Protein Family IF00644

Metagenome Isolate
145 Members
49 Samples
141 Scaffolds
361.66 Avg Length

🧬 Representative Sequence

ID
3300002450|JGI24695J34938_10008642|JGI24695J34938_100086424
Length
408 aa
Sequence
MKYVHQNGRGSVIYFRISYSQTILFVNFAKFNHTLFAEKNKSGEIFMKKALITGITGQDGAYLSEFLLKKGYEVHGIKRRASSFNTQRIDHLYQDPHVENKRFILHYGDLTDTSNLVRIIQLVQPDEIYNLGAQSHVQVSFEAPEYTADTDGIGTLRLLEAIRILGMEKKVRFYQASTSELYGKVQEIPQKESTPFYPRSPYAAAKLYAYWIVVNYRESYAMHASNGILFNHESPLRGETFVTRKVTRAASRISLGLQDKLFMGNIDAKRDWGFAGDYVELMWLMLQQDEADDYVMATGVTVTVRDFITMTFKEIGITLEWKGKGIDEKGVDQETGKVLVEIDPRYFRPTEVDLLVGDPSKAKMKLGWEPKVQLPELVKMMVEYDLELAKREVHLKRGGYRVENFYE*

📊 Sample Types

Isolate 2.8%
Metagenome 97.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 46.7%
Kalotermitidae 24.4%
Unclassified 11.1%
Rhinotermitidae 6.7%
Termopsidae 4.4%
Elmidae 2.2%
Blaberidae 2.2%
Hodotermitidae 2.2%

🌳 Taxonomy

Archaea 1
Bacteria 131
Eukaryota 0
Viruses 0
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
2 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
3 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
4 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
5 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
6 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
7 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
8 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
9 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
10 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
11 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
12 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
13 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
14 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
15 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
16 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
17 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
18 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
19 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
20 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
21 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
22 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
23 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
24 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
25 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
26 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
27 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
28 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
29 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
30 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
31 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
32 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
33 2864836148 Arcicella rosea S00070 Isolate Elmidae
34 2772190975 Treponema sp. RmG30 Isolate Blaberidae
35 650716102 Treponema primitia ZAS-2 Isolate Unclassified
36 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
37 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
38 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
39 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
40 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
41 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
42 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
