Protein Family IF00579
Metagenome
Isolate
184
Members
78
Samples
147
Scaffolds
531.95
Avg Length
Representative Sequence
- ID
- 3300002450|JGI24695J34938_10000057|JGI24695J34938_1000005766
- Length
- 564 aa
- Sequence
- MSVGMLNIFNTHSSALLVPTLQGVIITMNLKRTEIENTLAWKKMGISLPRFCVSEMCVRTKEAPQWVHFGAGNIFRAFIARISQNLLNLGLVESGIVAVETYDYEIIDRVYKPYSDLSLFVGLKSDGNMDMEVIASVARSLNADSSVEKDWSALHDIFKNPELQLVSVTITEKGYGLYGADGKLLAVVSDDIKSGPSAPRHAMSVVAALLYSRFLSGGAPLALVSMDNCSRNGEVFYKAVYTVAEGWYRNGHVDRAFLDYISDETKVAFPWSMIDKITPYPDDSVYKELTRLGLEGMEPLTTSKNSFTAPFVNAEIPEYLVIEDSFPNGRPPLEKAGVYLTDRETVNKTEKMKVTTCLNPLHTALAVFGCLLGFKKISDMMNDQDMVNLVNRLGYTEGMPVVTDPKIIRPRAFIKEVLEKRLPNPFLPDTPQRIATDTSQKMAIRFGETIRAYMESEALDTAELTVIPLVIAGWLRYLLAVDDNGNEMPLSPDPALGELTALLSDICVGVPNIAGGQLYPILSNAQIFGVNLFDAGLGEKVIKIFNELIAKPGAVREVVRKYT*
Sample Types
Isolate
20.1%
Metagenome
79.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
39.0%
Termitidae
23.4%
Kalotermitidae
18.2%
Apidae
10.4%
Termopsidae
5.2%
Rhinotermitidae
3.9%
Taxonomy
Archaea
0
Bacteria
182
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2597490194 | Bifidobacterium coryneforme LMG 18911 | Isolate | Apidae |
| 2 | 2671180601 | Bifidobacterium asteroides DSM 20089 | Isolate | Unclassified |
| 3 | 2820546020 | Unclassified Firmicutes Lab288P1bin102 | Isolate | Unclassified |
| 4 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 5 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 6 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 7 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 8 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 9 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 10 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 11 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 8110340172 | Bifidobacterium choladohabitans B14384H11 | Isolate | Apidae |
| 14 | 2519899775 | Bifidobacterium asteroides PRL2011 | Isolate | Apidae |
| 15 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 16 | 2590828841 | Oscillospiraceae bacterium Ne3 | Isolate | Termitidae |
| 17 | 2819999932 | Unclassified Synergistetes Th196P4bin51 | Isolate | Unclassified |
| 18 | 2820533259 | Unclassified Firmicutes Lab288P1bin140 | Isolate | Unclassified |
| 19 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 20 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 21 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 22 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 23 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 24 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 25 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 26 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 27 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 28 | 2513237174 | Bifidobacterium asteroides ATCC 25910 | Isolate | Apidae |
| 29 | 2820280018 | Unclassified Firmicutes Th196P3bin149 | Isolate | Unclassified |
| 30 | 2820661146 | Unclassified Firmicutes Co191P3bin61 | Isolate | Unclassified |
| 31 | 2820707375 | Unclassified Firmicutes Co191P1bin31 | Isolate | Unclassified |
