Protein Family IF00635

Metagenome Metatranscriptome Isolate
143 Members
57 Samples
128 Scaffolds
573.34 Avg Length

🧬 Representative Sequence

ID
3300002450|JGI24695J34938_10006488|JGI24695J34938_100064886
Length
673 aa
Sequence
MMRKRYRFAIILAVLAVCFVFLWPSLRWHFFTPMEQQARAMQSREQLRNSAMLRAESDFQRLLEGPAPTEAFLEEALAQAREEAVGLQGLADLARMDGWGLLAGPLAAALPRLEELAGEEPGASAASNLQRILEMAREGGAAADGAAFAAXXVXXXEXLQARRLNRDNRRPNPARWDARAALAAFPTPLAVRDAIENRYRDDVFSLRSMQRRAVQLGLDLSGGLSIVLQADMDALQERLDRPLTDADRDDAMERALIDLNSRIDQFGLTEPVIRRQGPDQIYVEIPGSADPERINDIIMGRGSLTFHIVDEDATAAFNAFYGAHGHFATFDGLGNLRDPMLVPPDVVIRGVYEQDRFGLNVPVYWDRDRGLRRYVAVRREVGLDGYHIRSALVERDQFGRPEVIFNMTGEGGELFWNLTSANVQRPMAIVLDDRVRSYPTIQTAIRDRVRLTGFGMDEANGIAMMLRTAGLPVTLEVASQQSIGASMGEDTIRQGLFALLGGVAMVLVFMLLFYKSAGINAVVAQLLNFYIMFSVLSAFSFTLTLPSIAGFILTIGMATDANVIVFERIKEELRLGKSRKAAIEIGFDKAFWAVMDSNVTTFIAALFLAQLGSGPIQGFAVALSVGVFSSVFTALFVSRLIFDFGTEVLRSRTIPITWAKQRVAGAAVGGTR*

📊 Sample Types

Isolate 10.5%
Metagenome 88.8%
MAG 0.0%
Metatranscriptome 0.7%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 35.7%
Unclassified 28.6%
Kalotermitidae 25.0%
Rhinotermitidae 3.6%
Termopsidae 3.6%
Hodotermitidae 1.8%
Blaberidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 136
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
2 2781125682 Treponema sp. Lab288P1bin107 Isolate Unclassified
3 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
4 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
5 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
6 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
7 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
8 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
9 2781125681 Treponema sp. Lab288P1bin11 Isolate Unclassified
10 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
11 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
12 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
13 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
14 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
15 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
16 2820023741 Unclassified Spirochaetes Lab288P3bin165 Isolate Unclassified
17 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
18 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
19 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
20 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
21 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
22 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
23 2820027804 Unclassified Spirochaetes Lab288P1bin105 Isolate Unclassified
24 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
25 2781125683 Treponema sp. Lab288P1bin34 Isolate Unclassified
26 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
27 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
28 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
29 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
30 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
31 3300021190 Termite gut microbial communities from nest - French Guiana - 1_3 mRNA 1_3 mRNA SA Metatranscriptome Termitidae
32 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
33 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
34 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
35 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
