Protein Family IF00659

Metagenome Isolate
175 Members
103 Samples
129 Scaffolds
279.03 Avg Length

🧬 Representative Sequence

ID
3300002450|JGI24695J34938_10013773|JGI24695J34938_100137733
Length
322 aa
Sequence
VPSAPFFEVFQIRSAYYREDKIDTIGRNGWKIIQNRLECRENVRIVFPSMNNPIHVGQYRCGEGENLLLIAGPCTLQAEYNNVIAEELARLNDRLPVNVVFKGSFDKANRSSIETARGCGLEAGLEMLAXXRSQTGLPVTTDIHETCQADPVGKVCDLIQIPAFLSRQTDLLVTAAKTGKPVHVKKGQFMAPQEMRNVVRKLEESGCQDILLCERGTFFGYGRLVNDMQSLAIMREFGVPICFDATHSVQEPGGQGTFTGGNRRMVEPLARSATAVGIDALFLETHPEPAKSPSDAANMLPLDQLERVLTKILHIREALVR*

📊 Sample Types

Isolate 26.3%
Metagenome 73.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 25.7%
Apidae 19.8%
Unclassified 18.8%
Kalotermitidae 13.9%
Formicidae 5.9%
Elmidae 4.0%
Termopsidae 3.0%
Culicidae 3.0%
Rhinotermitidae 1.0%
Daphniidae 1.0%
Nephropidae 1.0%
Ixodidae 1.0%
Blattidae 1.0%
Armadillidiidae 1.0%

🌳 Taxonomy

Archaea 0
Bacteria 161
Eukaryota 0
Viruses 0
Unclassified 14

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2711768164 Tritonibacter mobilis S1942 Isolate Unclassified
2 2816332545 Tritonibacter mobilis S1923 Isolate Unclassified
3 2864951976 Brevundimonas bullata S00223 Isolate Elmidae
4 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
5 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
6 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
7 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
8 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
9 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
10 8073617375 Bartonella apis W8098 Isolate Apidae
11 8082291289 Bartonella apihabitans K-FP28 Isolate Apidae
12 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
13 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
14 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
15 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
16 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
17 2556921669 Shinella sp. DD12 Isolate Daphniidae
18 2835143510 Yoonia maritima YPC211 Isolate Nephropidae
19 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
20 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
21 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
22 8068946563 Bartonella apihabitans M0187 Isolate Apidae
23 650716015 Candidatus Midichloria mitochondrii IricVA Isolate Ixodidae
24 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
25 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
26 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
27 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
28 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
29 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
30 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
31 2681813507 Insolitispirillum peregrinum integrum DSM 11589 Isolate Unclassified
32 2751185853 Bartonella apis BBC0178 Isolate Apidae
33 2820093073 Unclassified Proteobacteria Lab288P3bin233 Isolate Unclassified
34 2820178484 Unclassified Planctomycetes Th196P3bin110 Isolate Unclassified
35 2864866972 Brevundimonas bullata S00123 Isolate Elmidae
36 2920168565 Paludibacter sp. 221 Isolate Blattidae
37 8068944069 Bartonella choladocola W8125 Isolate Apidae
38 8068955631 Bartonella apihabitans M0280 Isolate Apidae
39 8073628750 Bartonella sp. W8167 Isolate Apidae
40 8074873247 Commensalibacter sp. M0134 Isolate Apidae