| 32 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 33 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 34 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 35 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 36 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 37 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 38 | 2660238275 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 39 | 2684622916 | Bifidobacterium asteroides Bi_170 | Isolate | Unclassified |
| 40 | 2684622917 | Bifidobacterium coryneforme Bi_197 | Isolate | Unclassified |
| 41 | 2693429521 | Bifidobacterium coryneforme DSM 20216 | Isolate | Unclassified |
| 42 | 2820292184 | Unclassified Firmicutes Th196P3bin109 | Isolate | Unclassified |
| 43 | 2820432912 | Unclassified Firmicutes Lab288P3bin219 | Isolate | Unclassified |
| 44 | 2820530790 | Unclassified Firmicutes Lab288P1bin141 | Isolate | Unclassified |
| 45 | 2820666966 | Unclassified Firmicutes Co191P3bin39 | Isolate | Unclassified |
| 46 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 47 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 48 | 2820393573 | Unclassified Firmicutes Nc150P1bin9 | Isolate | Unclassified |
| 49 | 2820563109 | Unclassified Firmicutes Emb289P3bin58 | Isolate | Unclassified |
| 50 | 2820690275 | Unclassified Firmicutes Co191P1bin72 | Isolate | Unclassified |
| 51 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 52 | 8024986378 | Bifidobacterium asteroides ESL0198 | Isolate | Apidae |
| 53 | 8032009961 | Bifidobacterium indicum ESL0197 | Isolate | Apidae |
| 54 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 55 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 56 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 57 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 58 | 2802429577 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 59 | 2820573558 | Unclassified Firmicutes Emb289P3bin140 | Isolate | Unclassified |
| 60 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 61 | 8110341875 | Bifidobacterium polysaccharolyticum W8117 | Isolate | Apidae |
| 62 | 2808606957 | Bifidobacterium sp. ESL0447 | Isolate | Unclassified |
| 63 | 2820301196 | Unclassified Firmicutes Th196P1bin8 | Isolate | Unclassified |
| 64 | 2820342392 | Unclassified Firmicutes Nt197P3bin64 | Isolate | Unclassified |
| 65 | 2820596822 | Unclassified Firmicutes Emb289P1bin58 | Isolate | Unclassified |
| 66 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 67 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 68 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 69 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 70 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 71 | 2684622918 | Bifidobacterium asteroides Bi_198 | Isolate | Unclassified |
| 72 | 2820005795 | Unclassified Synergistetes Nt197P3bin106 | Isolate | Unclassified |
| 73 | 2820246658 | Unclassified Firmicutes Th196P3bin70 | Isolate | Unclassified |
| 74 | 8024981139 | Bifidobacterium asteroides ESL0170 | Isolate | Apidae |
| 75 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 76 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 77 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 78 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123355_10039198 | 3300009826 | Bacteria | 7707 |
| 2 | Ga0123355_10165151 | 3300009826 | Bacteria | 3324 |
