Protein Family IF00642

Metagenome Isolate
206 Members
102 Samples
146 Scaffolds
154.75 Avg Length

🧬 Representative Sequence

ID
3300002450|JGI24695J34938_10008013|JGI24695J34938_100080132
Length
178 aa
Sequence
MRFIPIFLNNDEGAISKAMKITIIAVGKIKEKFYRDALSEYDKRLSKYAKLKIIEVDDEKAPEHISDVLKEQILRKEGEKILRHITAGTYVVSLEIFGKSMDSEGFATHLSNLKVGGVSHIRFIIGGSLGLHPSVCERADMHLSFSAMTFPHQMMRVILLEQVYRAFRIEAGEPYHK*

📊 Sample Types

Isolate 29.1%
Metagenome 70.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 28.3%
Blattidae 22.2%
Termitidae 20.2%
Tenebrionidae 7.1%
Kalotermitidae 5.1%
Drosophilidae 4.0%
Rhinotermitidae 3.0%
Termopsidae 2.0%
Passalidae 2.0%
Ixodidae 2.0%
Hodotermitidae 1.0%
Scarabaeidae 1.0%
Apidae 1.0%
Syrphidae 1.0%

🌳 Taxonomy

Archaea 0
Bacteria 154
Eukaryota 0
Viruses 0
Unclassified 52

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820854745 Unclassified Actinobacteria Lab288P3bin234 Isolate Unclassified
2 2940236825 Breznakia sp. PM6-1 Isolate Blattidae
3 2940280053 Lachnospiraceae bacterium PF1-22 Isolate Blattidae
4 2940341480 Breznakia sp. PFB2-8 Isolate Blattidae
5 2940356891 Breznakia sp. PFB1-11 Isolate Blattidae
6 2940364193 Breznakia sp. PFB1-19 Isolate Blattidae
7 2944625312 Dysgonomonas sp. PF1-3 Isolate Blattidae
8 2561511100 Mesoplasma photuris ATCC 49581 Isolate Unclassified
9 2820721785 Unclassified Fibrobacteres Lab288P1bin58 Isolate Unclassified
10 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
11 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
12 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
13 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
14 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
15 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
16 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
17 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
18 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
19 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
20 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
21 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
22 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
23 2940292506 Lachnoclostridium sp. PH5-23 Isolate Blattidae
24 2940343849 Breznakia sp. PH5-24 Isolate Blattidae
25 2940352027 Breznakia sp. PH1-1 Isolate Blattidae
26 2820507989 Unclassified Firmicutes Lab288P1bin41 Isolate Unclassified
27 2545824514 Entomoplasma somnilux ATCC 49194 Isolate Unclassified
28 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
29 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
30 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
31 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
32 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
33 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
34 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
35 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
36 2940339133 Breznakia sp. PF5-3 Isolate Blattidae
37 2940361758 Breznakia sp. PFB1-14 Isolate Blattidae
38 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
39 2775507073 Enterococcus sp. CR-Ec1 Isolate Unclassified
40 2820277137 Unclassified Firmicutes Th196P3bin150 Isolate Unclassified