43 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
44 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
45 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
46 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
47 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
48 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
49 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_223533 3300042612 Bacteria 9670
2 Ga0466713_095393 3300042602 Bacteria 10342
3 Ga0466720_065410 3300042607 Bacteria 38105
4 Ga0466720_108024 3300042607 Bacteria 60869
5 Ga0466708_243019 3300042652 Bacteria 6394
6 JGI24698J34947_10000169 3300002449 Bacteria 25304
7 JGI24698J34947_10000397 3300002449 Bacteria 19762
8 JGI24698J34947_10001174 3300002449 Bacteria 13653
9 JGI24698J34947_10001538 3300002449 Bacteria 12191
10 JGI24698J34947_10003282 3300002449 Unclassified 8767
11 JGI24698J34947_10003879 3300002449 Bacteria 8131
12 JGI24698J34947_10022611 3300002449 Bacteria 3370
13 JGI24698J34947_10023637 3300002449 Bacteria 3288
14 JGI24698J34947_10040842 3300002449 Bacteria 2393
15 JGI24695J34938_10000520 3300002450 Bacteria 37439
16 JGI24695J34938_10014236 3300002450 Bacteria 4134
17 JGI24695J34938_10015108 3300002450 Unclassified 3973
18 Ga0072941_1003147 3300005201 Bacteria 83880
19 Ga0264413_115191 3300024493 Bacteria 5142
20 Ga0466690_273349 3300042590 Bacteria 14692
21 Ga0466691_143127 3300042593 Bacteria 21417
22 Ga0466699_367249 3300042597 Bacteria 6957
23 Ga0466699_383782 3300042597 Bacteria 42777
24 Ga0466712_004801 3300042614 Bacteria 20548
25 Ga0466712_025347 3300042614 Bacteria 33106
26 Ga0466712_238638 3300042614 Bacteria 18615
27 Ga0466712_296467 3300042614 Bacteria 6978
28 Ga0466728_256335 3300042620 Bacteria 5440
29 Ga0123356_10000032 3300010049 Bacteria 154381
30 Ga0123356_10000264 3300010049 Bacteria 60568
31 Ga0160464_100014 3300012805 Bacteria 294595
32 Ga0466707_057014 3300042601 Unclassified 2966
33 Ga0466714_098377 3300042603 Bacteria 1165
34 Ga0466720_039429 3300042607 Bacteria 8601
35 Ga0466731_042217 3300042622 Archaea 53016
36 Ga0466703_114433 3300042636 Bacteria 25250
37 Ga0466709_244514 3300042648 Bacteria 1244
38 Ga0466708_329215 3300042652 Bacteria 19363
39 JGI24698J34947_10003766 3300002449 Bacteria 8267
40 JGI24698J34947_10008764 3300002449 Unclassified 5548
41 JGI24695J34938_10000963 3300002450 Bacteria 26245
42 Ga0264413_100520 3300024493 Bacteria 23484
43 Ga0264413_104284 3300024493 Bacteria 9049
44 Ga0264413_108093 3300024493 Bacteria 14472
45 Ga0466694_209141 3300042594 Bacteria 4829
46 Ga0466694_311242 3300042594 Bacteria 7219
47 Ga0466696_247847 3300042596 Bacteria 4154
48 Ga0466712_013257 3300042614 Bacteria 14183
49 Ga0466712_148698 3300042614 Bacteria 13070
50 Ga0466712_212965 3300042614 Bacteria 18054
51 Ga0466726_206449 3300042619 Unclassified 20895
52 Ga0466703_370542 3300042636 Bacteria 3689
53 Ga0466704_129181 3300042643 Unclassified 3018
54 JGI24698J34947_10013964 3300002449 Bacteria 4377
55 JGI24698J34947_10015034 3300002449 Bacteria 4215
56 JGI24698J34947_10038656 3300002449 Bacteria 2474
57 JGI24695J34938_10000431 3300002450 Bacteria 40398
58 JGI24695J34938_10000841 3300002450 Bacteria 28463
59 Ga0466692_186414 3300042591 Bacteria 3753
60 Ga0466712_046121 3300042614 Unclassified 10469
61 Ga0466712_273986 3300042614 Unclassified 8147
