Protein Family IF00581
Metagenome
Isolate
126
Members
46
Samples
118
Scaffolds
285.67
Avg Length
Representative Sequence
- ID
- 3300002450|JGI24695J34938_10000081|JGI24695J34938_1000008142
- Length
- 307 aa
- Sequence
- MNAKQGAIPENQDTKKIILKQNDLTEKIKNYITEIPSLPVSANKVLEICGNINVNPSDLNKVISLDPVLTGKILQLINSAYYGLGTHIKSLVRAITMLGLNTVKNLVLSTAVLNILQKNKGKKGINIKGFWHHSLCVGVISKLLAVKQGVDPKDYEEYFTAGLLHDIGKIPLNAVLASDYVRLVNKSDEEHKTLYETENENLEINHCAAGGMIASAWKLDSSIIDVISYHHNACAYSGDNTAIVCNTAIANYFSVVNEVGFAGDRKPVKPEKKVWDTAGISEDIYPDVLDKLNNEIERARIFLQIS*
Sample Types
Isolate
6.3%
Metagenome
93.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
43.2%
Kalotermitidae
29.5%
Unclassified
20.5%
Termopsidae
4.5%
Rhinotermitidae
2.3%
Taxonomy
Archaea
0
Bacteria
122
Eukaryota
0
Viruses
1
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 2 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 3 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 4 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 5 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 6 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 7 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 8 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 9 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 10 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 11 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 12 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 13 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 14 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 15 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 16 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 17 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 18 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 19 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 20 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 21 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 22 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 23 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 24 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 25 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 26 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 27 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 28 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 29 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 30 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 31 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 32 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 33 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 34 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 35 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 36 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 37 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 38 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 39 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 40 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 41 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 42 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 43 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 44 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 45 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 46 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0415639_142615 | 3300038395 | Bacteria | 1161 |
