Protein Family IF00637

Metagenome Isolate
183 Members
53 Samples
169 Scaffolds
702.96 Avg Length

🧬 Representative Sequence

ID
3300002450|JGI24695J34938_10006770|JGI24695J34938_100067702
Length
762 aa
Sequence
MEAPCFVSDIYVPQMLYALTVRSPVAKGRLVSIECPELPEGCTLIKAGDIPGENSLWGSDLPILASGELSYIGEPVALLLGLKKDRLEKYALSCKVIAEEGRPVFSIGEATAIADTEPGLIAARRDIRVGEPEEAFASAASIVKGDYETGIQEHWYSEPCGAIAWLEGQGIRDEQEEEGQENGGASQEQAEGKGQKGQKLVIRTATQCPLHIRHSVARVLGSGHAAPAIQVQPTAAGLHLDGKFWYPSLVSCHAALGAWVTGKPVRLILNKKEDFFFSPKRFGARISVSSAFDEQGELIGTDVEASINLGAYGVSAAGAGDPSGAAEMLDQVCLGSLGIYASKNIRFRGMALRTNIPPQGPFAGLGLAQGSFALERHASLIADKRRQDPSEWRKARFLKTNSLPLGLPVKEAIPGERLLDSAMNMSDYRRKWASYELLRRKRHEQLSQDDSQQTTRVEIGESLRGIGIAIGYQGNKLLHPGPDGGGYGVELILEKDGSLEIKAEMAGSDQAAVWTGIALEILGVEAGNVRISCNDKTFQESGIPESGPAIMSHKATDLTRLVEEACLAIRGQRFRDPLPISVVKTGGPQEDPEWNKHFSLPGGAAPDCSGFLQPGSAAAVVEVEIDPVEYVPKIRGVWLAVDGGRVFRKDKASRSLRLSAVQALGWAYREQIGYAEGRIPVDAFRNFDIQGASEAPPVGISFIENSSDEPKGIGDLPFNCIPAAYLEAVSQAMDWHFRSIPLKARDLWHAAMTKAKKGEEG*

📊 Sample Types

Isolate 7.7%
Metagenome 92.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 35.3%
Unclassified 29.4%
Kalotermitidae 27.5%
Rhinotermitidae 3.9%
Termopsidae 2.0%
Blaberidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 183
Eukaryota 0
Viruses 0
Unclassified 0

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
2 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
3 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
4 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
8 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
9 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
10 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
11 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
12 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
13 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
14 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
15 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
16 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
17 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
18 2772190975 Treponema sp. RmG30 Isolate Blaberidae
19 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
20 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
21 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
22 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
23 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
24 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
25 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
26 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
27 2781125633 Treponema sp. Co191P1bin38 Isolate Unclassified
28 2781125685 Treponema sp. Lab288P1bin13 Isolate Unclassified
29 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
30 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
31 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
32 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
33 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
34 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
35 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
36 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