41 2820329821 Unclassified Firmicutes Nt197P3bin77 Isolate Unclassified
42 2820459456 Unclassified Firmicutes Lab288P3bin148 Isolate Unclassified
43 2806310699 Spiroplasma melliferum KC3 Isolate Unclassified
44 8100315503 Spiroplasma sp. hyd1 Isolate Drosophilidae
45 2940277027 Lachnospiraceae bacterium PF1-21 Isolate Blattidae
46 2820545146 Unclassified Firmicutes Lab288P1bin104 Isolate Unclassified
47 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
48 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
49 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
50 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
51 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
52 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
53 2940230426 Lachnospiraceae bacterium PH5-48 Isolate Blattidae
54 2940283334 Lachnospiraceae bacterium PF1-4 Isolate Blattidae
55 2940295490 Lachnospiraceae bacterium PH1-22 Isolate Blattidae
56 2940368928 Breznakia sp. PFB2-30 Isolate Blattidae
57 2731957677 Alkalihalobacillus trypoxylicola NBRC 102646 Isolate Scarabaeidae
58 2820353569 Unclassified Firmicutes Nt197P3bin28 Isolate Unclassified
59 2820492969 Unclassified Firmicutes Lab288P1bin6 Isolate Unclassified
60 2820593525 Unclassified Firmicutes Emb289P1bin7 Isolate Unclassified
61 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
62 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
63 8012112996 Staphylococcus muscae ATCC 49910 Isolate
64 8067289520 Spiroplasma poulsonii MSRO_BK Isolate Drosophilidae
65 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
66 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
67 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
68 8112490586 Staphylococcus muscae CCM 4175 Isolate
69 2900804455 Listeria sp. PSOL-1 Marseille-P4284 Isolate Unclassified
70 2917496769 Staphylococcus muscae DSM 7068 Isolate Unclassified
71 2940289514 Lachnospiraceae bacterium PM6-15 Isolate Blattidae
72 2940359323 Breznakia sp. PFB1-12 Isolate Blattidae
73 2940366561 Breznakia sp. PFB1-4 Isolate Blattidae
74 2558860181 Spiroplasma mirum ATCC 29335 Isolate Ixodidae
75 2558860251 Spiroplasma mirum SMCA Isolate Ixodidae
76 2820324456 Unclassified Firmicutes Nt197P3bin80 Isolate Unclassified
77 2820393573 Unclassified Firmicutes Nc150P1bin9 Isolate Unclassified
78 2802429587 Spiroplasma eriocheiris CCTCC 'M 207170' Isolate Unclassified
79 8076013101 Spiroplasma poulsonii sHy/REF Isolate Drosophilidae
80 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
81 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
82 2902668162 Lacticaseibacillus paracasei DmW_181 Isolate Drosophilidae
83 2940286528 Lachnospiraceae bacterium PFB1-21 Isolate Blattidae
84 2820671341 Unclassified Firmicutes Co191P3bin20 Isolate Unclassified
85 2554235371 Spiroplasma chrysopicola DF-1 Isolate Unclassified
86 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
87 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
88 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
89 8064531044 Terrisporobacter mayombei DSM 6539 Isolate Unclassified
90 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
91 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
92 2940233634 Lachnoclostridium sp. PF5-10 Isolate Blattidae