| 3 | JGI24702J35022_10001499 | 3300002462 | Bacteria | 14498 |
| 4 | Ga0466715_321032 | 3300042616 | Bacteria | 166710 |
| 5 | Ga0466723_106096 | 3300042618 | Bacteria | 28128 |
| 6 | Ga0466728_094658 | 3300042620 | Bacteria | 11034 |
| 7 | Ga0466692_014346 | 3300042591 | Bacteria | 6661 |
| 8 | Ga0466696_010294 | 3300042596 | Bacteria | 27939 |
| 9 | Ga0466696_116428 | 3300042596 | Bacteria | 8392 |
| 10 | Ga0466696_123484 | 3300042596 | Bacteria | 9563 |
| 11 | Ga0466696_452388 | 3300042596 | Bacteria | 5072 |
| 12 | Ga0466707_248668 | 3300042601 | Bacteria | 1712 |
| 13 | Ga0466714_006804 | 3300042603 | Bacteria | 4388 |
| 14 | Ga0466714_164808 | 3300042603 | Bacteria | 1605 |
| 15 | Ga0466716_151046 | 3300042605 | Bacteria | 19901 |
| 16 | Ga0466721_285206 | 3300042608 | Bacteria | 28917 |
| 17 | Ga0466725_259712 | 3300042654 | Bacteria | 12556 |
| 18 | Ga0466733_199238 | 3300042659 | Bacteria | 3448 |
| 19 | Ga0123356_10002180 | 3300010049 | Bacteria | 21050 |
| 20 | Ga0123356_10002783 | 3300010049 | Bacteria | 18563 |
| 21 | Ga0123356_10012630 | 3300010049 | Bacteria | 8189 |
| 22 | Ga0123356_10039994 | 3300010049 | Bacteria | 4369 |
| 23 | Ga0123356_10196779 | 3300010049 | Bacteria | 2052 |
| 24 | Ga0466711_035438 | 3300042615 | Bacteria | 3516 |
| 25 | Ga0466723_358872 | 3300042618 | Bacteria | 4629 |
| 26 | Ga0466728_125878 | 3300042620 | Bacteria | 24281 |
| 27 | Ga0466690_283801 | 3300042590 | Bacteria | 4881 |
| 28 | Ga0466696_073454 | 3300042596 | Bacteria | 2143 |
| 29 | Ga0466696_259712 | 3300042596 | Bacteria | 29051 |
| 30 | Ga0466700_237745 | 3300042600 | Bacteria | 1634 |
| 31 | Ga0466707_098942 | 3300042601 | Bacteria | 5155 |
| 32 | Ga0466713_110078 | 3300042602 | Bacteria | 49332 |
| 33 | Ga0466719_473962 | 3300042606 | Bacteria | 3876 |
| 34 | Ga0466735_103111 | 3300042624 | Bacteria | 3679 |
| 35 | Ga0466703_293360 | 3300042636 | Bacteria | 8502 |
| 36 | Ga0466704_479369 | 3300042643 | Bacteria | 8748 |
| 37 | Ga0466704_538516 | 3300042643 | Bacteria | 9487 |
| 38 | Ga0466727_225171 | 3300042655 | Bacteria | 2988 |
| 39 | Ga0466727_328565 | 3300042655 | Bacteria | 4068 |
| 40 | Ga0466705_050308 | 3300042612 | Bacteria | 4620 |
| 41 | Ga0123355_10003176 | 3300009826 | Bacteria | 23461 |
| 42 | Ga0123355_10023344 | 3300009826 | Bacteria | 9932 |
| 43 | Ga0123355_10090620 | 3300009826 | Bacteria | 4850 |
| 44 | Ga0123356_10125629 | 3300010049 | Bacteria | 2503 |
| 45 | Ga0123353_10000269 | 3300010167 | Bacteria | 64830 |
| 46 | JGI24695J34938_10006918 | 3300002450 | Bacteria | 6732 |
| 47 | Ga0068305_10002306 | 3300005083 | Bacteria | 48693 |
| 48 | Ga0466711_364085 | 3300042615 | Bacteria | 228323 |
| 49 | Ga0466715_593419 | 3300042616 | Bacteria | 37491 |
| 50 | Ga0466726_241035 | 3300042619 | Bacteria | 10868 |
| 51 | Ga0466729_123862 | 3300042621 | Bacteria | 45856 |
| 52 | Ga0466691_042856 | 3300042593 | Bacteria | 6642 |
| 53 | Ga0466700_063771 | 3300042600 | Bacteria | 96209 |
| 54 | Ga0466707_309035 | 3300042601 | Unclassified | 3912 |
| 55 | Ga0466713_029057 | 3300042602 | Bacteria | 5290 |
| 56 | Ga0466714_071785 | 3300042603 | Bacteria | 2910 |
| 57 | Ga0466714_128332 | 3300042603 | Bacteria | 98615 |