62 Ga0466729_046879 3300042621 Bacteria 4795
63 Ga0466706_011132 3300042599 Bacteria 1537
64 Ga0466719_305209 3300042606 Bacteria 8160
65 Ga0466720_126456 3300042607 Bacteria 1506
66 Ga0466720_176349 3300042607 Bacteria 41886
67 Ga0466735_110289 3300042624 Bacteria 12453
68 Ga0466703_207911 3300042636 Bacteria 10138
69 AustNasuHG_c1023145 3300000089 Bacteria 1987
70 JGI24698J34947_10018623 3300002449 Bacteria 3749
71 JGI24698J34947_10026228 3300002449 Unclassified 3098
72 JGI24698J34947_10080977 3300002449 Bacteria 1523
73 JGI24695J34938_10000104 3300002450 Bacteria 74204
74 JGI24695J34938_10008642 3300002450 Unclassified 5787
75 JGI24702J35022_10107117 3300002462 Bacteria 1535
76 Ga0068305_10131887 3300005083 Unclassified 2689
77 Ga0264413_127233 3300024493 Unclassified 4705
78 Ga0466699_009862 3300042597 Bacteria 72863
79 Ga0466726_343623 3300042619 Bacteria 15284
80 Ga0123354_10132996 3300010882 Bacteria 3130
81 Ga0466707_006618 3300042601 Bacteria 2009
82 Ga0466714_045751 3300042603 Bacteria 5213
83 Ga0466703_186340 3300042636 Bacteria 9924
84 JGI24698J34947_10007597 3300002449 Bacteria 5958
85 JGI24698J34947_10008150 3300002449 Bacteria 5748
86 JGI24698J34947_10008898 3300002449 Bacteria 5510
87 JGI24698J34947_10019978 3300002449 Bacteria 3610
88 JGI24698J34947_10036293 3300002449 Bacteria 2567
89 JGI24695J34938_10000111 3300002450 Bacteria 72830
90 JGI24695J34938_10000355 3300002450 Bacteria 45167
91 JGI24695J34938_10002076 3300002450 Bacteria 15716
92 Ga0466657_128459 3300042582 Bacteria 2152
93 Ga0466712_018602 3300042614 Bacteria 54161
94 Ga0466712_046818 3300042614 Bacteria 19755
95 Ga0466712_152999 3300042614 Bacteria 6123
96 Ga0466712_185745 3300042614 Bacteria 7374
97 Ga0466712_262207 3300042614 Bacteria 5263
98 Ga0466712_296032 3300042614 Bacteria 21817
99 Ga0466705_157175 3300042612 Bacteria 2423
100 Ga0466705_325488 3300042612 Bacteria 2510
101 Ga0123355_10228155 3300009826 Bacteria 2664
102 Ga0466706_050745 3300042599 Bacteria 10034
103 Ga0466722_119949 3300042609 Bacteria 2845
104 Ga0466704_045031 3300042643 Bacteria 3426
105 JGI24698J34947_10000004 3300002449 Bacteria 62550
106 JGI24698J34947_10001168 3300002449 Bacteria 13684
107 JGI24698J34947_10040492 3300002449 Bacteria 2405
108 JGI24698J34947_10068631 3300002449 Bacteria 1714
109 JGI24695J34938_10000122 3300002450 Bacteria 69892
110 JGI24695J34938_10001261 3300002450 Bacteria 22261
111 JGI24695J34938_10005363 3300002450 Bacteria 8016
112 JGI24699J35502_11133893 3300002509 Bacteria 18446
113 Ga0072941_1034139 3300005201 Bacteria 10029
114 Ga0160453_100108 3300012814 Bacteria 84579
115 Ga0264413_104325 3300024493 Bacteria 24047
116 Ga0466693_436991 3300042592 Bacteria 1776
117 Ga0466712_002351 3300042614 Bacteria 29662
118 Ga0466712_128947 3300042614 Bacteria 14094
119 Ga0466712_132221 3300042614 Bacteria 19828
120 Ga0466718_002524 3300042617 Bacteria 42896
121 Ga0466703_148204 3300042636 Bacteria 12082
122 Ga0466703_225910 3300042636 Bacteria 10696
123 JGI24698J34947_10015490 3300002449 Bacteria 4148
124 JGI24698J34947_10087718 3300002449 Unclassified 1438
125 JGI24698J34947_10099301 3300002449 Bacteria 1313
126 JGI24695J34938_10003709 3300002450 Bacteria 10439
127 Ga0466712_077826 3300042614 Bacteria 33172
128 Ga0466712_171107 3300042614 Bacteria 22554
129 Ga0466705_000375 3300042612 Bacteria 2489