93 2940354458 Breznakia sp. PF1-11 Isolate Blattidae
94 2636416028 Pelosinus propionicus DSM 13327 Isolate Unclassified
95 2788499854 Breznakia blatticola DSM 28867 Isolate Unclassified
96 2820223845 Unclassified Firmicutes Th196P4bin57 Isolate Unclassified
97 2541047151 Spiroplasma melliferum IPMB4A Isolate Apidae
98 2554235381 Spiroplasma syrphidicola EA-1 Isolate Syrphidae
99 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
100 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
101 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
102 8012942269 Mammaliicoccus lentus UD i2 Isolate Tenebrionidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562379_0003 3300056790 Bacteria 3011780
2 Ga0562377_0006 3300056842 Bacteria 3350072
3 Ga0562377_0460 3300056842 Unclassified 68204
4 Ga0562376_1968 3300056857 Unclassified 26677
5 Ga0562376_2402 3300056857 Unclassified 22325
6 Ga0562376_5308 3300056857 Unclassified 8663
7 Ga0562376_6442 3300056857 Unclassified 4683
8 Ga0562374_0401 3300057007 Bacteria 77777
9 Ga0466706_246551 3300042599 Bacteria 1113
10 Ga0466700_168972 3300042600 Bacteria 1096
11 Ga0466719_336472 3300042606 Bacteria 54006
12 Ga0466722_082143 3300042609 Bacteria 3265
13 Ga0466698_074981 3300042610 Unclassified 1031
14 Ga0123355_10104429 3300009826 Bacteria 4450
15 Ga0123353_10000030 3300010167 Bacteria 161205
16 Ga0123353_10040418 3300010167 Bacteria 7358
17 2227505169 2225789004 Bacteria 19039
18 Ga0562378_3294 3300056814 Bacteria 10232
19 Ga0562377_1832 3300056842 Unclassified 19169
20 Ga0562377_2526 3300056842 Unclassified 13315
21 Ga0562375_0530 3300056856 Unclassified 77134
22 Ga0562376_1869 3300056857 Unclassified 27543
23 Ga0466734_091315 3300042623 Bacteria 1868
24 Ga0466704_329179 3300042643 Bacteria 3191
25 Ga0466729_119604 3300042621 Bacteria 18283
26 Ga0466707_259060 3300042601 Bacteria 63426
27 Ga0466714_011982 3300042603 Bacteria 1596
28 Ga0123355_10407015 3300009826 Bacteria 1750
29 Ga0123356_10281695 3300010049 Bacteria 1758
30 Ga0123353_10080939 3300010167 Bacteria 5222
31 Ga0123353_10372286 3300010167 Bacteria 2141
32 2227498800 2225789004 Bacteria 3856
33 IMNBL1DRAFT_c0003742 3300000062 Bacteria 9529
34 IMNBL1DRAFT_c0103069 3300000062 Bacteria 765
35 AustNasuHG_c1002721 3300000089 Bacteria 6375
36 Ga0466697_062265 3300042611 Bacteria 2648
37 Ga0562378_0666 3300056814 Unclassified 51271
38 Ga0562377_0263 3300056842 Unclassified 116907
39 Ga0562375_3492 3300056856 Unclassified 14576
40 Ga0562376_0009 3300056857 Bacteria 1013235
41 Ga0562376_1763 3300056857 Bacteria 28889
42 Ga0562376_3176 3300056857 Unclassified 17303
43 Ga0466729_286836 3300042621 Bacteria 3235
44 Ga0466734_033236 3300042623 Bacteria 1883
45 Ga0466709_279759 3300042648 Bacteria 128062
46 Ga0466693_382275 3300042592 Bacteria 2010
47 Ga0466699_084384 3300042597 Bacteria 1009
48 Ga0466706_125760 3300042599 Bacteria 2837
49 Ga0466707_143872 3300042601 Bacteria 3568
50 Ga0466707_286647 3300042601 Unclassified 8770
51 Ga0466722_133138 3300042609 Bacteria 2064
52 Ga0123355_10170289 3300009826 Bacteria 3257
53 Ga0123356_10092920 3300010049 Bacteria 2878
54 Ga0123354_10086066 3300010882 Bacteria 4397
55 JGI24700J35501_10930663 3300002508 Bacteria 18219