37 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
38 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
39 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
40 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
41 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
42 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
43 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
44 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
45 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
46 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
47 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
48 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
49 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
50 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
51 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
52 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
53 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_076390 3300042612 Bacteria 11586
2 AustNasuHG_c1000686 3300000089 Bacteria 12040
3 JGI24698J34947_10001254 3300002449 Bacteria 13277
4 JGI24695J34938_10003492 3300002450 Bacteria 10925
5 JGI24702J35022_10012568 3300002462 Bacteria 4701
6 Ga0466694_123440 3300042594 Bacteria 50310
7 Ga0466696_159501 3300042596 Bacteria 22033
8 Ga0466720_005383 3300042607 Bacteria 9250
9 Ga0466720_022808 3300042607 Bacteria 44153
10 Ga0466720_056128 3300042607 Bacteria 15747
11 Ga0466720_119607 3300042607 Bacteria 8266
12 Ga0123355_10085902 3300009826 Bacteria 5005
13 Ga0123356_10001789 3300010049 Bacteria 23449
14 Ga0123356_10003358 3300010049 Bacteria 16805
15 Ga0466712_132560 3300042614 Bacteria 3901
16 Ga0466711_265200 3300042615 Bacteria 8648
17 Ga0466715_089298 3300042616 Bacteria 10214
18 Ga0466715_192820 3300042616 Bacteria 9663
19 Ga0466718_050521 3300042617 Bacteria 6649
20 Ga0466718_050834 3300042617 Bacteria 3164
21 Ga0466718_126108 3300042617 Bacteria 7548
22 Ga0466728_319709 3300042620 Bacteria 10177
23 Ga0466703_084812 3300042636 Bacteria 9101
24 Ga0466704_417993 3300042643 Bacteria 12215
25 Ga0466708_056098 3300042652 Bacteria 19422
26 AustNasuHG_c1001258 3300000089 Bacteria 9132
27 JGI24698J34947_10002414 3300002449 Bacteria 10060
28 JGI24695J34938_10004644 3300002450 Bacteria 8920
29 Ga0072940_1009277 3300005200 Bacteria 7836
30 Ga0072940_1018448 3300005200 Bacteria 5994
31 Ga0072941_1003349 3300005201 Bacteria 40356
32 Ga0264413_101025 3300024493 Bacteria 6317
33 Ga0264413_117929 3300024493 Bacteria 7959
34 Ga0264413_119479 3300024493 Bacteria 4153
35 Ga0466693_292731 3300042592 Bacteria 11996
36 Ga0466691_031804 3300042593 Bacteria 7258
37 Ga0466699_122260 3300042597 Bacteria 12025
38 Ga0466720_053516 3300042607 Bacteria 5779
39 Ga0466720_123820 3300042607 Bacteria 3032
40 Ga0466712_038130 3300042614 Bacteria 20446
41 Ga0466715_157094 3300042616 Bacteria 4677
42 Ga0466718_147139 3300042617 Bacteria 7522
43 Ga0466709_315748 3300042648 Bacteria 19630
44 Ga0466732_444035 3300042656 Bacteria 4692
45 JGI24698J34947_10000580 3300002449 Bacteria 17418
46 JGI24698J34947_10012793 3300002449 Bacteria 4592
47 JGI24698J34947_10013836 3300002449 Bacteria 4398