| 2 | Ga0466696_386007 | 3300042596 | Bacteria | 2984 |
| 3 | Ga0123356_10004707 | 3300010049 | Bacteria | 14054 |
| 4 | AustNasuHG_c1006146 | 3300000089 | Bacteria | 4293 |
| 5 | JGI24698J34947_10016476 | 3300002449 | Bacteria | 4012 |
| 6 | Ga0466720_210192 | 3300042607 | Bacteria | 2254 |
| 7 | Ga0466721_126903 | 3300042608 | Bacteria | 1488 |
| 8 | Ga0466705_019655 | 3300042612 | Bacteria | 5747 |
| 9 | Ga0466712_109389 | 3300042614 | Bacteria | 3892 |
| 10 | Ga0466726_445256 | 3300042619 | Bacteria | 6746 |
| 11 | Ga0466703_011172 | 3300042636 | Bacteria | 6932 |
| 12 | Ga0466709_071710 | 3300042648 | Bacteria | 8781 |
| 13 | Ga0264413_105355 | 3300024493 | Bacteria | 10959 |
| 14 | Ga0264413_114651 | 3300024493 | Bacteria | 5023 |
| 15 | Ga0466690_097456 | 3300042590 | Bacteria | 9815 |
| 16 | Ga0466690_433560 | 3300042590 | Bacteria | 4297 |
| 17 | Ga0466691_026425 | 3300042593 | Bacteria | 17266 |
| 18 | Ga0123356_10408253 | 3300010049 | Bacteria | 1497 |
| 19 | AustNasuHG_c1000247 | 3300000089 | Bacteria | 18273 |
| 20 | JGI24698J34947_10012507 | 3300002449 | Bacteria | 4652 |
| 21 | JGI24698J34947_10019459 | 3300002449 | Unclassified | 3661 |
| 22 | JGI24698J34947_10030764 | 3300002449 | Bacteria | 2830 |
| 23 | Ga0072941_1002524 | 3300005201 | Bacteria | 35795 |
| 24 | Ga0466712_005190 | 3300042614 | Bacteria | 3881 |
| 25 | Ga0466728_473189 | 3300042620 | Bacteria | 3264 |
| 26 | Ga0466704_122341 | 3300042643 | Bacteria | 5770 |
| 27 | Ga0466704_310957 | 3300042643 | Bacteria | 7408 |
| 28 | Ga0466694_067158 | 3300042594 | Bacteria | 7290 |
| 29 | Ga0123356_10008813 | 3300010049 | Bacteria | 9994 |
| 30 | JGI24698J34947_10013692 | 3300002449 | Bacteria | 4420 |
| 31 | JGI24695J34938_10017060 | 3300002450 | Bacteria | 3670 |
| 32 | Ga0466719_162781 | 3300042606 | Bacteria | 7772 |
| 33 | Ga0466712_028790 | 3300042614 | Bacteria | 127971 |
| 34 | Ga0466711_517498 | 3300042615 | Bacteria | 14845 |
| 35 | Ga0466723_052478 | 3300042618 | Bacteria | 5861 |
| 36 | Ga0466704_097806 | 3300042643 | Bacteria | 12891 |
| 37 | Ga0466708_161621 | 3300042652 | Bacteria | 5606 |
| 38 | Ga0466727_153574 | 3300042655 | Bacteria | 1495 |
| 39 | Ga0466694_160678 | 3300042594 | Bacteria | 1985 |
| 40 | Ga0466699_040484 | 3300042597 | Bacteria | 9096 |
| 41 | Ga0466699_101428 | 3300042597 | Bacteria | 2441 |
| 42 | Ga0123356_10001645 | 3300010049 | Bacteria | 24536 |
| 43 | JGI24698J34947_10020641 | 3300002449 | Bacteria | 3546 |
| 44 | JGI24698J34947_10044458 | 3300002449 | Bacteria | 2273 |
| 45 | JGI24695J34938_10000052 | 3300002450 | Bacteria | 90676 |
| 46 | JGI24695J34938_10000827 | 3300002450 | Bacteria | 28780 |
| 47 | JGI24695J34938_10003656 | 3300002450 | Unclassified | 10546 |
| 48 | Ga0466707_294304 | 3300042601 | Bacteria | 1846 |
| 49 | Ga0466717_113733 | 3300042604 | Bacteria | 1980 |
| 50 | Ga0466720_083692 | 3300042607 | Bacteria | 1500 |
| 51 | Ga0466712_042362 | 3300042614 | Bacteria | 32694 |
| 52 | Ga0466731_318630 | 3300042622 | Bacteria | 2863 |
| 53 | Ga0466702_200073 | 3300042635 | Bacteria | 10606 |
| 54 | Ga0466703_103007 | 3300042636 | Bacteria | 3378 |