56 Ga0068302_10244105 3300005071 Unclassified 595
57 Ga0466697_232862 3300042611 Bacteria 1371
58 Ga0466733_083879 3300042659 Bacteria 1933
59 Ga0466733_144102 3300042659 Bacteria 37735
60 Ga0466733_180287 3300042659 Bacteria 3475
61 Ga0466733_220803 3300042659 Bacteria 1714
62 Ga0562378_1678 3300056814 Unclassified 22607
63 Ga0562377_0935 3300056842 Unclassified 37245
64 Ga0562375_1903 3300056856 Unclassified 25597
65 Ga0562375_5181 3300056856 Unclassified 8412
66 Ga0562376_0914 3300056857 Unclassified 46177
67 Ga0562374_0323 3300057007 Unclassified 90179
68 Ga0466734_151366 3300042623 Bacteria 1066
69 Ga0466715_454892 3300042616 Bacteria 75769
70 Ga0466657_032428 3300042582 Unclassified 2420
71 Ga0466707_327366 3300042601 Bacteria 3292
72 Ga0466713_115509 3300042602 Bacteria 3862
73 Ga0123355_10048815 3300009826 Bacteria 6883
74 Ga0123355_10400727 3300009826 Bacteria 1770
75 Ga0123353_10460184 3300010167 Bacteria 1870
76 Ga0123353_10998341 3300010167 Bacteria 1125
77 IMNBL1DRAFT_c0000380 3300000062 Bacteria 37967
78 JGI24702J35022_10016186 3300002462 Unclassified 4091
79 Ga0466733_007962 3300042659 Bacteria 9232
80 Ga0466733_119497 3300042659 Bacteria 1201
81 Ga0466733_155091 3300042659 Bacteria 1686
82 Ga0562379_3380 3300056790 Unclassified 10660
83 Ga0562378_1059 3300056814 Unclassified 33934
84 Ga0562378_1273 3300056814 Bacteria 28768
85 Ga0562375_3754 3300056856 Unclassified 13335
86 Ga0562375_5575 3300056856 Unclassified 7276
87 Ga0562376_0442 3300056857 Unclassified 77810
88 Ga0562376_1457 3300056857 Unclassified 33248
89 Ga0562376_4845 3300056857 Unclassified 10168
90 Ga0466730_086362 3300042625 Bacteria 3070
91 Ga0466703_094377 3300042636 Bacteria 2085
92 Ga0466704_368402 3300042643 Bacteria 8441
93 Ga0466700_302328 3300042600 Bacteria 3065
94 Ga0466700_310008 3300042600 Bacteria 1157
95 Ga0466707_178521 3300042601 Bacteria 5413
96 Ga0466707_253337 3300042601 Bacteria 1059
97 Ga0123356_11457833 3300010049 Bacteria 843
98 Ga0123353_10537804 3300010167 Bacteria 1689
99 Ga0068305_10001588 3300005083 Bacteria 82211
100 Ga0562379_5199 3300056790 Unclassified 4931
101 Ga0562377_0631 3300056842 Unclassified 53126
102 Ga0562377_0907 3300056842 Unclassified 38500
103 Ga0562377_1187 3300056842 Unclassified 30071
104 Ga0562375_1218 3300056856 Unclassified 37177
105 Ga0562375_5360 3300056856 Unclassified 7864
106 Ga0562375_6241 3300056856 Unclassified 5372
107 Ga0562376_0834 3300056857 Unclassified 49351
108 Ga0562376_4957 3300056857 Unclassified 9764
109 Ga0466703_068854 3300042636 Bacteria 8990
110 Ga0466726_484872 3300042619 Bacteria 8527
111 Ga0466700_146444 3300042600 Unclassified 2441
112 Ga0466707_064987 3300042601 Bacteria 29074
113 Ga0466707_296781 3300042601 Bacteria 32330
114 Ga0466713_147492 3300042602 Bacteria 11536
115 Ga0123355_10540731 3300009826 Bacteria 1414
116 Ga0123353_10114614 3300010167 Bacteria 4339
117 Ga0123353_10125157 3300010167 Bacteria 4131
118 Ga0123354_10162691 3300010882 Bacteria 2640
119 Ga0562379_3382 3300056790 Unclassified 10657
120 Ga0562377_0382 3300056842 Unclassified 81248
121 Ga0562377_0600 3300056842 Unclassified 54769
122 Ga0562375_5626 3300056856 Unclassified 7142
123 Ga0562375_5746 3300056856 Unclassified 6781