48 JGI24698J34947_10022674 3300002449 Bacteria 3364
49 JGI24695J34938_10000348 3300002450 Bacteria 45575
50 JGI24695J34938_10006770 3300002450 Bacteria 6813
51 Ga0415639_048186 3300038395 Bacteria 3183
52 Ga0466692_013239 3300042591 Bacteria 7081
53 Ga0466692_163898 3300042591 Bacteria 25340
54 Ga0466693_215613 3300042592 Bacteria 17543
55 Ga0466691_147874 3300042593 Bacteria 26528
56 Ga0466696_198548 3300042596 Bacteria 20253
57 Ga0466699_092365 3300042597 Bacteria 5025
58 Ga0466719_204086 3300042606 Bacteria 20417
59 Ga0466720_139259 3300042607 Bacteria 5318
60 Ga0466720_178452 3300042607 Bacteria 61615
61 Ga0466720_185753 3300042607 Bacteria 3800
62 Ga0466722_084381 3300042609 Bacteria 43243
63 Ga0123356_10000443 3300010049 Bacteria 47239
64 Ga0466712_307482 3300042614 Bacteria 2526
65 Ga0466715_464176 3300042616 Bacteria 6733
66 Ga0466703_066655 3300042636 Bacteria 3481
67 Ga0466704_286886 3300042643 Bacteria 7520
68 Ga0466705_095885 3300042612 Bacteria 9517
69 Ga0466732_079215 3300042656 Bacteria 16766
70 Ga0466732_174943 3300042656 Bacteria 4046
71 Ga0466732_402812 3300042656 Bacteria 2599
72 JGI24698J34947_10015982 3300002449 Bacteria 4081
73 JGI24695J34938_10000420 3300002450 Bacteria 41178
74 JGI24695J34938_10000511 3300002450 Bacteria 37801
75 Ga0072940_1007651 3300005200 Bacteria 5884
76 Ga0072941_1003381 3300005201 Bacteria 4443
77 Ga0072941_1057332 3300005201 Bacteria 4562
78 Ga0072941_1068151 3300005201 Bacteria 4043
79 Ga0264413_102996 3300024493 Bacteria 22929
80 Ga0466694_372355 3300042594 Bacteria 26103
81 Ga0466699_025250 3300042597 Bacteria 7745
82 Ga0466699_112043 3300042597 Bacteria 4087
83 Ga0466699_157063 3300042597 Bacteria 6153
84 Ga0466713_020473 3300042602 Bacteria 7680
85 Ga0466716_535524 3300042605 Bacteria 2528
86 Ga0466720_074924 3300042607 Bacteria 21256
87 Ga0466720_115436 3300042607 Bacteria 52557
88 Ga0466722_175249 3300042609 Bacteria 63620
89 Ga0466718_089840 3300042617 Bacteria 13842
90 Ga0466703_273006 3300042636 Bacteria 7797
91 AustNasuHG_c1000119 3300000089 Bacteria 24192
92 JGI24695J34938_10000232 3300002450 Bacteria 52996
93 JGI24695J34938_10000923 3300002450 Bacteria 26875
94 Ga0068305_10295989 3300005083 Bacteria 6587
95 Ga0466690_031343 3300042590 Bacteria 4104
96 Ga0466691_057666 3300042593 Bacteria 5826
97 Ga0466694_315239 3300042594 Bacteria 4354
98 Ga0466699_093121 3300042597 Bacteria 25575
99 Ga0466699_109702 3300042597 Bacteria 8134
100 Ga0466720_006827 3300042607 Bacteria 4432
101 Ga0466720_079671 3300042607 Bacteria 3636
102 Ga0466720_110638 3300042607 Bacteria 4151
103 Ga0466720_113294 3300042607 Bacteria 5468
104 Ga0466720_185663 3300042607 Bacteria 15769
105 Ga0466722_060842 3300042609 Bacteria 24383
106 Ga0123356_10000141 3300010049 Bacteria 81679
107 Ga0466712_189837 3300042614 Bacteria 23751
108 Ga0466711_360474 3300042615 Bacteria 28164
109 Ga0466718_012825 3300042617 Bacteria 18566
110 Ga0466718_119244 3300042617 Bacteria 3012
111 Ga0466723_184835 3300042618 Bacteria 7572
112 Ga0466726_479828 3300042619 Bacteria 4768
113 Ga0466703_275172 3300042636 Bacteria 10100
114 Ga0466709_335917 3300042648 Bacteria 15035
115 Ga0466705_312810 3300042612 Bacteria 5788