41 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
42 2724678956 Methylobacterium sp. GXS13 Isolate Unclassified
43 2820201435 Unclassified Planctomycetes Cu122P5bin25 Isolate Unclassified
44 8073626464 Bartonella apis W8152 Isolate Apidae
45 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
46 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
47 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
48 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
49 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
50 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
51 3300029809 Ant gut bacterial community from Dolichoderus sp. 3-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC188 Metagenome Formicidae
52 2718218026 Phaeobacter porticola P97 Isolate Unclassified
53 2841330038 Sulfitobacter sp. D7 Isolate
54 2864993140 Agrobacterium vitis S00303 Isolate Elmidae
55 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
56 8068950955 Bartonella apihabitans W8097 Isolate Apidae
57 8073621894 Bartonella apis W8099 Isolate Apidae
58 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
59 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
60 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
61 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
62 2695420964 Hyphomicrobiales bacterium JR021 Isolate Unclassified
63 2751185858 Bartonella apis BBC0122 Isolate Apidae
64 2820189034 Unclassified Planctomycetes Emb289P4bin17 Isolate Unclassified
65 2820196379 Unclassified Planctomycetes Emb289P3bin158 Isolate Unclassified
66 2820200053 Unclassified Planctomycetes Cu122P5bin40 Isolate Unclassified
67 2820082748 Unclassified Proteobacteria Lab288P4bin14 Isolate Unclassified
68 2886876212 Tokpelaia sp. RhiAcro1 Isolate Formicidae
69 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
70 8068941587 Bartonella choladocola B10834H15 Isolate Apidae
71 8073619611 Bartonella apis B10834G6 Isolate Apidae
72 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
73 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
74 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
75 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
76 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
77 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Formicidae
78 2816332503 Tritonibacter mobilis S1611 Isolate Unclassified
79 2820171952 Unclassified Planctomycetes Th196P3bin88 Isolate Unclassified
80 2873468275 Agrobacterium vitis S00131 Isolate Elmidae
81 2821312900 Unclassified Proteobacteria Lab288P4bin16 Isolate Unclassified
82 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
83 8073624232 Bartonella sp. W8151 Isolate Apidae
84 8074871419 Commensalibacter sp. M0133 Isolate Apidae
85 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
86 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
87 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
88 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
89 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
90 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
91 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
92 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
93 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
94 2820185449 Unclassified Planctomycetes Lab288P3bin146 Isolate Unclassified