130 Ga0466732_028038 3300042656 Bacteria 10403
131 Ga0466720_046989 3300042607 Bacteria 13019
132 Ga0466709_149837 3300042648 Bacteria 6043
133 AustNasuHG_c1011253 3300000089 Bacteria 3103
134 JGI24698J34947_10001047 3300002449 Bacteria 14254
135 JGI24695J34938_10040632 3300002450 Bacteria 2093
136 JGI24705J35276_12234924 3300002504 Bacteria 5993
137 Ga0072940_1106216 3300005200 Bacteria 2673
138 Ga0466656_245947 3300042550 Bacteria 1901
139 Ga0466712_307000 3300042614 Bacteria 7499
140 Ga0466711_267649 3300042615 Bacteria 10237
141 Ga0466726_255940 3300042619 Bacteria 30228

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300005201 Ga0072941_1034139 Ga0072941_10341393 342
2 3300002504 JGI24705J35276_12234924 JGI24705J35276_122349244 344
3 3300042612 Ga0466705_325488 Ga0466705_325488_410_1486 347
4 3300010882 Ga0123354_10132996 Ga0123354_101329963 349
5 3300042622 Ga0466731_042217 Ga0466731_042217_24627_25679 350
6 3300042596 Ga0466696_247847 Ga0466696_247847_560_1621 353
7 3300042636 Ga0466703_207911 Ga0466703_207911_8283_9344 353
8 3300042620 Ga0466728_256335 Ga0466728_256335_3968_5053 354
9 3300042614 Ga0466712_238638 Ga0466712_238638_14239_15306 355
10 iso_pr_bacteria 2864836148 2864837231 355
11 3300002449 JGI24698J34947_10003766 JGI24698J34947_100037664 356
12 3300042602 Ga0466713_095393 Ga0466713_095393_2920_4002 360
13 3300005083 Ga0068305_10131887 Ga0068305_101318873 361
14 3300024493 Ga0264413_100520 Ga0264413_10052021 361
15 3300024493 Ga0264413_104284 Ga0264413_1042848 361
16 3300024493 Ga0264413_104325 Ga0264413_1043259 361
17 3300024493 Ga0264413_108093 Ga0264413_1080938 361
18 3300024493 Ga0264413_115191 Ga0264413_1151912 361
19 3300024493 Ga0264413_127233 Ga0264413_1272332 361
20 3300042590 Ga0466690_273349 Ga0466690_273349_5977_7062 361
21 3300042591 Ga0466692_186414 Ga0466692_186414_1039_2124 361
22 3300042592 Ga0466693_436991 Ga0466693_436991_540_1625 361
23 3300042593 Ga0466691_143127 Ga0466691_143127_18681_19766 361
24 3300042594 Ga0466694_209141 Ga0466694_209141_3476_4561 361
25 3300042594 Ga0466694_311242 Ga0466694_311242_3031_4116 361
26 3300042597 Ga0466699_009862 Ga0466699_009862_6647_7732 361
27 3300042597 Ga0466699_367249 Ga0466699_367249_2023_3108 361
28 3300042597 Ga0466699_383782 Ga0466699_383782_41119_42204 361
29 3300042599 Ga0466706_011132 Ga0466706_011132_226_1311 361
30 3300042599 Ga0466706_050745 Ga0466706_050745_5876_6961 361
31 3300042601 Ga0466707_006618 Ga0466707_006618_911_1996 361
32 3300042601 Ga0466707_057014 Ga0466707_057014_1159_2244 361
33 3300042603 Ga0466714_045751 Ga0466714_045751_4098_5183 361
34 3300042603 Ga0466714_098377 Ga0466714_098377_66_1151 361
35 3300042606 Ga0466719_305209 Ga0466719_305209_1387_2472 361
36 3300042607 Ga0466720_039429 Ga0466720_039429_1198_2283 361
37 3300042607 Ga0466720_046989 Ga0466720_046989_2602_3687 361
38 3300042607 Ga0466720_065410 Ga0466720_065410_8084_9169 361
39 3300042607 Ga0466720_108024 Ga0466720_108024_48960_50045 361
40 3300042607 Ga0466720_126456 Ga0466720_126456_264_1349 361
41 3300042607 Ga0466720_176349 Ga0466720_176349_13910_14995 361
42 3300042609 Ga0466722_119949 Ga0466722_119949_1531_2616 361
43 3300042612 Ga0466705_157175 Ga0466705_157175_29_1114 361
44 3300042612 Ga0466705_223533 Ga0466705_223533_8045_9130 361
45 3300042614 Ga0466712_002351 Ga0466712_002351_2884_3969 361