116 Ga0466732_261144 3300042656 Bacteria 13344
117 JGI24695J34938_10012256 3300002450 Bacteria 4557
118 Ga0264413_119319 3300024493 Bacteria 3054
119 Ga0466690_188286 3300042590 Bacteria 9118
120 Ga0466692_111211 3300042591 Bacteria 6204
121 Ga0466694_036860 3300042594 Bacteria 17716
122 Ga0466694_308561 3300042594 Bacteria 4497
123 Ga0466716_122286 3300042605 Bacteria 3721
124 Ga0466720_019969 3300042607 Bacteria 45077
125 Ga0466720_029258 3300042607 Bacteria 50082
126 Ga0123353_10076817 3300010167 Bacteria 5366
127 Ga0466704_035006 3300042643 Bacteria 22236
128 Ga0466708_277272 3300042652 Bacteria 4136
129 Ga0466708_281390 3300042652 Bacteria 4140
130 AustNasuHG_c1007356 3300000089 Bacteria 3919
131 JGI24698J34947_10003690 3300002449 Bacteria 8328
132 JGI24698J34947_10031319 3300002449 Bacteria 2801
133 JGI24695J34938_10000329 3300002450 Bacteria 46693
134 JGI24695J34938_10002464 3300002450 Bacteria 14131
135 Ga0264413_120433 3300024493 Bacteria 11169
136 Ga0466692_190486 3300042591 Bacteria 17825
137 Ga0466693_124989 3300042592 Bacteria 4498
138 Ga0466694_403400 3300042594 Bacteria 17229
139 Ga0466699_019399 3300042597 Bacteria 7419
140 Ga0466699_024328 3300042597 Bacteria 3610
141 Ga0466699_094733 3300042597 Bacteria 4688
142 Ga0466700_434566 3300042600 Bacteria 4327
143 Ga0466720_018424 3300042607 Bacteria 27206
144 Ga0123356_10000577 3300010049 Bacteria 40782
145 Ga0466712_209850 3300042614 Bacteria 3869
146 Ga0466715_489021 3300042616 Bacteria 34263
147 Ga0466715_564102 3300042616 Bacteria 6750
148 Ga0466718_027395 3300042617 Bacteria 20192
149 Ga0466723_217442 3300042618 Bacteria 22009
150 Ga0466704_036773 3300042643 Bacteria 9285
151 Ga0466704_150438 3300042643 Bacteria 3750
152 JGI24695J34938_10000355 3300002450 Bacteria 45167
153 JGI24695J34938_10001120 3300002450 Bacteria 24156
154 JGI24695J34938_10001747 3300002450 Bacteria 17965
155 Ga0072941_1005601 3300005201 Bacteria 2879
156 Ga0072941_1068150 3300005201 Bacteria 7119
157 Ga0072941_1113944 3300005201 Bacteria 3221
158 Ga0264413_105545 3300024493 Bacteria 3973
159 Ga0264413_117170 3300024493 Bacteria 5358
160 Ga0415639_004309 3300038395 Bacteria 11639
161 Ga0466695_284277 3300042595 Bacteria 15337
162 Ga0466699_206662 3300042597 Bacteria 21346
163 Ga0466720_047144 3300042607 Bacteria 11062
164 Ga0466715_061652 3300042616 Bacteria 12808
165 Ga0466718_088224 3300042617 Bacteria 8537
166 Ga0466718_090789 3300042617 Bacteria 2858
167 Ga0466718_152189 3300042617 Bacteria 3827
168 Ga0466723_014267 3300042618 Bacteria 9006
169 Ga0466723_228239 3300042618 Bacteria 6224

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300005201 Ga0072941_1068151 Ga0072941_10681513 576
2 3300042612 Ga0466705_312810 Ga0466705_312810_540_2672 613
3 3300042636 Ga0466703_066655 Ga0466703_066655_1061_3163 618
4 3300042607 Ga0466720_056128 Ga0466720_056128_12776_14707 636
5 3300042607 Ga0466720_018424 Ga0466720_018424_19161_21095 644
6 3300002449 JGI24698J34947_10001254 JGI24698J34947_100012542 648
7 3300042605 Ga0466716_535524 Ga0466716_535524_531_2489 652
8 3300042652 Ga0466708_056098 Ga0466708_056098_12189_14357 669
9 3300042617 Ga0466718_089840 Ga0466718_089840_2127_4202 670
