_102615 | Ga0415639_102615_535_1611 | 358 |
| 14 | 3300042607 | Ga0466720_019106 | Ga0466720_019106_1192_2268 | 358 |
| 15 | 3300042607 | Ga0466720_053320 | Ga0466720_053320_7239_8315 | 358 |
| 16 | 3300042607 | Ga0466720_097559 | Ga0466720_097559_4558_5634 | 358 |
| 17 | 3300042656 | Ga0466732_398637 | Ga0466732_398637_683_1759 | 358 |
| 18 | 3300042659 | Ga0466733_222652 | Ga0466733_222652_901_1977 | 358 |
| 19 | iso_pr_bacteria | 2820899690 | 2820900150 | 358 |
| 20 | 3300009784 | Ga0123357_10034507 | Ga0123357_100345075 | 359 |
| 21 | 3300009784 | Ga0123357_10043859 | Ga0123357_100438594 | 359 |
| 22 | 3300009784 | Ga0123357_10176566 | Ga0123357_101765663 | 359 |
| 23 | 3300009784 | Ga0123357_10222468 | Ga0123357_102224681 | 359 |
| 24 | 3300010049 | Ga0123356_10000347 | Ga0123356_100003478 | 359 |
| 25 | 3300010167 | Ga0123353_10157088 | Ga0123353_101570882 | 359 |
| 26 | 3300010167 | Ga0123353_10300974 | Ga0123353_103009742 | 359 |
| 27 | 3300010167 | Ga0123353_10327348 | Ga0123353_103273481 | 359 |
| 28 | 3300010167 | Ga0123353_10346177 | Ga0123353_103461773 | 359 |
| 29 | 3300010882 | Ga0123354_10026234 | Ga0123354_100262344 | 359 |
| 30 | 3300010882 | Ga0123354_10284063 | Ga0123354_102840631 | 359 |
| 31 | 3300042591 | Ga0466692_127478 | Ga0466692_127478_2295_3374 | 359 |
| 32 | 3300042591 | Ga0466692_169984 | Ga0466692_169984_179_1258 | 359 |
| 33 | 3300042593 | Ga0466691_050116 | Ga0466691_050116_1679_2758 | 359 |
| 34 | 3300042594 | Ga0466694_307475 | Ga0466694_307475_5129_6208 | 359 |
| 35 | 3300042594 | Ga0466694_315036 | Ga0466694_315036_1072_2151 | 359 |
| 36 | 3300042596 | Ga0466696_400362 | Ga0466696_400362_2327_3406 | 359 |
| 37 | 3300042596 | Ga0466696_440693 | Ga0466696_440693_475_1554 | 359 |
| 38 | 3300042597 | Ga0466699_151960 | Ga0466699_151960_98_1177 | 359 |
| 39 | 3300042597 | Ga0466699_215053 | Ga0466699_215053_1302_2381 | 359 |
| 40 | 3300042597 | Ga0466699_417920 | Ga0466699_417920_2935_4014 | 359 |
| 41 | 3300042598 | Ga0466701_013913 | Ga0466701_013913_3308_4387 | 359 |
| 42 | 3300042598 | Ga0466701_041932 | Ga0466701_041932_31131_32210 | 359 |
| 43 | 3300042601 | Ga0466707_188207 | Ga0466707_188207_981_2060 | 359 |
| 44 | 3300042601 | Ga0466707_223481 | Ga0466707_223481_199_1278 | 359 |
| 45 | 3300042604 | Ga0466717_087572 | Ga0466717_087572_595_1674 | 359 |
| 46 | 3300042606 | Ga0466719_264404 | Ga0466719_264404_2208_3287 | 359 |
| 47 | 3300042607 | Ga0466720_016072 | Ga0466720_016072_717_1796 | 359 |
| 48 | 3300042607 | Ga0466720_164728 | Ga0466720_164728_1379_2458 | 359 |
| 49 | 3300042609 | Ga0466722_227357 | Ga0466722_227357_2861_3940 | 359 |
| 50 | 3300042612 | Ga0466705_019927 | Ga0466705_019927_208_1287 | 359 |
| 51 | 3300042612 | Ga0466705_188506 | Ga0466705_188506_5129_6208 | 359 |
| 52 | 3300042612 | Ga0466705_264604 | Ga0466705_264604_9334_10413 | 359 |