46 3300042614 Ga0466712_004801 Ga0466712_004801_13900_14985 361
47 3300042614 Ga0466712_018602 Ga0466712_018602_19525_20610 361
48 3300042614 Ga0466712_025347 Ga0466712_025347_4477_5562 361
49 3300042614 Ga0466712_046121 Ga0466712_046121_2305_3390 361
50 3300042614 Ga0466712_046818 Ga0466712_046818_3851_4936 361
51 3300042614 Ga0466712_128947 Ga0466712_128947_10181_11266 361
52 3300042614 Ga0466712_132221 Ga0466712_132221_10233_11318 361
53 3300042614 Ga0466712_152999 Ga0466712_152999_256_1341 361
54 3300042614 Ga0466712_171107 Ga0466712_171107_12390_13475 361
55 3300042614 Ga0466712_185745 Ga0466712_185745_109_1194 361
56 3300042614 Ga0466712_212965 Ga0466712_212965_15896_16981 361
57 3300042614 Ga0466712_262207 Ga0466712_262207_52_1137 361
58 3300042614 Ga0466712_273986 Ga0466712_273986_6954_8039 361
59 3300042614 Ga0466712_296032 Ga0466712_296032_18097_19182 361
60 3300042614 Ga0466712_296467 Ga0466712_296467_4821_5906 361
61 3300042614 Ga0466712_307000 Ga0466712_307000_3477_4562 361
62 3300042615 Ga0466711_267649 Ga0466711_267649_1123_2208 361
63 3300042617 Ga0466718_002524 Ga0466718_002524_11674_12759 361
64 3300042619 Ga0466726_206449 Ga0466726_206449_2607_3692 361
65 3300042619 Ga0466726_255940 Ga0466726_255940_3136_4221 361
66 3300042619 Ga0466726_343623 Ga0466726_343623_12022_13107 361
67 3300042624 Ga0466735_110289 Ga0466735_110289_6060_7145 361
68 3300042636 Ga0466703_114433 Ga0466703_114433_23836_24921 361
69 3300042636 Ga0466703_148204 Ga0466703_148204_2706_3791 361
70 3300042636 Ga0466703_186340 Ga0466703_186340_8367_9452 361
71 3300042636 Ga0466703_225910 Ga0466703_225910_9298_10383 361
72 3300042636 Ga0466703_370542 Ga0466703_370542_2064_3149 361
73 3300042643 Ga0466704_045031 Ga0466704_045031_1220_2305 361
74 3300042643 Ga0466704_129181 Ga0466704_129181_1886_2971 361
75 3300042648 Ga0466709_149837 Ga0466709_149837_2579_3664 361
76 3300042652 Ga0466708_243019 Ga0466708_243019_533_1618 361
77 3300042656 Ga0466732_028038 Ga0466732_028038_3767_4852 361
78 iso_pr_bacteria 2781125657 2781322245 361
79 iso_pr_bacteria 650716102 650882390 361
80 3300000089 AustNasuHG_c1011253 AustNasuHG_10112533 362
81 3300000089 AustNasuHG_c1023145 AustNasuHG_10231452 362
82 3300002449 JGI24698J34947_10000004 JGI24698J34947_1000000432 362
83 3300002449 JGI24698J34947_10000169 JGI24698J34947_1000016918 362
84 3300002449 JGI24698J34947_10000397 JGI24698J34947_100003978 362
85 3300002449 JGI24698J34947_10001047 JGI24698J34947_100010479 362
86 3300002449 JGI24698J34947_10001168 JGI24698J34947_1000116813 362
87 3300002449 JGI24698J34947_10001174 JGI24698J34947_100011749 362
88 3300002449 JGI24698J34947_10001538 JGI24698J34947_100015383 362
89 3300002449 JGI24698J34947_10003282 JGI24698J34947_100032822 362
90 3300002449 JGI24698J34947_10003879 JGI24698J34947_100038795 362
91 3300002449 JGI24698J34947_10007597 JGI24698J34947_100075974 362
92 3300002449 JGI24698J34947_10008150 JGI24698J34947_100081503 362
93 3300002449 JGI24698J34947_10008764 JGI24698J34947_100087645 362
94 3300002449 JGI24698J34947_10008898 JGI24698J34947_100088982 362
95 3300002449 JGI24698J34947_10013964 JGI24698J34947_100139643 362
96 3300002449 JGI24698J34947_10015034 JGI24698J34947_100150343 362
97 3300002449 JGI24698J34947_10015490 JGI24698J34947_100154902 362