36 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
37 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
38 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
39 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
40 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
41 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
42 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
43 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
44 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
45 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
46 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
47 2772190975 Treponema sp. RmG30 Isolate Blaberidae
48 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
49 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
50 2819990093 Unclassified Spirochaetes Cu122P1bin9 Isolate Unclassified
51 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
52 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
53 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
54 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
55 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
56 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
57 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_298927 3300042612 Bacteria 1891
2 Ga0466733_149102 3300042659 Bacteria 23474
3 Ga0466692_012972 3300042591 Bacteria 16690
4 Ga0466712_211647 3300042614 Unclassified 14390
5 Ga0466715_559985 3300042616 Bacteria 52926
6 Ga0123355_10001318 3300009826 Bacteria 34590
7 Ga0123356_10044796 3300010049 Bacteria 4118
8 Ga0466716_016485 3300042605 Bacteria 14263
9 Ga0466720_036535 3300042607 Bacteria 14362
10 Ga0466702_420796 3300042635 Bacteria 21022
11 Ga0466703_405388 3300042636 Bacteria 4504
12 Ga0466708_220067 3300042652 Bacteria 8647
13 Ga0466708_278401 3300042652 Bacteria 6399
14 Ga0466727_169724 3300042655 Bacteria 3613
15 JGI24698J34947_10001700 3300002449 Bacteria 11766
16 JGI24695J34938_10001037 3300002450 Bacteria 25193
17 JGI24695J34938_10002708 3300002450 Bacteria 13124
18 JGI24695J34938_10002933 3300002450 Bacteria 12346
19 JGI24702J35022_10003896 3300002462 Bacteria 8949
20 Ga0466732_406740 3300042656 Bacteria 29581
21 Ga0466733_077577 3300042659 Bacteria 14399
22 Ga0466733_185067 3300042659 Bacteria 39045
23 Ga0466690_326911 3300042590 Bacteria 3076
24 Ga0466712_187162 3300042614 Bacteria 11305
25 Ga0466715_125046 3300042616 Bacteria 8504
26 Ga0466718_002149 3300042617 Bacteria 22367
27 Ga0466728_198021 3300042620 Bacteria 5208
28 Ga0123356_10001795 3300010049 Bacteria 23388
29 Ga0123356_10003270 3300010049 Bacteria 17019
30 Ga0466707_235445 3300042601 Bacteria 3201
31 Ga0466716_002220 3300042605 Bacteria 3468
32 Ga0466702_063384 3300042635 Bacteria 12465
33 Ga0466708_139336 3300042652 Bacteria 48639
34 JGI24698J34947_10000800 3300002449 Bacteria 15625
35 JGI24695J34938_10001894 3300002450 Bacteria 16947
36 JGI24695J34938_10032902 3300002450 Bacteria 2391
37 Ga0415639_105323 3300038395 Bacteria 7975
38 Ga0415639_122067 3300038395 Bacteria 3916
39 Ga0466712_023524 3300042614 Bacteria 21459
40 Ga0466715_096782 3300042616 Bacteria 4172
41 Ga0466715_181913 3300042616 Bacteria 3537
42 Ga0466723_082665 3300042618 Bacteria 17262
43 Ga0466726_207342 3300042619 Bacteria 9281