| 53 | 3300042614 | Ga0466712_106716 | Ga0466712_106716_15808_16887 | 359 |
| 54 | 3300042616 | Ga0466715_038842 | Ga0466715_038842_1266_2345 | 359 |
| 55 | 3300042616 | Ga0466715_228029 | Ga0466715_228029_1160_2239 | 359 |
| 56 | 3300042616 | Ga0466715_252314 | Ga0466715_252314_149_1228 | 359 |
| 57 | 3300042618 | Ga0466723_310461 | Ga0466723_310461_7615_8694 | 359 |
| 58 | 3300042619 | Ga0466726_015961 | Ga0466726_015961_1326_2405 | 359 |
| 59 | 3300042619 | Ga0466726_092026 | Ga0466726_092026_3394_4500 | 359 |
| 60 | 3300042619 | Ga0466726_100390 | Ga0466726_100390_102_1181 | 359 |
| 61 | 3300042636 | Ga0466703_090445 | Ga0466703_090445_48775_49854 | 359 |
| 62 | 3300042636 | Ga0466703_398152 | Ga0466703_398152_870_1949 | 359 |
| 63 | 3300042643 | Ga0466704_164360 | Ga0466704_164360_1248_2327 | 359 |
| 64 | 3300042643 | Ga0466704_234381 | Ga0466704_234381_1452_2531 | 359 |
| 65 | 3300042643 | Ga0466704_471343 | Ga0466704_471343_10399_11478 | 359 |
| 66 | 3300042652 | Ga0466708_332073 | Ga0466708_332073_1343_2422 | 359 |
| 67 | 3300042655 | Ga0466727_187459 | Ga0466727_187459_2029_3108 | 359 |
| 68 | 3300042655 | Ga0466727_232302 | Ga0466727_232302_1127_2206 | 359 |
| 69 | iso_pr_bacteria | 2781125629 | 2781264003 | 359 |
| 70 | iso_pr_bacteria | 2820899690 | 2820900217 | 359 |
| 71 | 3300000089 | AustNasuHG_c1000894 | AustNasuHG_10008944 | 360 |
| 72 | 3300000089 | AustNasuHG_c1013110 | AustNasuHG_10131102 | 360 |
| 73 | 3300000089 | AustNasuHG_c1021719 | AustNasuHG_10217192 | 360 |
| 74 | 3300000089 | AustNasuHG_c1034454 | AustNasuHG_10344542 | 360 |
| 75 | 3300005201 | Ga0072941_1131468 | Ga0072941_11314683 | 360 |
| 76 | 3300005201 | Ga0072941_1225186 | Ga0072941_12251861 | 360 |
| 77 | 3300009784 | Ga0123357_10041671 | Ga0123357_100416717 | 360 |
| 78 | 3300010049 | Ga0123356_10041427 | Ga0123356_100414273 | 360 |
| 79 | 3300024493 | Ga0264413_108801 | Ga0264413_1088016 | 360 |
| 80 | 3300042607 | Ga0466720_178546 | Ga0466720_178546_86_1168 | 360 |
| 81 | 3300042608 | Ga0466721_018710 | Ga0466721_018710_128_1210 | 360 |
| 82 | 3300042622 | Ga0466731_399476 | Ga0466731_399476_432_1514 | 360 |
| 83 | 3300042635 | Ga0466702_466320 | Ga0466702_466320_4593_5675 | 360 |
| 84 | 3300042656 | Ga0466732_179723 | Ga0466732_179723_29147_30229 | 360 |
| 85 | 3300042656 | Ga0466732_382113 | Ga0466732_382113_10357_11439 | 360 |
| 86 | 3300005201 | Ga0072941_1257473 | Ga0072941_12574731 | 361 |
| 87 | 3300042591 | Ga0466692_014731 | Ga0466692_014731_3126_4211 | 361 |
| 88 | 3300042591 | Ga0466692_162332 | Ga0466692_162332_527_1612 | 361 |
| 89 | 3300042592 | Ga0466693_128816 | Ga0466693_128816_8612_9697 | 361 |
| 90 | 3300042610 | Ga0466698_327020 | Ga0466698_327020_371_1456 | 361 |
| 91 | 3300042621 | Ga0466729_161140 | Ga0466729_161140_350_1435 | 361 |