95 8068953321 Bartonella apihabitans M0190 Isolate Apidae
96 8074745029 Commensalibacter melissae M0407 Isolate Apidae
97 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
98 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
99 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
100 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
101 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
102 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
103 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_118047 3300042612 Bacteria 5621
2 Ga0466701_021287 3300042598 Bacteria 3538
3 Ga0466719_234214 3300042606 Bacteria 1472
4 Ga0466715_055281 3300042616 Bacteria 15597
5 Ga0466715_077095 3300042616 Bacteria 15607
6 Ga0466728_340280 3300042620 Unclassified 1227
7 Ga0123355_10641395 3300009826 Bacteria 1243
8 Ga0123356_10016826 3300010049 Bacteria 6968
9 Ga0123356_10278139 3300010049 Bacteria 1767
10 Ga0123353_10022160 3300010167 Unclassified 9563
11 Ga0123353_10336140 3300010167 Bacteria 2284
12 Ga0466730_072036 3300042625 Unclassified 1139
13 Ga0466704_397751 3300042643 Bacteria 1282
14 Ga0466704_419647 3300042643 Bacteria 2280
15 Ga0160446_100072 3300012835 Bacteria 99052
16 Ga0466699_150917 3300042597 Bacteria 1035
17 Ga0068305_10076322 3300005083 Bacteria 7159
18 Ga0466729_152309 3300042621 Bacteria 4130
19 Ga0123356_10149551 3300010049 Bacteria 2316
20 Ga0123356_10246694 3300010049 Bacteria 1860
21 Ga0123356_10794107 3300010049 Bacteria 1118
22 Ga0123353_10024170 3300010167 Bacteria 9219
23 Ga0466734_013204 3300042623 Bacteria 7120
24 Ga0466703_184876 3300042636 Bacteria 9678
25 Ga0466704_005447 3300042643 Bacteria 2864
26 Ga0466725_325885 3300042654 Bacteria 1518
27 Ga0415639_117007 3300038395 Bacteria 3108
28 Ga0466691_148457 3300042593 Bacteria 3313
29 JGI24695J34938_10013773 3300002450 Unclassified 4230
30 JGI24695J34938_10024568 3300002450 Unclassified 2892
31 Ga0068302_10731243 3300005071 Bacteria 1920
32 Ga0466700_346509 3300042600 Bacteria 3644
33 Ga0466716_113101 3300042605 Bacteria 5015
34 Ga0466719_078707 3300042606 Bacteria 4392
35 Ga0466711_513243 3300042615 Bacteria 5692
36 Ga0466715_423249 3300042616 Bacteria 1442
37 Ga0123355_10466992 3300009826 Bacteria 1580
38 Ga0123355_10724342 3300009826 Bacteria 1134
39 Ga0123353_10149739 3300010167 Bacteria 3727
40 Ga0123353_10893436 3300010167 Bacteria 1211
41 Ga0466731_284410 3300042622 Bacteria 1450
42 Ga0466703_204906 3300042636 Bacteria 14838
43 Ga0466704_331087 3300042643 Bacteria 21912
44 Ga0466727_132397 3300042655 Bacteria 1261
45 Ga0160433_100168 3300012846 Bacteria 55205
46 Ga0466693_171816 3300042592 Bacteria 1083
47 Ga0466712_075007 3300042614 Bacteria 3268
48 Ga0466711_485012 3300042615 Bacteria 2610
49 Ga0466718_140246 3300042617 Bacteria 2217
50 Ga0466726_250417 3300042619 Bacteria 14283
51 Ga0466729_141377 3300042621 Bacteria 4112
52 Ga0466729_174297 3300042621 Bacteria 16166
53 Ga0123355_10190995 3300009826 Bacteria 3016
54 Ga0123355_10335823 3300009826 Unclassified 2019
55 Ga0123355_10494051 3300009826 Bacteria 1514
56 Ga0123356_10013330 3300010049 Bacteria 7941
57 Ga0123356_10021803 3300010049 Bacteria 6047
58 Ga0123356_10086590 3300010049 Bacteria 2974
59 Ga0123356_10351256 3300010049 Unclassified 1598
60 Ga0123356_10380286 3300010049 Bacteria 1544
61 Ga0123353_10442914 3300010167 Bacteria 1915