10 3300042597 Ga0466699_094733 Ga0466699_094733_2546_4645 672
11 3300005083 Ga0068305_10295989 Ga0068305_102959894 673
12 3300042597 Ga0466699_092365 Ga0466699_092365_2561_4660 673
13 3300042648 Ga0466709_335917 Ga0466709_335917_11811_14204 674
14 3300042656 Ga0466732_261144 Ga0466732_261144_4184_6325 674
15 3300002450 JGI24695J34938_10000923 JGI24695J34938_100009236 678
16 3300002450 JGI24695J34938_10001120 JGI24695J34938_100011205 678
17 3300024493 Ga0264413_120433 Ga0264413_1204332 678
18 3300042600 Ga0466700_434566 Ga0466700_434566_1338_3374 678
19 3300024493 Ga0264413_119479 Ga0264413_1194794 680
20 3300042591 Ga0466692_190486 Ga0466692_190486_8375_10495 680
21 3300042619 Ga0466726_479828 Ga0466726_479828_1865_4000 680
22 3300005200 Ga0072940_1009277 Ga0072940_10092775 681
23 iso_pr_bacteria 2781125657 2781323597 681
24 3300010049 Ga0123356_10000577 Ga0123356_1000057727 682
25 3300042607 Ga0466720_139259 Ga0466720_139259_897_3017 683
26 3300042616 Ga0466715_192820 Ga0466715_192820_3918_6002 683
27 3300042643 Ga0466704_286886 Ga0466704_286886_550_2619 683
28 3300042607 Ga0466720_053516 Ga0466720_053516_1484_3592 685
29 3300042607 Ga0466720_079671 Ga0466720_079671_1006_3066 686
30 3300042607 Ga0466720_185663 Ga0466720_185663_5297_7360 687
31 3300002449 JGI24698J34947_10000580 JGI24698J34947_100005806 688
32 3300024493 Ga0264413_101025 Ga0264413_1010256 688
33 3300042607 Ga0466720_074924 Ga0466720_074924_11200_13314 689
34 3300002449 JGI24698J34947_10015982 JGI24698J34947_100159822 690
35 3300002450 JGI24695J34938_10003492 JGI24695J34938_100034928 690
36 3300005201 Ga0072941_1003349 Ga0072941_100334910 690
37 3300042594 Ga0466694_036860 Ga0466694_036860_7036_9108 690
38 3300042597 Ga0466699_093121 Ga0466699_093121_7510_9582 690
39 3300042607 Ga0466720_110638 Ga0466720_110638_984_3086 690
40 3300042617 Ga0466718_088224 Ga0466718_088224_4159_6276 691
41 3300010167 Ga0123353_10076817 Ga0123353_100768173 692
42 3300038395 Ga0415639_048186 Ga0415639_048186_577_2655 692
43 iso_pr_bacteria 2781125693 2781433625 692
44 3300002449 JGI24698J34947_10022674 JGI24698J34947_100226743 693
45 3300002450 JGI24695J34938_10000420 JGI24695J34938_1000042032 693
46 3300002450 JGI24695J34938_10012256 JGI24695J34938_100122562 694
47 3300005201 Ga0072941_1005601 Ga0072941_10056012 694
48 3300005201 Ga0072941_1113944 Ga0072941_11139442 694
49 3300002450 JGI24695J34938_10000511 JGI24695J34938_1000051124 695
50 3300002449 JGI24698J34947_10013836 JGI24698J34947_100138363 696
51 3300042595 Ga0466695_284277 Ga0466695_284277_9322_11412 696
52 3300042597 Ga0466699_206662 Ga0466699_206662_16247_18337 696
53 3300042617 Ga0466718_147139 Ga0466718_147139_3234_5396 696
54 3300042607 Ga0466720_006827 Ga0466720_006827_1540_3804 697
55 3300042616 Ga0466715_489021 Ga0466715_489021_5694_7787 697
56 3300002449 JGI24698J34947_10012793 JGI24698J34947_100127932 698
57 3300042609 Ga0466722_175249 Ga0466722_175249_52320_54416 698
58 3300042614 Ga0466712_038130 Ga0466712_038130_15881_18031 698
59 3300042656 Ga0466732_079215 Ga0466732_079215_13848_15944 698
60 3300042590 Ga0466690_188286 Ga0466690_188286_1713_3878 699