44 Ga0466720_082406 3300042607 Bacteria 20211
45 Ga0466720_086464 3300042607 Bacteria 3795
46 Ga0466721_040497 3300042608 Bacteria 19632
47 Ga0466702_023988 3300042635 Bacteria 3071
48 JGI24698J34947_10020487 3300002449 Unclassified 3560
49 JGI24695J34938_10006488 3300002450 Bacteria 7006
50 JGI24695J34938_10023889 3300002450 Bacteria 2941
51 Ga0415639_005821 3300038395 Bacteria 15199
52 Ga0466694_131918 3300042594 Bacteria 11046
53 Ga0466696_023207 3300042596 Bacteria 24784
54 Ga0466699_043250 3300042597 Bacteria 3427
55 Ga0466712_011973 3300042614 Bacteria 32677
56 Ga0466726_190232 3300042619 Bacteria 7380
57 Ga0466726_200448 3300042619 Bacteria 6168
58 Ga0123356_10001913 3300010049 Bacteria 22561
59 Ga0123356_10002534 3300010049 Bacteria 19531
60 Ga0466706_182139 3300042599 Bacteria 2903
61 Ga0466709_296303 3300042648 Bacteria 26634
62 Ga0466708_007744 3300042652 Unclassified 10088
63 Ga0466708_275714 3300042652 Bacteria 3303
64 Ga0072940_1038177 3300005200 Bacteria 5457
65 Ga0466705_344359 3300042612 Bacteria 6746
66 Ga0222431_1006117 3300021190 Bacteria 2765
67 Ga0466692_028541 3300042591 Bacteria 8100
68 Ga0466694_310596 3300042594 Bacteria 2251
69 Ga0466712_220004 3300042614 Unclassified 7037
70 Ga0466715_080210 3300042616 Bacteria 95686
71 Ga0466715_157756 3300042616 Bacteria 4599
72 Ga0466718_028728 3300042617 Bacteria 11087
73 Ga0466723_314973 3300042618 Bacteria 5859
74 Ga0466726_424060 3300042619 Bacteria 10051
75 Ga0123357_10042010 3300009784 Bacteria 6219
76 Ga0123356_10001145 3300010049 Bacteria 29294
77 Ga0466719_074977 3300042606 Bacteria 14500
78 Ga0466702_399345 3300042635 Bacteria 2904
79 Ga0466704_129449 3300042643 Bacteria 13011
80 Ga0466708_296978 3300042652 Bacteria 13251
81 JGI24695J34938_10002323 3300002450 Bacteria 14643
82 JGI24695J34938_10005175 3300002450 Bacteria 8240
83 JGI24695J34938_10009137 3300002450 Bacteria 5543
84 JGI24695J34938_10015971 3300002450 Bacteria 3834
85 JGI24695J34938_10025677 3300002450 Unclassified 2812
86 Ga0072941_1004367 3300005201 Bacteria 32939
87 Ga0072941_1053560 3300005201 Bacteria 8156
88 Ga0466705_094903 3300042612 Bacteria 13125
89 Ga0466691_123216 3300042593 Bacteria 3408
90 Ga0466711_294107 3300042615 Bacteria 20081
91 Ga0466715_378175 3300042616 Bacteria 8771
92 Ga0466718_048448 3300042617 Bacteria 5710
93 Ga0466726_235190 3300042619 Bacteria 2619
94 Ga0123357_10045724 3300009784 Bacteria 5938
95 Ga0123353_10129165 3300010167 Bacteria 4057
96 Ga0466722_107919 3300042609 Bacteria 31771
97 Ga0466708_198827 3300042652 Bacteria 20273
98 JGI24698J34947_10036300 3300002449 Bacteria 2567
99 JGI24695J34938_10000274 3300002450 Bacteria 50501
100 JGI24695J34938_10007357 3300002450 Unclassified 6457
101 Ga0068305_10008967 3300005083 Bacteria 22100
102 Ga0466690_426264 3300042590 Bacteria 3091
103 Ga0466691_209197 3300042593 Bacteria 3304
104 Ga0466694_220692 3300042594 Bacteria 5009
105 Ga0466712_057732 3300042614 Bacteria 25744
106 Ga0466723_056949 3300042618 Bacteria 7702
107 Ga0466723_264949 3300042618 Bacteria 8516
108 Ga0123356_10000123 3300010049 Bacteria 85175
109 Ga0123353_10002835 3300010167 Bacteria 21675
110 Ga0123353_10010662 3300010167 Bacteria 12843
111 Ga0123353_10066483 3300010167 Bacteria 5786
112 Ga0123353_10116425 3300010167 Bacteria 4301
113 Ga0466704_198177 3300042643 Bacteria 51282