62 Ga0466708_075908 3300042652 Bacteria 8550
63 Ga0466708_139554 3300042652 Bacteria 28818
64 Ga0466690_252916 3300042590 Bacteria 1175
65 Ga0466696_021254 3300042596 Bacteria 8360
66 JGI24705J35276_12236395 3300002504 Bacteria 7984
67 Ga0072940_1219999 3300005200 Bacteria 1830
68 Ga0466707_147722 3300042601 Bacteria 5064
69 Ga0466726_408669 3300042619 Bacteria 10614
70 Ga0466729_007162 3300042621 Bacteria 4578
71 Ga0123356_10084590 3300010049 Unclassified 3007
72 Ga0123356_10322050 3300010049 Bacteria 1659
73 Ga0123353_10000736 3300010167 Bacteria 39970
74 Ga0123353_10036867 3300010167 Bacteria 7664
75 Ga0123353_10402052 3300010167 Bacteria 2038
76 Ga0160459_100812 3300012831 Bacteria 10127
77 Ga0160460_100521 3300012845 Bacteria 21830
78 Ga0309903_100005 3300029809 Bacteria 95692
79 Ga0466696_018952 3300042596 Unclassified 3822
80 Ga0466698_100835 3300042610 Bacteria 1549
81 Ga0466723_065360 3300042618 Bacteria 25532
82 Ga0123355_10404929 3300009826 Bacteria 1756
83 Ga0123356_10027004 3300010049 Bacteria 5382
84 Ga0123356_10256243 3300010049 Bacteria 1830
85 Ga0123356_10269914 3300010049 Bacteria 1790
86 Ga0123353_10274187 3300010167 Bacteria 2596
87 Ga0123353_10433077 3300010167 Unclassified 1944
88 Ga0123353_10655688 3300010167 Bacteria 1485
89 Ga0466731_287274 3300042622 Bacteria 1230
90 Ga0466708_082549 3300042652 Bacteria 53797
91 Ga0466727_041196 3300042655 Bacteria 1145
92 Ga0466695_117967 3300042595 Bacteria 1654
93 Ga0466695_309017 3300042595 Bacteria 1600
94 HBC_ctgsDRAFT_1048370 3300000333 Unclassified 1035
95 CVPL005L_10005514 3300002938 Bacteria 17405
96 Ga0072941_1090411 3300005201 Bacteria 3245
97 Ga0074278_109825 3300005721 Bacteria 6807
98 Ga0102738_1000035 3300007141 Bacteria 64841
99 Ga0466705_278288 3300042612 Bacteria 1698
100 Ga0466705_286349 3300042612 Bacteria 1287
101 Ga0466733_092461 3300042659 Bacteria 2574
102 Ga0466717_261443 3300042604 Unclassified 1406
103 Ga0123353_10129227 3300010167 Bacteria 4056
104 Ga0123353_10518890 3300010167 Unclassified 1729
105 Ga0466734_023074 3300042623 Bacteria 1444
106 Ga0466702_027754 3300042635 Bacteria 2160
107 Ga0466704_071662 3300042643 Bacteria 2168
108 Ga0466709_363668 3300042648 Bacteria 46373
109 Ga0466690_117640 3300042590 Bacteria 4497
110 Ga0466690_343571 3300042590 Bacteria 3835
111 JGI24702J35022_10025836 3300002462 Bacteria 3167
112 JGI24702J35022_10048418 3300002462 Bacteria 2263
113 CVPL010L_1000030 3300002932 Bacteria 49452
114 Ga0466700_385193 3300042600 Bacteria 1583
115 Ga0466707_383883 3300042601 Bacteria 2518
116 Ga0466717_075384 3300042604 Bacteria 3567
117 Ga0466717_235208 3300042604 Bacteria 1201
118 Ga0466721_207457 3300042608 Unclassified 3858
119 Ga0466712_318023 3300042614 Bacteria 1064
120 Ga0123353_10644998 3300010167 Bacteria 1501
121 Ga0466703_380674 3300042636 Bacteria 2214
122 Ga0466704_051573 3300042643 Bacteria 36056
123 Ga0160460_100102 3300012845 Bacteria 116929
124 Ga0316159_10558 3300030930 Bacteria 9892
125 Ga0466657_238785 3300042582 Bacteria 19833
126 Ga0466696_019210 3300042596 Bacteria 1288
127 JGI24702J35022_10007329 3300002462 Bacteria 6333
128 Ga0074278_136386 3300005721 Bacteria 43260
129 Ga0123357_10001267 3300009784 Bacteria 26584

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042643 Ga0466704_331087 Ga0466704_331087_8754_9527 257
2 3300042612 Ga0466705_286349 Ga0466705_286349_34_828 264