124 Ga0562374_0280 3300057007 Unclassified 98840
125 Ga0466731_342100 3300042622 Bacteria 3607
126 Ga0466725_339726 3300042654 Bacteria 9005
127 Ga0466692_011278 3300042591 Bacteria 21280
128 Ga0466707_156011 3300042601 Bacteria 3851
129 Ga0123355_10617254 3300009826 Bacteria 1280
130 Ga0123356_10068174 3300010049 Bacteria 3332
131 Ga0123356_10480242 3300010049 Bacteria 1396
132 Ga0123356_11643523 3300010049 Bacteria 796
133 Ga0123353_10258342 3300010167 Bacteria 2693
134 Ga0123353_10764053 3300010167 Unclassified 1342
135 Ga0123354_10060745 3300010882 Bacteria 5586
136 Ga0562377_0610 3300056842 Unclassified 54256
137 Ga0562377_2636 3300056842 Bacteria 12658
138 Ga0562375_3074 3300056856 Unclassified 16661
139 Ga0562376_2196 3300056857 Unclassified 24363
140 Ga0466722_034072 3300042609 Bacteria 33241
141 Ga0123353_10003995 3300010167 Bacteria 18876
142 Ga0123353_10006504 3300010167 Unclassified 15566
143 IMNBL1DRAFT_c0004254 3300000062 Bacteria 8674
144 IMNBL1DRAFT_c0022900 3300000062 Bacteria 2459
145 JGI24695J34938_10008013 3300002450 Bacteria 6091
146 JGI24702J35022_10022394 3300002462 Bacteria 3419

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 8067289520 8067290094 125
2 iso_pr_bacteria 8076013101 8076014663 125
3 iso_pr_bacteria 8100315503 8100316266 125
4 3300010167 Ga0123353_10764053 Ga0123353_107640532 129
5 3300010167 Ga0123353_10003995 Ga0123353_100039952 138
6 3300042609 Ga0466722_034072 Ga0466722_034072_22322_22801 143
7 3300042622 Ga0466731_342100 Ga0466731_342100_2321_2752 143
8 3300042623 Ga0466734_151366 Ga0466734_151366_252_683 143
9 3300010167 Ga0123353_10080939 Ga0123353_100809396 144
10 3300056814 Ga0562378_1273 Ga0562378_1273_26931_27365 144
11 3300056842 Ga0562377_2636 Ga0562377_2636_11768_12202 144
12 3300056856 Ga0562375_5181 Ga0562375_5181_4962_5396 144
13 3300056857 Ga0562376_1763 Ga0562376_1763_1855_2289 144
14 3300057007 Ga0562374_0280 Ga0562374_0280_70026_70460 144
15 3300010167 Ga0123353_10460184 Ga0123353_104601842 145
16 3300042600 Ga0466700_310008 Ga0466700_310008_443_880 145
17 3300042602 Ga0466713_147492 Ga0466713_147492_7083_7562 145
18 3300042643 Ga0466704_368402 Ga0466704_368402_873_1349 145
19 3300042654 Ga0466725_339726 Ga0466725_339726_5016_5453 145
20 3300000062 IMNBL1DRAFT_c0000380 IMNBL1DRAFT_00003808 146
21 3300042582 Ga0466657_032428 Ga0466657_032428_1124_1564 146
22 3300042600 Ga0466700_146444 Ga0466700_146444_1480_1920 146
23 3300042623 Ga0466734_033236 Ga0466734_033236_1299_1739 146
24 3300010049 Ga0123356_11457833 Ga0123356_114578332 147
25 3300010167 Ga0123353_10040418 Ga0123353_100404182 147
26 3300010167 Ga0123353_10372286 Ga0123353_103722861 147
27 iso_pr_bacteria 2820324456 2820324665 147
28 3300010167 Ga0123353_10258342 Ga0123353_102583423 148
29 3300042611 Ga0466697_232862 Ga0466697_232862_729_1178 149
30 3300002508 JGI24700J35501_10930663 JGI24700J35501_109306639 150
31 3300009826 Ga0123355_10170289 Ga0123355_101702894 150
32 3300010049 Ga0123356_10281695 Ga0123356_102816951 150
33 3300010049 Ga0123356_10480242 Ga0123356_104802422 150
34 3300010167 Ga0123353_10998341 Ga0123353_109983412 150
35 3300010882 Ga0123354_10060745 Ga0123354_100607456 150
36 3300042591 Ga0466692_011278 Ga0466692_011278_12413_12883 150