61 iso_pr_bacteria 2781125665 2781341121 699
62 3300010049 Ga0123356_10000141 Ga0123356_1000014113 700
63 3300042614 Ga0466712_132560 Ga0466712_132560_213_2315 700
64 3300042596 Ga0466696_198548 Ga0466696_198548_3651_5756 701
65 3300042615 Ga0466711_360474 Ga0466711_360474_995_3145 701
66 3300042607 Ga0466720_029258 Ga0466720_029258_39033_41168 702
67 3300042614 Ga0466712_209850 Ga0466712_209850_1645_3804 702
68 3300000089 AustNasuHG_c1001258 AustNasuHG_10012585 703
69 3300002449 JGI24698J34947_10003690 JGI24698J34947_100036905 703
70 3300005200 Ga0072940_1018448 Ga0072940_10184485 703
71 3300042594 Ga0466694_403400 Ga0466694_403400_6021_8195 703
72 3300042607 Ga0466720_005383 Ga0466720_005383_1028_3139 703
73 3300042607 Ga0466720_123820 Ga0466720_123820_888_2999 703
74 3300042618 Ga0466723_014267 Ga0466723_014267_2927_5092 703
75 iso_pr_bacteria 2819992462 2819994128 703
76 iso_pr_bacteria 2820020240 2820021108 703
77 3300024493 Ga0264413_117170 Ga0264413_1171702 704
78 3300042594 Ga0466694_308561 Ga0466694_308561_551_2665 704
79 3300042597 Ga0466699_112043 Ga0466699_112043_1507_3660 704
80 3300042606 Ga0466719_204086 Ga0466719_204086_4449_6563 704
81 3300042607 Ga0466720_047144 Ga0466720_047144_3319_5433 704
82 3300042607 Ga0466720_178452 Ga0466720_178452_35914_38028 704
83 3300042617 Ga0466718_152189 Ga0466718_152189_919_3033 704
84 iso_pr_bacteria 2781125632 2781269469 704
85 3300002450 JGI24695J34938_10002464 JGI24695J34938_1000246413 705
86 3300010049 Ga0123356_10000443 Ga0123356_100004435 705
87 3300042612 Ga0466705_095885 Ga0466705_095885_3196_5313 705
88 3300042643 Ga0466704_035006 Ga0466704_035006_5443_7605 705
89 3300042643 Ga0466704_036773 Ga0466704_036773_2465_4582 705
90 3300002450 JGI24695J34938_10000355 JGI24695J34938_100003551 706
91 3300042593 Ga0466691_147874 Ga0466691_147874_15174_17294 706
92 3300042594 Ga0466694_315239 Ga0466694_315239_1589_3709 706
93 3300042636 Ga0466703_084812 Ga0466703_084812_1310_3472 706
94 iso_pr_bacteria 2772190975 2773723022 706
95 3300042593 Ga0466691_031804 Ga0466691_031804_1637_3760 707
96 3300042597 Ga0466699_024328 Ga0466699_024328_498_2642 707
97 3300042617 Ga0466718_012825 Ga0466718_012825_14675_16825 707
98 3300002450 JGI24695J34938_10004644 JGI24695J34938_100046447 708
99 3300042594 Ga0466694_372355 Ga0466694_372355_14627_16753 708
100 3300042607 Ga0466720_115436 Ga0466720_115436_5658_7865 708
101 3300042607 Ga0466720_185753 Ga0466720_185753_1440_3599 708
102 3300042614 Ga0466712_307482 Ga0466712_307482_279_2405 708
103 3300000089 AustNasuHG_c1000686 AustNasuHG_100068611 709
104 3300042590 Ga0466690_031343 Ga0466690_031343_274_2445 709
105 3300042615 Ga0466711_265200 Ga0466711_265200_4109_6274 709
106 3300042618 Ga0466723_228239 Ga0466723_228239_1191_3320 709
107 3300002450 JGI24695J34938_10001747 JGI24695J34938_1000174718 710
108 3300038395 Ga0415639_004309 Ga0415639_004309_8558_10690 710
109 3300042607 Ga0466720_019969 Ga0466720_019969_38871_41036 710
110 3300042614 Ga0466712_189837 Ga0466712_189837_13229_15400 710
111 3300042616 Ga0466715_157094 Ga0466715_157094_1612_3801 710
112 3300042616 Ga0466715_564102 Ga0466715_564102_4526_6697 710