| 55 | Ga0466704_331491 | 3300042643 | Bacteria | 5626 |
| 56 | JGI24698J34947_10012921 | 3300002449 | Bacteria | 4563 |
| 57 | JGI24698J34947_10021905 | 3300002449 | Bacteria | 3431 |
| 58 | JGI24695J34938_10008240 | 3300002450 | Bacteria | 5968 |
| 59 | Ga0466719_269808 | 3300042606 | Bacteria | 1473 |
| 60 | Ga0466719_311337 | 3300042606 | Bacteria | 1584 |
| 61 | Ga0466712_046018 | 3300042614 | Bacteria | 3256 |
| 62 | Ga0466712_317354 | 3300042614 | Bacteria | 11761 |
| 63 | Ga0466723_134847 | 3300042618 | Bacteria | 5557 |
| 64 | Ga0466726_416431 | 3300042619 | Bacteria | 1333 |
| 65 | Ga0466729_010962 | 3300042621 | Bacteria | 2329 |
| 66 | Ga0466702_262605 | 3300042635 | Bacteria | 4117 |
| 67 | Ga0466704_201723 | 3300042643 | Bacteria | 8038 |
| 68 | Ga0466708_030557 | 3300042652 | Bacteria | 4895 |
| 69 | Ga0466727_325669 | 3300042655 | Bacteria | 4625 |
| 70 | Ga0415639_025745 | 3300038395 | Bacteria | 33738 |
| 71 | Ga0466694_188580 | 3300042594 | Bacteria | 10460 |
| 72 | Ga0466696_215137 | 3300042596 | Bacteria | 7493 |
| 73 | Ga0123356_10005241 | 3300010049 | Bacteria | 13235 |
| 74 | Ga0123356_10145466 | 3300010049 | Bacteria | 2344 |
| 75 | Ga0123356_10267222 | 3300010049 | Bacteria | 1798 |
| 76 | JGI24695J34938_10000899 | 3300002450 | Bacteria | 27480 |
| 77 | Ga0072941_1035832 | 3300005201 | Bacteria | 2713 |
| 78 | Ga0466700_190210 | 3300042600 | Bacteria | 14958 |
| 79 | Ga0466705_141900 | 3300042612 | Bacteria | 6377 |
| 80 | Ga0466712_215788 | 3300042614 | Unclassified | 1195 |
| 81 | Ga0466728_072978 | 3300042620 | Bacteria | 5311 |
| 82 | Ga0466731_146613 | 3300042622 | Bacteria | 26612 |
| 83 | Ga0466708_339182 | 3300042652 | Bacteria | 2900 |
| 84 | Ga0466693_385425 | 3300042592 | Bacteria | 15880 |
| 85 | Ga0466694_222263 | 3300042594 | Bacteria | 27991 |
| 86 | Ga0466699_304457 | 3300042597 | Bacteria | 1028 |
| 87 | Ga0123356_10616588 | 3300010049 | Bacteria | 1250 |
| 88 | JGI24698J34947_10007518 | 3300002449 | Bacteria | 5986 |
| 89 | JGI24698J34947_10019570 | 3300002449 | Bacteria | 3650 |
| 90 | JGI24695J34938_10000081 | 3300002450 | Bacteria | 82371 |
| 91 | JGI24695J34938_10001075 | 3300002450 | Bacteria | 24661 |
| 92 | Ga0072940_1018024 | 3300005200 | Bacteria | 25189 |
| 93 | Ga0466707_018940 | 3300042601 | Bacteria | 2240 |
| 94 | Ga0466716_051403 | 3300042605 | Bacteria | 21148 |
| 95 | Ga0466716_078304 | 3300042605 | Bacteria | 1808 |
| 96 | Ga0466712_313583 | 3300042614 | Bacteria | 3811 |
| 97 | Ga0466711_310201 | 3300042615 | Bacteria | 4101 |
| 98 | Ga0466729_236582 | 3300042621 | Bacteria | 4168 |
| 99 | Ga0466708_165285 | 3300042652 | Bacteria | 4827 |
| 100 | Ga0415639_056024 | 3300038395 | Bacteria | 14269 |
| 101 | Ga0466694_121632 | 3300042594 | Bacteria | 1306 |
| 102 | Ga0466696_175819 | 3300042596 | Bacteria | 19045 |
| 103 | Ga0123356_10001315 | 3300010049 | Bacteria | 27499 |
| 104 | Ga0123356_10010412 | 3300010049 | Bacteria | 9126 |
| 105 | Ga0123353_10271722 | 3300010167 | Bacteria | 2611 |
| 106 | JGI24698J34947_10039450 | 3300002449 | Bacteria | 2444 |
| 107 | JGI24695J34938_10000780 | 3300002450 | Bacteria | 29857 |
| 108 | JGI24695J34938_10002120 | 3300002450 | Bacteria | 15524 |
| 109 | Ga0466698_516759 | 3300042610 | Bacteria | 1788 |
| 110 | Ga0466705_053400 | 3300042612 | Bacteria | 2026 |