114 Ga0466709_195814 3300042648 Unclassified 2973
115 Ga0466709_205317 3300042648 Bacteria 10596
116 Ga0466705_040381 3300042612 Bacteria 16401
117 Ga0466732_317009 3300042656 Bacteria 7996
118 Ga0466726_136220 3300042619 Bacteria 6399
119 Ga0466726_396881 3300042619 Bacteria 10428
120 Ga0466707_132070 3300042601 Bacteria 5212
121 Ga0466720_038676 3300042607 Bacteria 20239
122 Ga0466722_009808 3300042609 Bacteria 7327
123 Ga0466703_112152 3300042636 Bacteria 9417
124 Ga0466727_342607 3300042655 Bacteria 7416
125 AustNasuHG_c1001085 3300000089 Bacteria 9765
126 JGI24695J34938_10000080 3300002450 Bacteria 82616
127 JGI24702J35022_10000918 3300002462 Bacteria 18353
128 Ga0068305_10009630 3300005083 Bacteria 8838

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300005201 Ga0072941_1004367 Ga0072941_100436719 479
2 3300042618 Ga0466723_314973 Ga0466723_314973_4154_5818 512
3 3300042616 Ga0466715_181913 Ga0466715_181913_1166_2833 521
4 3300042614 Ga0466712_011973 Ga0466712_011973_16197_17783 528
5 3300010167 Ga0123353_10002835 Ga0123353_1000283520 538
6 3300010167 Ga0123353_10010662 Ga0123353_1001066213 538
7 3300010167 Ga0123353_10116425 Ga0123353_101164252 538
8 3300042590 Ga0466690_326911 Ga0466690_326911_245_1879 538
9 3300042596 Ga0466696_023207 Ga0466696_023207_10511_12145 538
10 3300042652 Ga0466708_220067 Ga0466708_220067_1472_3190 539
11 3300042659 Ga0466733_077577 Ga0466733_077577_7392_9029 540
12 3300042620 Ga0466728_198021 Ga0466728_198021_704_2461 543
13 3300042652 Ga0466708_275714 Ga0466708_275714_263_1951 544
14 3300042601 Ga0466707_235445 Ga0466707_235445_185_1927 551
15 3300042619 Ga0466726_207342 Ga0466726_207342_5940_7667 551
16 3300042655 Ga0466727_342607 Ga0466727_342607_5408_7132 551
17 3300042597 Ga0466699_043250 Ga0466699_043250_337_2112 552
18 3300042616 Ga0466715_080210 Ga0466715_080210_13976_15700 552
19 3300042643 Ga0466704_129449 Ga0466704_129449_807_2564 553
20 3300042652 Ga0466708_007744 Ga0466708_007744_2721_4475 553
21 3300042617 Ga0466718_028728 Ga0466718_028728_3041_4816 554
22 3300009826 Ga0123355_10001318 Ga0123355_1000131822 555
23 3300042616 Ga0466715_559985 Ga0466715_559985_26266_27954 556
24 3300042617 Ga0466718_002149 Ga0466718_002149_14058_15809 556
25 3300042607 Ga0466720_086464 Ga0466720_086464_1125_2900 557
26 3300042616 Ga0466715_096782 Ga0466715_096782_1914_3644 557
27 3300000089 AustNasuHG_c1001085 AustNasuHG_10010858 558
28 3300002450 JGI24695J34938_10002323 JGI24695J34938_100023237 559
29 3300042607 Ga0466720_082406 Ga0466720_082406_15163_16938 559
30 3300042612 Ga0466705_094903 Ga0466705_094903_9472_11169 559
31 3300042616 Ga0466715_125046 Ga0466715_125046_3465_5195 559
32 3300042614 Ga0466712_211647 Ga0466712_211647_3625_5418 560
33 3300042617 Ga0466718_048448 Ga0466718_048448_3390_5165 560
34 3300002462 JGI24702J35022_10003896 JGI24702J35022_100038964 561
35 3300042656 Ga0466732_317009 Ga0466732_317009_3766_5541 561
36 3300042648 Ga0466709_195814 Ga0466709_195814_576_2333 562
37 3300042609 Ga0466722_009808 Ga0466722_009808_5469_7250 565
38 3300042615 Ga0466711_294107 Ga0466711_294107_1350_3074 566
39 3300042616 Ga0466715_157756 Ga0466715_157756_1160_2914 566
40 3300042618 Ga0466723_264949 Ga0466723_264949_1854_3608 566
41 3300042635 Ga0466702_063384 Ga0466702_063384_7362_9122 566