| 58 | Ga0466716_000163 | 3300042605 | Bacteria | 3102 |
| 59 | Ga0466703_270850 | 3300042636 | Bacteria | 13720 |
| 60 | Ga0466708_377185 | 3300042652 | Bacteria | 4221 |
| 61 | Ga0466727_304622 | 3300042655 | Bacteria | 4543 |
| 62 | Ga0466705_008694 | 3300042612 | Bacteria | 2121 |
| 63 | Ga0123357_10059466 | 3300009784 | Bacteria | 5128 |
| 64 | Ga0123355_10002318 | 3300009826 | Bacteria | 26885 |
| 65 | Ga0123355_10003310 | 3300009826 | Bacteria | 23053 |
| 66 | Ga0123356_10000009 | 3300010049 | Bacteria | 226788 |
| 67 | Ga0123356_10095189 | 3300010049 | Bacteria | 2846 |
| 68 | Ga0072941_1000935 | 3300005201 | Bacteria | 118687 |
| 69 | Ga0466723_029755 | 3300042618 | Bacteria | 48312 |
| 70 | Ga0466723_101405 | 3300042618 | Bacteria | 32576 |
| 71 | Ga0466696_329767 | 3300042596 | Bacteria | 15797 |
| 72 | Ga0466716_179312 | 3300042605 | Bacteria | 5627 |
| 73 | Ga0466719_127301 | 3300042606 | Bacteria | 9111 |
| 74 | Ga0466698_157547 | 3300042610 | Bacteria | 23432 |
| 75 | Ga0466703_309775 | 3300042636 | Bacteria | 11693 |
| 76 | Ga0466704_099865 | 3300042643 | Bacteria | 12393 |
| 77 | Ga0466704_303329 | 3300042643 | Bacteria | 3449 |
| 78 | Ga0466709_368918 | 3300042648 | Bacteria | 82197 |
| 79 | Ga0466727_150380 | 3300042655 | Bacteria | 3401 |
| 80 | Ga0466705_069098 | 3300042612 | Bacteria | 10056 |
| 81 | Ga0466705_110916 | 3300042612 | Bacteria | 65673 |
| 82 | Ga0123353_10040308 | 3300010167 | Bacteria | 7367 |
| 83 | Ga0466705_436087 | 3300042612 | Bacteria | 4422 |
| 84 | Ga0466715_111177 | 3300042616 | Bacteria | 1957 |
| 85 | Ga0466715_244540 | 3300042616 | Bacteria | 16421 |
| 86 | Ga0466715_421137 | 3300042616 | Bacteria | 6577 |
| 87 | Ga0466715_459474 | 3300042616 | Bacteria | 3985 |
| 88 | Ga0466726_182456 | 3300042619 | Bacteria | 3469 |
| 89 | Ga0466696_493332 | 3300042596 | Bacteria | 5644 |
| 90 | Ga0466702_448230 | 3300042635 | Bacteria | 4728 |
| 91 | Ga0466703_146010 | 3300042636 | Bacteria | 3999 |
| 92 | Ga0466703_212971 | 3300042636 | Bacteria | 3569 |
| 93 | Ga0123355_10000182 | 3300009826 | Bacteria | 77682 |
| 94 | Ga0123356_10002282 | 3300010049 | Bacteria | 20654 |
| 95 | Ga0123356_10010058 | 3300010049 | Bacteria | 9303 |
| 96 | Ga0072941_1071609 | 3300005201 | Bacteria | 12714 |
| 97 | Ga0466711_048496 | 3300042615 | Bacteria | 16827 |
| 98 | Ga0466715_241955 | 3300042616 | Bacteria | 3486 |
| 99 | Ga0466728_083856 | 3300042620 | Bacteria | 5780 |
| 100 | Ga0466696_021324 | 3300042596 | Bacteria | 9070 |
| 101 | Ga0466696_029290 | 3300042596 | Bacteria | 39093 |
| 102 | Ga0466714_003848 | 3300042603 | Bacteria | 22429 |
| 103 | Ga0466714_086830 | 3300042603 | Bacteria | 8301 |
| 104 | Ga0466714_114674 | 3300042603 | Bacteria | 18871 |
| 105 | Ga0466716_053025 | 3300042605 | Bacteria | 4120 |
| 106 | Ga0466719_014220 | 3300042606 | Bacteria | 7815 |
| 107 | Ga0466722_102355 | 3300042609 | Bacteria | 2435 |
| 108 | Ga0466704_011570 | 3300042643 | Bacteria | 91516 |
| 109 | Ga0466704_506267 | 3300042643 | Bacteria | 10877 |
| 110 | Ga0466709_039865 | 3300042648 | Bacteria | 21232 |
| 111 | Ga0466708_021980 | 3300042652 | Bacteria | 6979 |
| 112 | Ga0068302_10395563 | 3300005071 | Bacteria | 1908 |
| 113 | Ga0466711_181310 | 3300042615 | Bacteria | 18546 |