| 111 | Ga0466705_172654 | 3300042612 | Bacteria | 2205 |
| 112 | Ga0466705_374346 | 3300042612 | Bacteria | 15648 |
| 113 | Ga0466712_049611 | 3300042614 | Bacteria | 7961 |
| 114 | Ga0466712_155015 | 3300042614 | Bacteria | 1859 |
| 115 | Ga0466718_068778 | 3300042617 | Viruses | 4211 |
| 116 | Ga0466702_208883 | 3300042635 | Bacteria | 15911 |
| 117 | Ga0466709_109280 | 3300042648 | Bacteria | 5634 |
| 118 | Ga0466708_070166 | 3300042652 | Bacteria | 4779 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042610 | Ga0466698_516759 | Ga0466698_516759_1042_1740 | 232 |
| 2 | 3300042597 | Ga0466699_040484 | Ga0466699_040484_5024_5773 | 249 |
| 3 | 3300042635 | Ga0466702_200073 | Ga0466702_200073_376_1161 | 256 |
| 4 | 3300042614 | Ga0466712_046018 | Ga0466712_046018_2438_3223 | 261 |
| 5 | 3300042619 | Ga0466726_445256 | Ga0466726_445256_582_1370 | 262 |
| 6 | 3300042614 | Ga0466712_215788 | Ga0466712_215788_12_806 | 264 |
| 7 | 3300002449 | JGI24698J34947_10007518 | JGI24698J34947_100075184 | 271 |
| 8 | 3300042612 | Ga0466705_374346 | Ga0466705_374346_8891_9706 | 271 |
| 9 | 3300000089 | AustNasuHG_c1000247 | AustNasuHG_100024712 | 272 |
| 10 | 3300005200 | Ga0072940_1018024 | Ga0072940_101802422 | 272 |
| 11 | 3300042635 | Ga0466702_262605 | Ga0466702_262605_2265_3083 | 272 |
| 12 | 3300010049 | Ga0123356_10408253 | Ga0123356_104082532 | 274 |
| 13 | 3300042600 | Ga0466700_190210 | Ga0466700_190210_6636_7505 | 276 |
| 14 | 3300042652 | Ga0466708_030557 | Ga0466708_030557_888_1748 | 279 |
| 15 | 3300042590 | Ga0466690_433560 | Ga0466690_433560_1257_2114 | 280 |
| 16 | 3300042620 | Ga0466728_473189 | Ga0466728_473189_1002_1874 | 281 |
| 17 | 3300042614 | Ga0466712_042362 | Ga0466712_042362_263_1117 | 284 |
| 18 | 3300042622 | Ga0466731_146613 | Ga0466731_146613_10906_11760 | 284 |
| 19 | iso_pr_bacteria | 2781125637 | 2781282014 | 284 |
| 20 | iso_pr_bacteria | 2781125649 | 2781306663 | 284 |
| 21 | 3300002450 | JGI24695J34938_10001075 | JGI24695J34938_100010757 | 285 |
| 22 | 3300002450 | JGI24695J34938_10002120 | JGI24695J34938_100021203 | 285 |
| 23 | 3300010167 | Ga0123353_10271722 | Ga0123353_102717222 | 285 |
| 24 | 3300042593 | Ga0466691_026425 | Ga0466691_026425_15340_16197 | 285 |
| 25 | 3300042596 | Ga0466696_215137 | Ga0466696_215137_5387_6244 | 285 |
| 26 | 3300042605 | Ga0466716_051403 | Ga0466716_051403_3521_4378 | 285 |
| 27 | 3300042606 | Ga0466719_162781 | Ga0466719_162781_1142_1999 | 285 |
| 28 | 3300042606 | Ga0466719_269808 | Ga0466719_269808_539_1396 | 285 |
| 29 | 3300042612 | Ga0466705_053400 | Ga0466705_053400_211_1068 | 285 |
| 30 | 3300042612 | Ga0466705_141900 | Ga0466705_141900_3755_4612 | 285 |
| 31 | 3300042612 | Ga0466705_172654 | Ga0466705_172654_1138_1995 | 285 |
| 32 | 3300042615 | Ga0466711_517498 | Ga0466711_517498_4182_5039 | 285 |
| 33 | 3300042618 | Ga0466723_052478 | Ga0466723_052478_1625_2482 | 285 |
| 34 | 3300042618 | Ga0466723_134847 | Ga0466723_134847_1142_1999 | 285 |
| 35 | 3300042621 | Ga0466729_010962 | Ga0466729_010962_1235_2092 | 285 |
| 36 | 3300042636 | Ga0466703_011172 | Ga0466703_011172_541_1398 | 285 |
| 37 | 3300042643 | Ga0466704_122341 | Ga0466704_122341_3457_4314 | 285 |
| 38 | 3300042643 | Ga0466704_310957 | Ga0466704_310957_1683_2540 | 285 |