98 3300002449 JGI24698J34947_10018623 JGI24698J34947_100186233 362
99 3300002449 JGI24698J34947_10019978 JGI24698J34947_100199784 362
100 3300002449 JGI24698J34947_10022611 JGI24698J34947_100226113 362
101 3300002449 JGI24698J34947_10026228 JGI24698J34947_100262283 362
102 3300002449 JGI24698J34947_10038656 JGI24698J34947_100386562 362
103 3300002449 JGI24698J34947_10040492 JGI24698J34947_100404922 362
104 3300002449 JGI24698J34947_10040842 JGI24698J34947_100408422 362
105 3300002449 JGI24698J34947_10068631 JGI24698J34947_100686311 362
106 3300002449 JGI24698J34947_10080977 JGI24698J34947_100809771 362
107 3300002449 JGI24698J34947_10087718 JGI24698J34947_100877181 362
108 3300002449 JGI24698J34947_10099301 JGI24698J34947_100993011 362
109 3300002450 JGI24695J34938_10000104 JGI24695J34938_1000010429 362
110 3300002450 JGI24695J34938_10000111 JGI24695J34938_100001116 362
111 3300002450 JGI24695J34938_10000122 JGI24695J34938_1000012211 362
112 3300002450 JGI24695J34938_10000355 JGI24695J34938_1000035517 362
113 3300002450 JGI24695J34938_10000520 JGI24695J34938_1000052022 362
114 3300002450 JGI24695J34938_10000841 JGI24695J34938_1000084114 362
115 3300002450 JGI24695J34938_10001261 JGI24695J34938_1000126122 362
116 3300002450 JGI24695J34938_10002076 JGI24695J34938_100020764 362
117 3300002450 JGI24695J34938_10003709 JGI24695J34938_100037096 362
118 3300002450 JGI24695J34938_10005363 JGI24695J34938_100053635 362
119 3300002450 JGI24695J34938_10014236 JGI24695J34938_100142362 362
120 3300002450 JGI24695J34938_10015108 JGI24695J34938_100151082 362
121 3300002450 JGI24695J34938_10040632 JGI24695J34938_100406322 362
122 3300002462 JGI24702J35022_10107117 JGI24702J35022_101071172 362
123 3300005200 Ga0072940_1106216 Ga0072940_11062162 362
124 3300005201 Ga0072941_1003147 Ga0072941_100314727 362
125 3300009826 Ga0123355_10228155 Ga0123355_102281553 362
126 3300010049 Ga0123356_10000032 Ga0123356_1000003216 362
127 3300010049 Ga0123356_10000264 Ga0123356_1000026419 362
128 3300042652 Ga0466708_329215 Ga0466708_329215_11504_12592 362
129 3300002450 JGI24695J34938_10000963 JGI24695J34938_1000096310 363
130 3300042550 Ga0466656_245947 Ga0466656_245947_286_1380 364
131 3300042621 Ga0466729_046879 Ga0466729_046879_769_1863 364
132 iso_pr_bacteria 2772190975 2773721100 364
133 3300042614 Ga0466712_013257 Ga0466712_013257_7152_8252 366
134 3300002449 JGI24698J34947_10023637 JGI24698J34947_100236373 367
135 3300002449 JGI24698J34947_10036293 JGI24698J34947_100362931 367
136 3300002509 JGI24699J35502_11133893 JGI24699J35502_111338934 367
137 3300042614 Ga0466712_148698 Ga0466712_148698_4626_5729 367
138 3300042582 Ga0466657_128459 Ga0466657_128459_591_1703 370
139 3300012805 Ga0160464_100014 Ga0160464_100014150 371
140 3300012814 Ga0160453_100108 Ga0160453_10010855 371
141 3300002450 JGI24695J34938_10000431 JGI24695J34938_1000043121 372
142 3300042614 Ga0466712_077826 Ga0466712_077826_28178_29296 372
143 3300042648 Ga0466709_244514 Ga0466709_244514_101_1219 372
144 3300042612 Ga0466705_000375 Ga0466705_000375_828_1949 373
145 3300002450 JGI24695J34938_10008642 JGI24695J34938_100086424 408

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase 51 381 1
PF01370 Epimerase NAD dependent epimerase/dehydratase family 50 295 0.97

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.