3 3300042608 Ga0466721_207457 Ga0466721_207457_361_1197 265
4 3300042604 Ga0466717_235208 Ga0466717_235208_374_1186 270
5 3300042617 Ga0466718_140246 Ga0466718_140246_793_1605 270
6 3300042621 Ga0466729_174297 Ga0466729_174297_8485_9297 270
7 3300010049 Ga0123356_10084590 Ga0123356_100845903 271
8 3300042590 Ga0466690_117640 Ga0466690_117640_3246_4061 271
9 3300042592 Ga0466693_171816 Ga0466693_171816_101_916 271
10 3300042595 Ga0466695_309017 Ga0466695_309017_290_1105 271
11 3300042600 Ga0466700_346509 Ga0466700_346509_1296_2111 271
12 3300042614 Ga0466712_318023 Ga0466712_318023_203_1018 271
13 3300042654 Ga0466725_325885 Ga0466725_325885_115_930 271
14 iso_pr_bacteria 2820171952 2820172736 271
15 iso_pr_bacteria 2820178484 2820180389 271
16 3300010167 Ga0123353_10893436 Ga0123353_108934361 272
17 3300042593 Ga0466691_148457 Ga0466691_148457_2165_2983 272
18 3300042597 Ga0466699_150917 Ga0466699_150917_89_907 272
19 3300042601 Ga0466707_147722 Ga0466707_147722_2038_2856 272
20 3300042605 Ga0466716_113101 Ga0466716_113101_215_1033 272
21 3300042606 Ga0466719_078707 Ga0466719_078707_3314_4132 272
22 3300042606 Ga0466719_234214 Ga0466719_234214_258_1076 272
23 3300042610 Ga0466698_100835 Ga0466698_100835_237_1055 272
24 3300042615 Ga0466711_485012 Ga0466711_485012_1383_2201 272
25 3300042618 Ga0466723_065360 Ga0466723_065360_5601_6419 272
26 3300042620 Ga0466728_340280 Ga0466728_340280_98_916 272
27 3300042623 Ga0466734_013204 Ga0466734_013204_1011_1829 272
28 3300042648 Ga0466709_363668 Ga0466709_363668_9510_10328 272
29 3300042655 Ga0466727_041196 Ga0466727_041196_217_1035 272
30 3300005200 Ga0072940_1219999 Ga0072940_12199992 273
31 3300005201 Ga0072941_1090411 Ga0072941_10904112 273
32 3300010049 Ga0123356_10086590 Ga0123356_100865902 273
33 3300010049 Ga0123356_10246694 Ga0123356_102466942 273
34 3300010049 Ga0123356_10794107 Ga0123356_107941071 273
35 3300010167 Ga0123353_10000736 Ga0123353_1000073627 273
36 3300010167 Ga0123353_10129227 Ga0123353_101292273 273
37 3300010167 Ga0123353_10433077 Ga0123353_104330772 273
38 3300010167 Ga0123353_10518890 Ga0123353_105188901 273
39 3300042596 Ga0466696_018952 Ga0466696_018952_693_1514 273
40 3300042635 Ga0466702_027754 Ga0466702_027754_93_914 273
41 3300042652 Ga0466708_075908 Ga0466708_075908_1603_2424 273
42 3300042659 Ga0466733_092461 Ga0466733_092461_1568_2389 273
43 iso_pr_bacteria 2820196379 2820197107 273
44 3300010049 Ga0123356_10269914 Ga0123356_102699142 274
45 3300042596 Ga0466696_019210 Ga0466696_019210_125_949 274
46 3300042600 Ga0466700_385193 Ga0466700_385193_372_1196 274
47 3300042615 Ga0466711_513243 Ga0466711_513243_4818_5642 274
48 3300042622 Ga0466731_287274 Ga0466731_287274_80_904 274
49 3300042636 Ga0466703_184876 Ga0466703_184876_1350_2174 274
50 3300042636 Ga0466703_204906 Ga0466703_204906_11766_12590 274
51 3300042643 Ga0466704_005447 Ga0466704_005447_1944_2768 274
52 3300042643 Ga0466704_071662 Ga0466704_071662_379_1203 274
53 3300042652 Ga0466708_139554 Ga0466708_139554_13366_14190 274
54 3300002462 JGI24702J35022_10025836 JGI24702J35022_100258362 275
55 3300010167 Ga0123353_10274187 Ga0123353_102741873 275
56 3300010167 Ga0123353_10644998 Ga0123353_106449982 275
57 3300042655 Ga0466727_132397 Ga0466727_132397_133_960 275
58 iso_pr_bacteria 2820201435 2820204600 275
59 3300010049 Ga0123356_10021803 Ga0123356_100218032 276