| 39 | 3300042643 | Ga0466704_331491 | Ga0466704_331491_1151_2008 | 285 |
| 40 | 3300042652 | Ga0466708_070166 | Ga0466708_070166_1271_2128 | 285 |
| 41 | 3300042652 | Ga0466708_161621 | Ga0466708_161621_2435_3292 | 285 |
| 42 | 3300002449 | JGI24698J34947_10020641 | JGI24698J34947_100206413 | 286 |
| 43 | 3300042590 | Ga0466690_097456 | Ga0466690_097456_3784_4644 | 286 |
| 44 | 3300042596 | Ga0466696_175819 | Ga0466696_175819_9609_10469 | 286 |
| 45 | 3300042596 | Ga0466696_386007 | Ga0466696_386007_1650_2510 | 286 |
| 46 | 3300042601 | Ga0466707_018940 | Ga0466707_018940_220_1080 | 286 |
| 47 | 3300042605 | Ga0466716_078304 | Ga0466716_078304_461_1321 | 286 |
| 48 | 3300042606 | Ga0466719_311337 | Ga0466719_311337_369_1229 | 286 |
| 49 | 3300042619 | Ga0466726_416431 | Ga0466726_416431_209_1069 | 286 |
| 50 | 3300042636 | Ga0466703_103007 | Ga0466703_103007_1217_2077 | 286 |
| 51 | 3300042652 | Ga0466708_339182 | Ga0466708_339182_1438_2298 | 286 |
| 52 | 3300042655 | Ga0466727_325669 | Ga0466727_325669_731_1591 | 286 |
| 53 | 3300002449 | JGI24698J34947_10016476 | JGI24698J34947_100164763 | 287 |
| 54 | 3300010049 | Ga0123356_10145466 | Ga0123356_101454661 | 287 |
| 55 | 3300042594 | Ga0466694_160678 | Ga0466694_160678_893_1756 | 287 |
| 56 | 3300042594 | Ga0466694_222263 | Ga0466694_222263_5223_6086 | 287 |
| 57 | 3300042597 | Ga0466699_101428 | Ga0466699_101428_1251_2114 | 287 |
| 58 | 3300042597 | Ga0466699_304457 | Ga0466699_304457_143_1006 | 287 |
| 59 | 3300042608 | Ga0466721_126903 | Ga0466721_126903_490_1353 | 287 |
| 60 | 3300042612 | Ga0466705_019655 | Ga0466705_019655_856_1719 | 287 |
| 61 | 3300042622 | Ga0466731_318630 | Ga0466731_318630_1525_2388 | 287 |
| 62 | 3300042643 | Ga0466704_097806 | Ga0466704_097806_8577_9440 | 287 |
| 63 | 3300042652 | Ga0466708_165285 | Ga0466708_165285_2474_3337 | 287 |
| 64 | iso_pr_bacteria | 2781125646 | 2781300724 | 287 |
| 65 | iso_pr_bacteria | 2781125665 | 2781342529 | 287 |
| 66 | 3300002450 | JGI24695J34938_10000052 | JGI24695J34938_1000005247 | 288 |
| 67 | 3300002450 | JGI24695J34938_10000827 | JGI24695J34938_1000082720 | 288 |
| 68 | 3300002450 | JGI24695J34938_10008240 | JGI24695J34938_100082403 | 288 |
| 69 | 3300010049 | Ga0123356_10001645 | Ga0123356_1000164510 | 288 |
| 70 | 3300010049 | Ga0123356_10004707 | Ga0123356_100047072 | 288 |
| 71 | 3300010049 | Ga0123356_10008813 | Ga0123356_100088136 | 288 |
| 72 | 3300042601 | Ga0466707_294304 | Ga0466707_294304_734_1600 | 288 |
| 73 | 3300042604 | Ga0466717_113733 | Ga0466717_113733_672_1538 | 288 |
| 74 | 3300042614 | Ga0466712_005190 | Ga0466712_005190_1322_2188 | 288 |
| 75 | 3300042614 | Ga0466712_109389 | Ga0466712_109389_1337_2203 | 288 |
| 76 | 3300042614 | Ga0466712_155015 | Ga0466712_155015_953_1819 | 288 |
| 77 | 3300042614 | Ga0466712_313583 | Ga0466712_313583_1048_1914 | 288 |
| 78 | 3300042614 | Ga0466712_317354 | Ga0466712_317354_7227_8093 | 288 |
| 79 | 3300042621 | Ga0466729_236582 | Ga0466729_236582_1871_2737 | 288 |
| 80 | iso_pr_bacteria | 2781125661 | 2781332884 | 288 |
| 81 | 3300002449 | JGI24698J34947_10012507 | JGI24698J34947_100125073 | 289 |
| 82 | 3300002449 | JGI24698J34947_10013692 | JGI24698J34947_100136923 | 289 |
| 83 | 3300002449 | JGI24698J34947_10019459 | JGI24698J34947_100194593 | 289 |