42 3300042593 Ga0466691_209197 Ga0466691_209197_542_2266 567
43 3300042636 Ga0466703_405388 Ga0466703_405388_1372_3129 567
44 3300042648 Ga0466709_296303 Ga0466709_296303_15573_17276 567
45 3300042656 Ga0466732_406740 Ga0466732_406740_3056_4834 567
46 3300042606 Ga0466719_074977 Ga0466719_074977_5776_7500 568
47 3300042612 Ga0466705_040381 Ga0466705_040381_3048_4772 568
48 3300042619 Ga0466726_424060 Ga0466726_424060_4108_5832 568
49 3300042636 Ga0466703_112152 Ga0466703_112152_7012_8736 568
50 3300042643 Ga0466704_198177 Ga0466704_198177_24177_25901 568
51 3300042655 Ga0466727_169724 Ga0466727_169724_1524_3248 568
52 3300042659 Ga0466733_149102 Ga0466733_149102_5586_7310 568
53 3300042601 Ga0466707_132070 Ga0466707_132070_1598_3328 570
54 3300042616 Ga0466715_378175 Ga0466715_378175_2362_4095 571
55 3300042618 Ga0466723_082665 Ga0466723_082665_9629_11362 571
56 3300042614 Ga0466712_187162 Ga0466712_187162_8433_10190 572
57 3300042614 Ga0466712_220004 Ga0466712_220004_423_2180 572
58 3300002449 JGI24698J34947_10000800 JGI24698J34947_1000080012 573
59 3300002449 JGI24698J34947_10036300 JGI24698J34947_100363002 573
60 3300002450 JGI24695J34938_10002708 JGI24695J34938_100027083 573
61 3300042594 Ga0466694_310596 Ga0466694_310596_176_1930 573
62 3300042619 Ga0466726_190232 Ga0466726_190232_3462_5183 573
63 3300042619 Ga0466726_396881 Ga0466726_396881_3369_5108 573
64 3300042648 Ga0466709_205317 Ga0466709_205317_4821_6542 573
65 3300042652 Ga0466708_278401 Ga0466708_278401_4311_6032 573
66 3300042593 Ga0466691_123216 Ga0466691_123216_444_2168 574
67 3300042605 Ga0466716_002220 Ga0466716_002220_1612_3336 574
68 3300042612 Ga0466705_298927 Ga0466705_298927_80_1822 574
69 3300042619 Ga0466726_200448 Ga0466726_200448_2152_3876 574
70 3300042652 Ga0466708_139336 Ga0466708_139336_40452_42176 574
71 3300042605 Ga0466716_016485 Ga0466716_016485_540_2285 575
72 3300042614 Ga0466712_023524 Ga0466712_023524_17839_19566 575
73 3300042619 Ga0466726_136220 Ga0466726_136220_2308_4035 575
74 3300042652 Ga0466708_198827 Ga0466708_198827_5165_6910 575
75 3300042659 Ga0466733_185067 Ga0466733_185067_4230_5957 575
76 iso_pr_bacteria 2772190975 2773723832 575
77 3300042652 Ga0466708_296978 Ga0466708_296978_9195_10925 576
78 iso_pr_bacteria 2820023741 2820024620 576
79 iso_pr_bacteria 2820027804 2820028566 576
80 3300002450 JGI24695J34938_10002933 JGI24695J34938_100029339 577
81 3300002450 JGI24695J34938_10005175 JGI24695J34938_100051757 577
82 3300042612 Ga0466705_344359 Ga0466705_344359_2660_4393 577
83 iso_pr_bacteria 2819990093 2819991758 577
84 3300002450 JGI24695J34938_10001037 JGI24695J34938_1000103723 578
85 3300005083 Ga0068305_10009630 Ga0068305_1000963010 578
86 3300010049 Ga0123356_10002534 Ga0123356_1000253410 579
87 3300042590 Ga0466690_426264 Ga0466690_426264_193_1932 579
88 3300042618 Ga0466723_056949 Ga0466723_056949_146_1885 579
89 3300042594 Ga0466694_220692 Ga0466694_220692_1482_3224 580
90 3300002450 JGI24695J34938_10001894 JGI24695J34938_1000189413 581
91 3300002450 JGI24695J34938_10032902 JGI24695J34938_100329022 581
92 3300009784 Ga0123357_10045724 Ga0123357_100457243 581
93 3300038395 Ga0415639_122067 Ga0415639_122067_506_2296 581
94 3300042591 Ga0466692_028541 Ga0466692_028541_4420_6201 581
95 3300042607 Ga0466720_036535 Ga0466720_036535_9394_11139 581