37 iso_pr_bacteria 2820545146 2820545392 150
38 iso_pr_bacteria 2820593525 2820593961 150
39 3300009826 Ga0123355_10048815 Ga0123355_100488153 151
40 3300042597 Ga0466699_084384 Ga0466699_084384_225_680 151
41 3300042601 Ga0466707_064987 Ga0466707_064987_22621_23076 151
42 3300042601 Ga0466707_143872 Ga0466707_143872_735_1190 151
43 3300042601 Ga0466707_178521 Ga0466707_178521_521_976 151
44 3300042601 Ga0466707_327366 Ga0466707_327366_31_486 151
45 3300042623 Ga0466734_091315 Ga0466734_091315_256_711 151
46 iso_pr_bacteria 2820353569 2820356179 151
47 3300005071 Ga0068302_10244105 Ga0068302_102441051 152
48 3300009826 Ga0123355_10540731 Ga0123355_105407312 152
49 3300010167 Ga0123353_10000030 Ga0123353_1000003028 152
50 3300042621 Ga0466729_286836 Ga0466729_286836_1385_1843 152
51 3300042636 Ga0466703_068854 Ga0466703_068854_6359_6817 152
52 3300042636 Ga0466703_094377 Ga0466703_094377_314_772 152
53 3300010049 Ga0123356_11643523 Ga0123356_116435232 153
54 3300056857 Ga0562376_0009 Ga0562376_0009_685077_685538 153
55 iso_pr_bacteria 2820223845 2820226915 153
56 3300002462 JGI24702J35022_10022394 JGI24702J35022_100223943 154
57 3300056790 Ga0562379_3380 Ga0562379_3380_3165_3629 154
58 3300056790 Ga0562379_3382 Ga0562379_3382_8452_8916 154
59 3300056790 Ga0562379_5199 Ga0562379_5199_3209_3673 154
60 3300056814 Ga0562378_0666 Ga0562378_0666_30099_30563 154
61 3300056814 Ga0562378_1059 Ga0562378_1059_31977_32441 154
62 3300056814 Ga0562378_1678 Ga0562378_1678_9078_9542 154
63 3300056814 Ga0562378_3294 Ga0562378_3294_2043_2507 154
64 3300056842 Ga0562377_0263 Ga0562377_0263_91019_91483 154
65 3300056842 Ga0562377_0382 Ga0562377_0382_74206_74670 154
66 3300056842 Ga0562377_0460 Ga0562377_0460_42557_43021 154
67 3300056842 Ga0562377_0600 Ga0562377_0600_24002_24466 154
68 3300056842 Ga0562377_0610 Ga0562377_0610_24554_25018 154
69 3300056842 Ga0562377_0631 Ga0562377_0631_25256_25720 154
70 3300056842 Ga0562377_0907 Ga0562377_0907_25556_26020 154
71 3300056842 Ga0562377_0935 Ga0562377_0935_30282_30746 154
72 3300056842 Ga0562377_1187 Ga0562377_1187_21290_21754 154
73 3300056842 Ga0562377_1832 Ga0562377_1832_10411_10875 154
74 3300056842 Ga0562377_2526 Ga0562377_2526_553_1017 154
75 3300056856 Ga0562375_0530 Ga0562375_0530_52826_53290 154
76 3300056856 Ga0562375_1218 Ga0562375_1218_1600_2064 154
77 3300056856 Ga0562375_1903 Ga0562375_1903_3030_3494 154
78 3300056856 Ga0562375_3074 Ga0562375_3074_9476_9940 154
79 3300056856 Ga0562375_3492 Ga0562375_3492_3793_4257 154
80 3300056856 Ga0562375_3754 Ga0562375_3754_4176_4640 154
81 3300056856 Ga0562375_5360 Ga0562375_5360_4041_4505 154
82 3300056856 Ga0562375_5575 Ga0562375_5575_3250_3714 154
83 3300056856 Ga0562375_5626 Ga0562375_5626_3796_4260 154
84 3300056856 Ga0562375_5746 Ga0562375_5746_4307_4771 154
85 3300056856 Ga0562375_6241 Ga0562375_6241_4369_4833 154
86 3300056857 Ga0562376_0442 Ga0562376_0442_19938_20402 154
87 3300056857 Ga0562376_0834 Ga0562376_0834_45392_45856 154
88 3300056857 Ga0562376_0914 Ga0562376_0914_14215_14679 154
89 3300056857 Ga0562376_1457 Ga0562376_1457_30945_31409 154
90 3300056857 Ga0562376_1869 Ga0562376_1869_1595_2059 154
91 3300056857 Ga0562376_1968 Ga0562376_1968_17837_18301 154