| 114 | Ga0466715_325083 | 3300042616 | Bacteria | 37633 |
| 115 | Ga0466693_234840 | 3300042592 | Bacteria | 1841 |
| 116 | Ga0466696_290089 | 3300042596 | Bacteria | 9192 |
| 117 | Ga0466713_025243 | 3300042602 | Bacteria | 12014 |
| 118 | Ga0466714_150022 | 3300042603 | Bacteria | 3774 |
| 119 | Ga0466703_321499 | 3300042636 | Bacteria | 9354 |
| 120 | Ga0466704_337647 | 3300042643 | Bacteria | 10905 |
| 121 | Ga0466704_515801 | 3300042643 | Bacteria | 57837 |
| 122 | Ga0466709_222083 | 3300042648 | Bacteria | 2835 |
| 123 | Ga0466733_086673 | 3300042659 | Bacteria | 6275 |
| 124 | Ga0123357_10210781 | 3300009784 | Bacteria | 2183 |
| 125 | Ga0123355_10009052 | 3300009826 | Bacteria | 15092 |
| 126 | Ga0123355_10043336 | 3300009826 | Bacteria | 7321 |
| 127 | Ga0123355_10062939 | 3300009826 | Bacteria | 5987 |
| 128 | Ga0123355_10309306 | 3300009826 | Bacteria | 2144 |
| 129 | Ga0123353_10024319 | 3300010167 | Bacteria | 9193 |
| 130 | JGI24695J34938_10000057 | 3300002450 | Bacteria | 89669 |
| 131 | JGI24700J35501_10930934 | 3300002508 | Bacteria | 66586 |
| 132 | Ga0068305_10009261 | 3300005083 | Unclassified | 4197 |
| 133 | Ga0466715_036720 | 3300042616 | Bacteria | 9199 |
| 134 | Ga0466723_069694 | 3300042618 | Bacteria | 3874 |
| 135 | Ga0415639_075635 | 3300038395 | Bacteria | 4807 |
| 136 | Ga0466690_200100 | 3300042590 | Bacteria | 11962 |
| 137 | Ga0466691_119084 | 3300042593 | Bacteria | 39836 |
| 138 | Ga0466691_158402 | 3300042593 | Bacteria | 3927 |
| 139 | Ga0466713_062099 | 3300042602 | Bacteria | 11148 |
| 140 | Ga0466719_117979 | 3300042606 | Bacteria | 6960 |
| 141 | Ga0466719_121895 | 3300042606 | Bacteria | 15848 |
| 142 | Ga0466719_295739 | 3300042606 | Bacteria | 21474 |
| 143 | Ga0466719_303212 | 3300042606 | Bacteria | 94930 |
| 144 | Ga0466722_081863 | 3300042609 | Bacteria | 13861 |
| 145 | Ga0466703_106697 | 3300042636 | Bacteria | 53394 |
| 146 | Ga0466708_003745 | 3300042652 | Bacteria | 6833 |
| 147 | Ga0466727_093204 | 3300042655 | Bacteria | 3801 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042600 | Ga0466700_237745 | Ga0466700_237745_276_1592 | 438 |
| 2 | 3300042618 | Ga0466723_358872 | Ga0466723_358872_3256_4611 | 451 |
| 3 | iso_pr_bacteria | 2820596822 | 2820598173 | 456 |
| 4 | 3300009826 | Ga0123355_10023344 | Ga0123355_100233442 | 457 |
| 5 | 3300042643 | Ga0466704_515801 | Ga0466704_515801_12640_14088 | 482 |
| 6 | iso_pr_bacteria | 2820280018 | 2820281971 | 487 |
| 7 | 3300038395 | Ga0415639_075635 | Ga0415639_075635_2341_3807 | 488 |
| 8 | 3300042603 | Ga0466714_164808 | Ga0466714_164808_27_1547 | 489 |
| 9 | 3300042603 | Ga0466714_003848 | Ga0466714_003848_19199_20677 | 492 |
| 10 | iso_pr_bacteria | 2820292184 | 2820292527 | 493 |
| 11 | iso_pr_bacteria | 2820342392 | 2820343172 | 495 |
| 12 | 3300042592 | Ga0466693_234840 | Ga0466693_234840_271_1761 | 496 |
| 13 | 3300042600 | Ga0466700_063771 | Ga0466700_063771_26984_28477 | 497 |
| 14 | 3300042601 | Ga0466707_098942 | Ga0466707_098942_645_2150 | 501 |
| 15 | 3300042603 | Ga0466714_114674 | Ga0466714_114674_10511_12016 | 501 |
| 16 | 3300042610 | Ga0466698_157547 | Ga0466698_157547_13988_15493 | 501 |