| 92 | 3300042635 | Ga0466702_243639 | Ga0466702_243639_730_1815 | 361 |
| 93 | 3300002450 | JGI24695J34938_10005312 | JGI24695J34938_100053123 | 362 |
| 94 | 3300042636 | Ga0466703_031350 | Ga0466703_031350_1725_2813 | 362 |
| 95 | 3300002450 | JGI24695J34938_10002766 | JGI24695J34938_100027664 | 363 |
| 96 | 3300002450 | JGI24695J34938_10048049 | JGI24695J34938_100480492 | 363 |
| 97 | 3300002462 | JGI24702J35022_10112552 | JGI24702J35022_101125522 | 363 |
| 98 | 3300010167 | Ga0123353_10059197 | Ga0123353_100591972 | 363 |
| 99 | 3300042615 | Ga0466711_359607 | Ga0466711_359607_484_1575 | 363 |
| 100 | iso_pr_bacteria | 2781125640 | 2781288735 | 363 |
| 101 | 3300002449 | JGI24698J34947_10068587 | JGI24698J34947_100685872 | 364 |
| 102 | 3300005201 | Ga0072941_1013718 | Ga0072941_10137184 | 364 |
| 103 | 3300042594 | Ga0466694_005840 | Ga0466694_005840_64912_66006 | 364 |
| 104 | iso_pr_bacteria | 2781125638 | 2781284664 | 365 |
| 105 | 3300002450 | JGI24695J34938_10000033 | JGI24695J34938_1000003356 | 366 |
| 106 | 3300002450 | JGI24695J34938_10001209 | JGI24695J34938_1000120913 | 366 |
| 107 | 3300002450 | JGI24695J34938_10003220 | JGI24695J34938_1000322010 | 366 |
| 108 | 3300002450 | JGI24695J34938_10012447 | JGI24695J34938_100124474 | 366 |
| 109 | 3300002450 | JGI24695J34938_10052606 | JGI24695J34938_100526062 | 366 |
| 110 | 3300010049 | Ga0123356_10015425 | Ga0123356_100154253 | 366 |
| 111 | 3300042635 | Ga0466702_237616 | Ga0466702_237616_500_1600 | 366 |
| 112 | iso_pr_bacteria | 2781125647 | 2781303438 | 368 |
| 113 | iso_pr_bacteria | 2781125683 | 2781411696 | 368 |
| 114 | 3300002450 | JGI24695J34938_10001087 | JGI24695J34938_1000108716 | 369 |
| 115 | 3300005201 | Ga0072941_1002307 | Ga0072941_10023076 | 369 |
| 116 | 3300005201 | Ga0072941_1008539 | Ga0072941_10085392 | 369 |
| 117 | 3300005201 | Ga0072941_1013719 | Ga0072941_10137192 | 369 |
| 118 | iso_pr_bacteria | 2781125659 | 2781328617 | 371 |
| 119 | 3300010049 | Ga0123356_10019625 | Ga0123356_100196251 | 372 |
| 120 | iso_pr_bacteria | 2781125633 | 2781273127 | 374 |
| 121 | 3300002450 | JGI24695J34938_10000779 | JGI24695J34938_100007798 | 378 |
| 122 | 3300002450 | JGI24695J34938_10003115 | JGI24695J34938_100031154 | 378 |
| 123 | iso_pr_bacteria | 2781125648 | 2781304917 | 378 |
| 124 | 3300002450 | JGI24695J34938_10000369 | JGI24695J34938_1000036926 | 379 |
| 125 | 3300002450 | JGI24695J34938_10012131 | JGI24695J34938_100121313 | 379 |
| 126 | 3300042656 | Ga0466732_194127 | Ga0466732_194127_2192_3349 | 385 |
| 127 | 3300002450 | JGI24695J34938_10014345 | JGI24695J34938_100143453 | 395 |
| 128 | 3300009826 | Ga0123355_10045087 | Ga0123355_100450875 | 399 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.84 | 0.88 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.