113 3300042617 Ga0466718_126108 Ga0466718_126108_3971_6103 710
114 3300042656 Ga0466732_402812 Ga0466732_402812_108_2276 710
115 3300002449 JGI24698J34947_10002414 JGI24698J34947_100024141 711
116 3300010049 Ga0123356_10003358 Ga0123356_100033583 711
117 3300042597 Ga0466699_025250 Ga0466699_025250_3883_6018 711
118 iso_pr_bacteria 2781125695 2781438944 711
119 3300002450 JGI24695J34938_10000232 JGI24695J34938_1000023240 712
120 3300002462 JGI24702J35022_10012568 JGI24702J35022_100125683 712
121 3300010049 Ga0123356_10001789 Ga0123356_100017899 712
122 3300024493 Ga0264413_119319 Ga0264413_1193192 712
123 3300042592 Ga0466693_292731 Ga0466693_292731_4596_6734 712
124 3300042597 Ga0466699_109702 Ga0466699_109702_3016_5154 712
125 3300042597 Ga0466699_122260 Ga0466699_122260_980_3118 712
126 3300042617 Ga0466718_027395 Ga0466718_027395_16329_18467 712
127 3300042643 Ga0466704_150438 Ga0466704_150438_1451_3592 713
128 iso_pr_bacteria 2781125643 2781294169 713
129 3300042597 Ga0466699_019399 Ga0466699_019399_4782_6926 714
130 3300042597 Ga0466699_157063 Ga0466699_157063_3332_5476 714
131 3300042607 Ga0466720_113294 Ga0466720_113294_2918_5137 714
132 3300005201 Ga0072941_1068150 Ga0072941_10681503 715
133 3300042592 Ga0466693_215613 Ga0466693_215613_8842_10989 715
134 3300042607 Ga0466720_119607 Ga0466720_119607_897_3044 715
135 3300042636 Ga0466703_273006 Ga0466703_273006_1137_3284 715
136 3300024493 Ga0264413_117929 Ga0264413_1179295 716
137 3300042648 Ga0466709_315748 Ga0466709_315748_4615_6765 716
138 iso_pr_bacteria 2781125692 2781430906 716
139 3300000089 AustNasuHG_c1007356 AustNasuHG_10073564 717
140 3300002449 JGI24698J34947_10031319 JGI24698J34947_100313192 717
141 3300042591 Ga0466692_013239 Ga0466692_013239_4483_6636 717
142 3300042594 Ga0466694_123440 Ga0466694_123440_14289_16442 717
143 3300042609 Ga0466722_060842 Ga0466722_060842_18502_20655 717
144 3300042656 Ga0466732_174943 Ga0466732_174943_20_2173 717
145 3300005200 Ga0072940_1007651 Ga0072940_10076515 718
146 3300024493 Ga0264413_105545 Ga0264413_1055453 718
147 3300002450 JGI24695J34938_10000348 JGI24695J34938_1000034813 719
148 3300042612 Ga0466705_076390 Ga0466705_076390_5293_7452 719
149 3300042652 Ga0466708_277272 Ga0466708_277272_1243_3429 719
150 iso_pr_bacteria 2781125633 2781272376 719
151 3300000089 AustNasuHG_c1000119 AustNasuHG_100011915 720
152 3300005201 Ga0072941_1003381 Ga0072941_10033813 720
153 3300042616 Ga0466715_061652 Ga0466715_061652_10110_12317 720
154 3300042616 Ga0466715_089298 Ga0466715_089298_7243_9408 721
155 3300042620 Ga0466728_319709 Ga0466728_319709_6046_8211 721
156 3300042643 Ga0466704_417993 Ga0466704_417993_9906_12071 721
157 3300002450 JGI24695J34938_10000329 JGI24695J34938_1000032923 722
158 3300024493 Ga0264413_102996 Ga0264413_1029963 722
159 3300042605 Ga0466716_122286 Ga0466716_122286_1052_3220 722
160 3300042616 Ga0466715_464176 Ga0466715_464176_3652_5820 722
161 3300042617 Ga0466718_090789 Ga0466718_090789_505_2673 722
162 3300042617 Ga0466718_050521 Ga0466718_050521_462_2636 724
163 3300042617 Ga0466718_050834 Ga0466718_050834_597_2771 724
164 3300042617 Ga0466718_119244 Ga0466718_119244_178_2352 724