92 3300056857 Ga0562376_2196 Ga0562376_2196_1876_2340 154
93 3300056857 Ga0562376_2402 Ga0562376_2402_19114_19578 154
94 3300056857 Ga0562376_3176 Ga0562376_3176_9030_9494 154
95 3300056857 Ga0562376_4845 Ga0562376_4845_6562_7026 154
96 3300056857 Ga0562376_5308 Ga0562376_5308_6530_6994 154
97 3300056857 Ga0562376_6442 Ga0562376_6442_966_1430 154
98 3300057007 Ga0562374_0323 Ga0562374_0323_15514_15978 154
99 3300057007 Ga0562374_0401 Ga0562374_0401_15805_16269 154
100 iso_pr_bacteria 2545824514 2545872207 154
101 iso_pr_bacteria 2820854745 2820856108 154
102 3300010049 Ga0123356_10092920 Ga0123356_100929202 155
103 3300010167 Ga0123353_10006504 Ga0123353_100065047 155
104 3300042609 Ga0466722_082143 Ga0466722_082143_1670_2137 155
105 3300042611 Ga0466697_062265 Ga0466697_062265_1797_2264 155
106 iso_pr_bacteria 2558860181 2559092474 155
107 iso_pr_bacteria 2558860251 2559327364 155
108 iso_pr_bacteria 2561511100 2562063540 155
109 iso_pr_bacteria 2802429587 2805847740 155
110 3300042621 Ga0466729_119604 Ga0466729_119604_1368_1838 156
111 iso_pr_bacteria 2541047151 2542000316 156
112 iso_pr_bacteria 2554235371 2555765430 156
113 iso_pr_bacteria 2554235381 2555814451 156
114 iso_pr_bacteria 2806310699 2807278604 156
115 iso_pr_bacteria 2788499854 2788759158 157
116 iso_pr_bacteria 2940352027 2940354384 157
117 iso_pr_bacteria 2940354458 2940356809 157
118 iso_pr_bacteria 2940356891 2940359250 157
119 iso_pr_bacteria 2940359323 2940361681 157
120 iso_pr_bacteria 2940361758 2940364112 157
121 iso_pr_bacteria 2940364193 2940366483 157
122 iso_pr_bacteria 2940366561 2940368853 157
123 iso_pr_bacteria 2940368928 2940371196 157
124 3300042609 Ga0466722_133138 Ga0466722_133138_1493_1969 158
125 3300042610 Ga0466698_074981 Ga0466698_074981_373_849 158
126 3300042659 Ga0466733_155091 Ga0466733_155091_1001_1477 158
127 iso_pr_bacteria 2940236825 2940237990 158
128 iso_pr_bacteria 2940339133 2940340476 158
129 iso_pr_bacteria 2940341480 2940342630 158
130 iso_pr_bacteria 2940343849 2940344932 158
131 2225789004 2227498800 2227979049 159
132 2225789004 2227505169 2227991853 159
133 3300042599 Ga0466706_246551 Ga0466706_246551_431_910 159
134 3300042600 Ga0466700_302328 Ga0466700_302328_1336_1815 159
135 3300042601 Ga0466707_156011 Ga0466707_156011_1393_1872 159
136 3300042601 Ga0466707_259060 Ga0466707_259060_11140_11619 159
137 3300042601 Ga0466707_286647 Ga0466707_286647_3700_4179 159
138 3300042601 Ga0466707_296781 Ga0466707_296781_501_980 159
139 3300042602 Ga0466713_115509 Ga0466713_115509_3030_3509 159
140 3300042616 Ga0466715_454892 Ga0466715_454892_65337_65816 159
141 3300042619 Ga0466726_484872 Ga0466726_484872_1933_2412 159
142 3300042625 Ga0466730_086362 Ga0466730_086362_175_654 159
143 3300042643 Ga0466704_329179 Ga0466704_329179_1392_1871 159
144 3300042648 Ga0466709_279759 Ga0466709_279759_95854_96333 159
145 3300042659 Ga0466733_007962 Ga0466733_007962_3003_3482 159
146 3300042659 Ga0466733_144102 Ga0466733_144102_29155_29634 159
147 3300042659 Ga0466733_180287 Ga0466733_180287_1318_1797 159
148 3300042659 Ga0466733_220803 Ga0466733_220803_31_510 159
149 3300056790 Ga0562379_0003 Ga0562379_0003_2263863_2264342 159
150 3300056842 Ga0562377_0006 Ga0562377_0006_1892744_1893223 159