60 3300042582 Ga0466657_238785 Ga0466657_238785_2951_3781 276
61 3300042590 Ga0466690_252916 Ga0466690_252916_154_984 276
62 3300042623 Ga0466734_023074 Ga0466734_023074_297_1127 276
63 3300030930 Ga0316159_10558 Ga0316159_105588 277
64 3300042596 Ga0466696_021254 Ga0466696_021254_4378_5211 277
65 3300042616 Ga0466715_423249 Ga0466715_423249_491_1324 277
66 3300042619 Ga0466726_250417 Ga0466726_250417_7715_8548 277
67 3300042621 Ga0466729_152309 Ga0466729_152309_3043_3876 277
68 iso_pr_bacteria 2695420964 2698253927 277
69 iso_pr_bacteria 2711768164 2712505994 277
70 iso_pr_bacteria 2718218026 2719801872 277
71 iso_pr_bacteria 2751185853 2753586316 277
72 iso_pr_bacteria 2751185858 2753595471 277
73 iso_pr_bacteria 2816332503 2818124180 277
74 iso_pr_bacteria 2816332545 2818336067 277
75 iso_pr_bacteria 2820200053 2820200837 277
76 iso_pr_bacteria 2835143510 2835145801 277
77 iso_pr_bacteria 2835143510 2835146521 277
78 iso_pr_bacteria 2841330038 2841331211 277
79 iso_pr_bacteria 8068941587 8068942833 277
80 iso_pr_bacteria 8068944069 8068945292 277
81 iso_pr_bacteria 8068946563 8068947763 277
82 iso_pr_bacteria 8068950955 8068951005 277
83 iso_pr_bacteria 8068953321 8068954322 277
84 iso_pr_bacteria 8068955631 8068956596 277
85 iso_pr_bacteria 8073617375 8073618542 277
86 iso_pr_bacteria 8073619611 8073620808 277
87 iso_pr_bacteria 8073621894 8073621939 277
88 iso_pr_bacteria 8073624232 8073625840 277
89 iso_pr_bacteria 8073626464 8073626953 277
90 iso_pr_bacteria 8073628750 8073629758 277
91 iso_pr_bacteria 8082291289 8082292016 277
92 3300000333 HBC_ctgsDRAFT_1048370 HBC_ctgsDRAFT_10483701 278
93 3300002462 JGI24702J35022_10048418 JGI24702J35022_100484182 278
94 3300005071 Ga0068302_10731243 Ga0068302_107312432 278
95 3300005721 Ga0074278_109825 Ga0074278_1098253 278
96 3300005721 Ga0074278_136386 Ga0074278_13638625 278
97 3300012831 Ga0160459_100812 Ga0160459_10081210 278
98 3300012835 Ga0160446_100072 Ga0160446_10007242 278
99 3300012845 Ga0160460_100521 Ga0160460_1005215 278
100 3300038395 Ga0415639_117007 Ga0415639_117007_698_1534 278
101 3300042595 Ga0466695_117967 Ga0466695_117967_24_860 278
102 3300042604 Ga0466717_075384 Ga0466717_075384_1839_2675 278
103 3300042625 Ga0466730_072036 Ga0466730_072036_250_1086 278
104 3300042636 Ga0466703_380674 Ga0466703_380674_556_1392 278
105 iso_pr_bacteria 2820082748 2820083286 278
106 iso_pr_bacteria 2820093073 2820094562 278
107 iso_pr_bacteria 2820185449 2820187387 278
108 iso_pr_bacteria 2920168565 2920168934 278
109 3300002450 JGI24695J34938_10024568 JGI24695J34938_100245682 279
110 3300009826 Ga0123355_10190995 Ga0123355_101909953 279
111 3300009826 Ga0123355_10335823 Ga0123355_103358231 279
112 3300009826 Ga0123355_10641395 Ga0123355_106413952 279
113 3300010049 Ga0123356_10013330 Ga0123356_100133307 279
114 3300010049 Ga0123356_10016826 Ga0123356_100168268 279
115 3300010049 Ga0123356_10351256 Ga0123356_103512562 279
116 3300010167 Ga0123353_10022160 Ga0123353_100221605 279
117 3300010167 Ga0123353_10036867 Ga0123353_100368676 279
118 3300012845 Ga0160460_100102 Ga0160460_10010288 279
119 3300042601 Ga0466707_383883 Ga0466707_383883_168_1007 279
120 3300042604 Ga0466717_261443 Ga0466717_261443_146_985 279
121 3300042614 Ga0466712_075007 Ga0466712_075007_2409_3248 279
122 iso_pr_bacteria 2556921669 2558279116 279