| 84 | 3300002449 | JGI24698J34947_10019570 | JGI24698J34947_100195703 | 289 |
| 85 | 3300002449 | JGI24698J34947_10021905 | JGI24698J34947_100219053 | 289 |
| 86 | 3300002449 | JGI24698J34947_10030764 | JGI24698J34947_100307642 | 289 |
| 87 | 3300002449 | JGI24698J34947_10044458 | JGI24698J34947_100444583 | 289 |
| 88 | 3300002450 | JGI24695J34938_10003656 | JGI24695J34938_100036564 | 289 |
| 89 | 3300005201 | Ga0072941_1002524 | Ga0072941_100252410 | 289 |
| 90 | 3300005201 | Ga0072941_1035832 | Ga0072941_10358321 | 289 |
| 91 | 3300024493 | Ga0264413_105355 | Ga0264413_1053559 | 289 |
| 92 | 3300024493 | Ga0264413_114651 | Ga0264413_1146512 | 289 |
| 93 | 3300038395 | Ga0415639_025745 | Ga0415639_025745_6723_7592 | 289 |
| 94 | 3300038395 | Ga0415639_056024 | Ga0415639_056024_4965_5834 | 289 |
| 95 | 3300042594 | Ga0466694_067158 | Ga0466694_067158_3324_4193 | 289 |
| 96 | 3300042594 | Ga0466694_121632 | Ga0466694_121632_89_958 | 289 |
| 97 | 3300042607 | Ga0466720_083692 | Ga0466720_083692_314_1183 | 289 |
| 98 | 3300042617 | Ga0466718_068778 | Ga0466718_068778_2428_3297 | 289 |
| 99 | 3300042620 | Ga0466728_072978 | Ga0466728_072978_2280_3149 | 289 |
| 100 | 3300042635 | Ga0466702_208883 | Ga0466702_208883_6968_7837 | 289 |
| 101 | 3300042648 | Ga0466709_109280 | Ga0466709_109280_2081_2950 | 289 |
| 102 | 3300042655 | Ga0466727_153574 | Ga0466727_153574_13_882 | 289 |
| 103 | iso_pr_bacteria | 2781125657 | 2781324343 | 289 |
| 104 | 3300010049 | Ga0123356_10005241 | Ga0123356_100052412 | 290 |
| 105 | 3300010049 | Ga0123356_10267222 | Ga0123356_102672222 | 290 |
| 106 | 3300010049 | Ga0123356_10616588 | Ga0123356_106165882 | 290 |
| 107 | 3300042614 | Ga0466712_049611 | Ga0466712_049611_6023_6895 | 290 |
| 108 | 3300042615 | Ga0466711_310201 | Ga0466711_310201_1152_2024 | 290 |
| 109 | 3300042643 | Ga0466704_201723 | Ga0466704_201723_2295_3167 | 290 |
| 110 | 3300042648 | Ga0466709_071710 | Ga0466709_071710_2860_3732 | 290 |
| 111 | 3300002449 | JGI24698J34947_10039450 | JGI24698J34947_100394503 | 291 |
| 112 | 3300010049 | Ga0123356_10010412 | Ga0123356_100104125 | 291 |
| 113 | 3300042607 | Ga0466720_210192 | Ga0466720_210192_791_1666 | 291 |
| 114 | 3300042614 | Ga0466712_028790 | Ga0466712_028790_63001_63876 | 291 |
| 115 | 3300002449 | JGI24698J34947_10012921 | JGI24698J34947_100129212 | 292 |
| 116 | 3300002450 | JGI24695J34938_10000899 | JGI24695J34938_100008997 | 292 |
| 117 | 3300038395 | Ga0415639_142615 | Ga0415639_142615_46_924 | 292 |
| 118 | 3300042594 | Ga0466694_188580 | Ga0466694_188580_5158_6042 | 294 |
| 119 | 3300000089 | AustNasuHG_c1006146 | AustNasuHG_10061462 | 296 |
| 120 | 3300010049 | Ga0123356_10001315 | Ga0123356_100013153 | 296 |
| 121 | iso_pr_bacteria | 2781125660 | 2781330439 | 297 |
| 122 | 3300002450 | JGI24695J34938_10017060 | JGI24695J34938_100170603 | 298 |
| 123 | 3300042592 | Ga0466693_385425 | Ga0466693_385425_9538_10437 | 299 |
| 124 | iso_pr_bacteria | 2781125647 | 2781303293 | 300 |
| 125 | 3300002450 | JGI24695J34938_10000780 | JGI24695J34938_100007805 | 301 |
| 126 | 3300002450 | JGI24695J34938_10000081 | JGI24695J34938_1000008142 | 307 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.85 | 0.89 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.