151 3300056857 Ga0562376_4957 Ga0562376_4957_6460_6939 159
152 iso_pr_bacteria 2636416028 2638992900 159
153 iso_pr_bacteria 2731957677 2732689474 159
154 iso_pr_bacteria 2775507073 2777018248 159
155 iso_pr_bacteria 2820393573 2820395645 159
156 iso_pr_bacteria 2820459456 2820460102 159
157 iso_pr_bacteria 2820492969 2820495047 159
158 iso_pr_bacteria 2820671341 2820673168 159
159 iso_pr_bacteria 2820721785 2820723112 159
160 iso_pr_bacteria 2900804455 2900804498 159
161 iso_pr_bacteria 2902668162 2902671195 159
162 iso_pr_bacteria 2917496769 2917497352 159
163 iso_pr_bacteria 2940230426 2940231204 159
164 iso_pr_bacteria 2940233634 2940234409 159
165 iso_pr_bacteria 2940277027 2940277421 159
166 iso_pr_bacteria 2940280053 2940280560 159
167 iso_pr_bacteria 2940283334 2940283995 159
168 iso_pr_bacteria 2940286528 2940286671 159
169 iso_pr_bacteria 2940289514 2940289839 159
170 iso_pr_bacteria 2940292506 2940292966 159
171 iso_pr_bacteria 2940295490 2940295815 159
172 iso_pr_bacteria 2944625312 2944625818 159
173 iso_pr_bacteria 8012112996 8012114507 159
174 iso_pr_bacteria 8012942269 8012944863 159
175 iso_pr_bacteria 8018794549 8018795746 159
176 iso_pr_bacteria 8064531044 8064535416 159
177 iso_pr_bacteria 8112490586 8112490939 159
178 3300000062 IMNBL1DRAFT_c0003742 IMNBL1DRAFT_00037422 160
179 3300000062 IMNBL1DRAFT_c0004254 IMNBL1DRAFT_00042545 160
180 3300000062 IMNBL1DRAFT_c0022900 IMNBL1DRAFT_00229002 160
181 3300000062 IMNBL1DRAFT_c0103069 IMNBL1DRAFT_01030692 160
182 3300000089 AustNasuHG_c1002721 AustNasuHG_10027214 160
183 3300002462 JGI24702J35022_10016186 JGI24702J35022_100161863 160
184 3300005083 Ga0068305_10001588 Ga0068305_1000158869 160
185 3300009826 Ga0123355_10104429 Ga0123355_101044296 160
186 3300009826 Ga0123355_10407015 Ga0123355_104070152 160
187 3300009826 Ga0123355_10617254 Ga0123355_106172543 160
188 3300010167 Ga0123353_10114614 Ga0123353_101146144 160
189 3300010167 Ga0123353_10125157 Ga0123353_101251572 160
190 3300010167 Ga0123353_10537804 Ga0123353_105378043 160
191 3300010882 Ga0123354_10162691 Ga0123354_101626911 160
192 3300042599 Ga0466706_125760 Ga0466706_125760_336_818 160
193 3300042600 Ga0466700_168972 Ga0466700_168972_294_776 160
194 3300042601 Ga0466707_253337 Ga0466707_253337_117_599 160
195 3300042659 Ga0466733_083879 Ga0466733_083879_822_1304 160
196 3300042659 Ga0466733_119497 Ga0466733_119497_535_1017 160
197 iso_pr_bacteria 2820507989 2820510616 160
198 3300010882 Ga0123354_10086066 Ga0123354_100860663 161
199 3300042592 Ga0466693_382275 Ga0466693_382275_956_1441 161
200 iso_pr_bacteria 2820329821 2820332219 161
201 3300009826 Ga0123355_10400727 Ga0123355_104007273 162
202 3300010049 Ga0123356_10068174 Ga0123356_100681742 163
203 iso_pr_bacteria 2820277137 2820279683 167
204 3300042606 Ga0466719_336472 Ga0466719_336472_26069_26581 170
205 3300002450 JGI24695J34938_10008013 JGI24695J34938_100080132 178
206 3300042603 Ga0466714_011982 Ga0466714_011982_483_1091 202

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02590 SPOUT_MTase Predicted SPOUT methyltransferase 19 176 0.96
PF23400 14 97 0.9

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.88 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.