96 3300042607 Ga0466720_038676 Ga0466720_038676_6524_8269 581
97 iso_pr_bacteria 2781125695 2781438040 581
98 3300010049 Ga0123356_10001145 Ga0123356_100011453 582
99 3300010167 Ga0123353_10066483 Ga0123353_100664832 582
100 3300042594 Ga0466694_131918 Ga0466694_131918_6697_8481 582
101 3300002450 JGI24695J34938_10023889 JGI24695J34938_100238892 583
102 3300010049 Ga0123356_10001913 Ga0123356_1000191318 583
103 3300010167 Ga0123353_10129165 Ga0123353_101291653 583
104 3300042619 Ga0466726_235190 Ga0466726_235190_739_2508 583
105 3300005083 Ga0068305_10008967 Ga0068305_100089672 584
106 3300005201 Ga0072941_1053560 Ga0072941_10535606 584
107 3300042614 Ga0466712_057732 Ga0466712_057732_14584_16356 584
108 3300042635 Ga0466702_399345 Ga0466702_399345_536_2290 584
109 3300002449 JGI24698J34947_10020487 JGI24698J34947_100204872 585
110 3300002450 JGI24695J34938_10025677 JGI24695J34938_100256773 585
111 3300002462 JGI24702J35022_10000918 JGI24702J35022_100009182 585
112 3300038395 Ga0415639_105323 Ga0415639_105323_2201_3961 586
113 3300042591 Ga0466692_012972 Ga0466692_012972_1888_3669 587
114 iso_pr_bacteria 2781125643 2781293180 587
115 3300002450 JGI24695J34938_10000080 JGI24695J34938_1000008011 590
116 3300005200 Ga0072940_1038177 Ga0072940_10381772 591
117 3300042599 Ga0466706_182139 Ga0466706_182139_719_2524 591
118 3300042635 Ga0466702_420796 Ga0466702_420796_9893_11668 591
119 iso_pr_bacteria 2781125655 2781317382 591
120 3300002449 JGI24698J34947_10001700 JGI24698J34947_100017006 592
121 3300009784 Ga0123357_10042010 Ga0123357_100420105 592
122 iso_pr_bacteria 2781125681 2781407874 592
123 3300038395 Ga0415639_005821 Ga0415639_005821_4609_6390 593
124 3300042609 Ga0466722_107919 Ga0466722_107919_27645_29426 593
125 iso_pr_bacteria 2781125644 2781295844 593
126 3300002450 JGI24695J34938_10000274 JGI24695J34938_1000027413 594
127 3300002450 JGI24695J34938_10007357 JGI24695J34938_100073573 594
128 3300042635 Ga0466702_023988 Ga0466702_023988_348_2132 594
129 iso_pr_bacteria 2781125683 2781411206 594
130 3300002450 JGI24695J34938_10015971 JGI24695J34938_100159711 595
131 3300010049 Ga0123356_10044796 Ga0123356_100447963 595
132 iso_pr_bacteria 2781125637 2781281894 595
133 iso_pr_bacteria 2781125649 2781306832 595
134 iso_pr_bacteria 2781125682 2781409355 597
135 3300042608 Ga0466721_040497 Ga0466721_040497_15643_17439 598
136 3300010049 Ga0123356_10001795 Ga0123356_1000179513 599
137 iso_pr_bacteria 2781125659 2781327187 599
138 3300010049 Ga0123356_10003270 Ga0123356_100032704 601
139 iso_pr_bacteria 2781125657 2781322911 605
140 3300010049 Ga0123356_10000123 Ga0123356_1000012322 606
141 3300002450 JGI24695J34938_10009137 JGI24695J34938_100091373 608
142 3300021190 Ga0222431_1006117 Ga0222431_10061172 625
143 3300002450 JGI24695J34938_10006488 JGI24695J34938_100064886 673

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF21760 SecD_1st Protein translocase subunit SecDF, P1 domain, N-terminal 252 311 0.95
PF22599 SecDF_P1_head SecDF, P1 head subdomain 372 473 0.94
PF02355 SecD_SecF Protein export membrane protein 475 641 0.9
PF03176 MMPL MMPL family 471 635 0.81

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF03176 GO:0016020 membrane CC

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.7 0.71 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.