165 3300005201 Ga0072941_1057332 Ga0072941_10573323 725
166 3300042607 Ga0466720_022808 Ga0466720_022808_33001_35178 725
167 3300042618 Ga0466723_217442 Ga0466723_217442_12789_14966 725
168 3300042652 Ga0466708_281390 Ga0466708_281390_1813_4023 725
169 iso_pr_bacteria 2781125685 2781417728 725
170 3300042618 Ga0466723_184835 Ga0466723_184835_4832_7012 726
171 iso_pr_bacteria 2781125658 2781325806 726
172 3300009826 Ga0123355_10085902 Ga0123355_100859023 727
173 3300042593 Ga0466691_057666 Ga0466691_057666_1330_3513 727
174 3300042596 Ga0466696_159501 Ga0466696_159501_1874_4063 729
175 3300042609 Ga0466722_084381 Ga0466722_084381_7958_10147 729
176 3300042656 Ga0466732_444035 Ga0466732_444035_1273_3462 729
177 iso_pr_bacteria 2781125650 2781308367 730
178 3300042602 Ga0466713_020473 Ga0466713_020473_949_3273 731
179 3300042636 Ga0466703_275172 Ga0466703_275172_1294_3492 732
180 3300042591 Ga0466692_111211 Ga0466692_111211_1298_3538 733
181 3300042591 Ga0466692_163898 Ga0466692_163898_14557_16818 753
182 3300042592 Ga0466693_124989 Ga0466693_124989_146_2407 753
183 3300002450 JGI24695J34938_10006770 JGI24695J34938_100067702 762

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF20256 MoCoBD_2 Molybdopterin cofactor-binding domain 616 696 0.95
PF02738 MoCoBD_1 Molybdopterin cofactor-binding domain 196 395 0.9
PF01315 Ald_Xan_dh_C Aldehyde oxidase and xanthine dehydrogenase, a/b hammerhead domain 5 80 0.89

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02738 GO:0016491 oxidoreductase activity MF

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
3hrd-assembly1.cif.gz_E Crystal structure of nicotinate dehydrogenase 0.907 4 426
8j79-assembly1.cif.gz_B Bovine Xanthine Oxidoreductase Crystallized with oxypurinol 0.851 2 733
3unc-assembly1.cif.gz_A Crystal Structure of Bovine Milk Xanthine Dehydrogenase to 1.65A Resolution 0.851 4 733
8j79-assembly1.cif.gz_A Bovine Xanthine Oxidoreductase Crystallized with oxypurinol 0.849 5 733
2ckj-assembly2.cif.gz_B-3 Human milk xanthine oxidoreductase 0.848 2 734
IDDescriptionScoreStartEndSuperfamily
3hrdF01 Alpha Beta;2-Layer Sandwich;Aldehyde Oxidoreductase; domain 4;Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding domain 0.9203 614 753 3.30.365.10
1t3qB04 Alpha Beta;2-Layer Sandwich;Aldehyde Oxidoreductase; domain 4;Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding domain 0.914 614 752 3.30.365.10
1fo4A07 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Aldehyde oxidase/xanthine dehydrogenase, a/b hammerhead 0.8965 5 102 3.90.1170.50
3hrdE02 Alpha Beta;2-Layer Sandwich;Aldehyde Oxidoreductase; domain 4;Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding domain 0.8921 284 426 3.30.365.10
4zohA04 Alpha Beta;2-Layer Sandwich;Aldehyde Oxidoreductase; domain 4;Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding domain 0.8874 614 747 3.30.365.10
IDDescriptionScoreStartEndGO Terms
AF-F5YHU8-F1-model_v4 Uncharacterized/unreviewed 0.9551 2 756 GO:0005506
GO:0016491
AF-A0A7W0QNE6-F1-model_v4 Uncharacterized/unreviewed 0.9414 4 396

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.89 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.