123 iso_pr_bacteria 2821312900 2821313167 279
124 iso_pr_bacteria 650716015 650987633 279
125 iso_pr_bacteria 8074745029 8074745672 279
126 iso_pr_bacteria 8074871419 8074871794 279
127 iso_pr_bacteria 8074873247 8074873771 279
128 3300005083 Ga0068305_10076322 Ga0068305_100763222 280
129 3300009826 Ga0123355_10466992 Ga0123355_104669921 280
130 3300009826 Ga0123355_10494051 Ga0123355_104940512 280
131 3300010049 Ga0123356_10278139 Ga0123356_102781392 280
132 3300042598 Ga0466701_021287 Ga0466701_021287_1851_2693 280
133 3300042616 Ga0466715_077095 Ga0466715_077095_10796_11638 280
134 3300042643 Ga0466704_397751 Ga0466704_397751_197_1039 280
135 3300042652 Ga0466708_082549 Ga0466708_082549_45226_46068 280
136 3300010049 Ga0123356_10027004 Ga0123356_100270044 281
137 3300010049 Ga0123356_10256243 Ga0123356_102562432 281
138 3300010167 Ga0123353_10655688 Ga0123353_106556882 281
139 3300029809 Ga0309903_100005 Ga0309903_10000585 281
140 3300042612 Ga0466705_118047 Ga0466705_118047_286_1131 281
141 3300042619 Ga0466726_408669 Ga0466726_408669_7008_7853 281
142 iso_pr_bacteria 2864993140 2864995921 281
143 iso_pr_bacteria 2873468275 2873470873 281
144 3300002938 CVPL005L_10005514 CVPL005L_1000551411 282
145 3300010049 Ga0123356_10380286 Ga0123356_103802862 282
146 3300002932 CVPL010L_1000030 CVPL010L_100003013 284
147 3300042616 Ga0466715_055281 Ga0466715_055281_4773_5627 284
148 iso_pr_bacteria 2724678956 2724788709 284
149 3300042590 Ga0466690_343571 Ga0466690_343571_2102_2959 285
150 iso_pr_bacteria 2681813507 2684380697 285
151 3300010167 Ga0123353_10402052 Ga0123353_104020522 287
152 3300012846 Ga0160433_100168 Ga0160433_10016829 287
153 3300042612 Ga0466705_278288 Ga0466705_278288_168_1031 287
154 3300042643 Ga0466704_051573 Ga0466704_051573_23583_24446 287
155 3300042643 Ga0466704_419647 Ga0466704_419647_312_1175 287
156 3300002462 JGI24702J35022_10007329 JGI24702J35022_100073296 288
157 3300007141 Ga0102738_1000035 Ga0102738_100003515 288
158 3300042621 Ga0466729_141377 Ga0466729_141377_1159_2025 288
159 3300042622 Ga0466731_284410 Ga0466731_284410_359_1228 289
160 iso_pr_bacteria 2886876212 2886877008 289
161 3300010167 Ga0123353_10149739 Ga0123353_101497393 290
162 3300002504 JGI24705J35276_12236395 JGI24705J35276_122363959 292
163 3300009826 Ga0123355_10724342 Ga0123355_107243422 292
164 3300010049 Ga0123356_10322050 Ga0123356_103220503 292
165 iso_pr_bacteria 2864866972 2864868315 292
166 iso_pr_bacteria 2864951976 2864953319 292
167 3300010049 Ga0123356_10149551 Ga0123356_101495512 294
168 3300010167 Ga0123353_10024170 Ga0123353_100241706 302
169 3300010167 Ga0123353_10442914 Ga0123353_104429142 302
170 iso_pr_bacteria 2820189034 2820190874 307
171 3300009784 Ga0123357_10001267 Ga0123357_100012674 308
172 3300010167 Ga0123353_10336140 Ga0123353_103361401 309
173 3300009826 Ga0123355_10404929 Ga0123355_104049292 314
174 3300002450 JGI24695J34938_10013773 JGI24695J34938_100137733 322
175 3300042621 Ga0466729_007162 Ga0466729_007162_231_1214 327

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00793 DAHP_synth_1 DAHP synthetase I family 58 312 0.95

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00793 GO:0009058 biosynthetic process BP

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.77 0.84 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.