| 17 | 3300042609 | Ga0466722_081863 | Ga0466722_081863_6838_8346 | 502 |
| 18 | iso_pr_bacteria | 2820573558 | 2820574852 | 502 |
| 19 | 3300010049 | Ga0123356_10002180 | Ga0123356_1000218011 | 503 |
| 20 | 3300042659 | Ga0466733_199238 | Ga0466733_199238_1871_3385 | 504 |
| 21 | iso_pr_bacteria | 2820432912 | 2820435103 | 504 |
| 22 | iso_pr_bacteria | 2820530790 | 2820532102 | 504 |
| 23 | 3300009784 | Ga0123357_10059466 | Ga0123357_100594665 | 505 |
| 24 | 3300010167 | Ga0123353_10000269 | Ga0123353_1000026930 | 505 |
| 25 | 3300010167 | Ga0123353_10024319 | Ga0123353_100243194 | 505 |
| 26 | 3300042603 | Ga0466714_006804 | Ga0466714_006804_1647_3167 | 506 |
| 27 | 3300042603 | Ga0466714_071785 | Ga0466714_071785_783_2303 | 506 |
| 28 | 3300042608 | Ga0466721_285206 | Ga0466721_285206_3707_5269 | 511 |
| 29 | 3300009826 | Ga0123355_10000182 | Ga0123355_100001822 | 512 |
| 30 | 3300010049 | Ga0123356_10002783 | Ga0123356_100027833 | 512 |
| 31 | iso_pr_bacteria | 2820246658 | 2820247847 | 513 |
| 32 | 3300010049 | Ga0123356_10002282 | Ga0123356_100022829 | 515 |
| 33 | 3300010049 | Ga0123356_10039994 | Ga0123356_100399943 | 515 |
| 34 | 3300010049 | Ga0123356_10125629 | Ga0123356_101256292 | 515 |
| 35 | 3300042621 | Ga0466729_123862 | Ga0466729_123862_8249_9868 | 517 |
| 36 | iso_pr_bacteria | 2820563109 | 2820563280 | 521 |
| 37 | 3300010049 | Ga0123356_10000009 | Ga0123356_10000009171 | 522 |
| 38 | 3300010049 | Ga0123356_10010058 | Ga0123356_100100583 | 525 |
| 39 | 3300042616 | Ga0466715_593419 | Ga0466715_593419_19279_20934 | 525 |
| 40 | 3300042655 | Ga0466727_093204 | Ga0466727_093204_1779_3398 | 526 |
| 41 | iso_pr_bacteria | 2820393573 | 2820396769 | 528 |
| 42 | iso_pr_bacteria | 2820707375 | 2820708553 | 528 |
| 43 | 3300042596 | Ga0466696_029290 | Ga0466696_029290_26586_28211 | 531 |
| 44 | 3300042635 | Ga0466702_448230 | Ga0466702_448230_961_2556 | 531 |
| 45 | 3300009784 | Ga0123357_10210781 | Ga0123357_102107812 | 532 |
| 46 | 3300042596 | Ga0466696_010294 | Ga0466696_010294_16433_18052 | 532 |
| 47 | 3300042616 | Ga0466715_321032 | Ga0466715_321032_29143_30762 | 532 |
| 48 | iso_pr_bacteria | 2820301196 | 2820303320 | 532 |
| 49 | 3300002462 | JGI24702J35022_10001499 | JGI24702J35022_100014998 | 533 |
| 50 | 3300002508 | JGI24700J35501_10930934 | JGI24700J35501_1093093441 | 533 |
| 51 | 3300005083 | Ga0068305_10009261 | Ga0068305_100092612 | 533 |
| 52 | 3300009826 | Ga0123355_10043336 | Ga0123355_100433362 | 533 |
| 53 | 3300009826 | Ga0123355_10062939 | Ga0123355_100629395 | 533 |
| 54 | 3300042596 | Ga0466696_021324 | Ga0466696_021324_2606_4207 | 533 |
| 55 | 3300042612 | Ga0466705_008694 | Ga0466705_008694_321_2009 | 533 |
| 56 | 3300042618 | Ga0466723_029755 | Ga0466723_029755_5411_7039 | 533 |
| 57 | 3300042643 | Ga0466704_538516 | Ga0466704_538516_6409_8025 | 533 |
| 58 | 3300009826 | Ga0123355_10090620 | Ga0123355_100906202 | 534 |
| 59 | 3300042603 | Ga0466714_086830 | Ga0466714_086830_4367_5971 | 534 |
| 60 | 3300042636 | Ga0466703_212971 | Ga0466703_212971_1153_2757 | 534 |
| 61 | iso_pr_bacteria | 2819999932 | 2820000473 | 534 |
| 62 | 3300005201 | Ga0072941_1071609 | Ga0072941_10716099 | 535 |
| 63 | 3300042612 | Ga0466705_436087 | Ga0466705_436087_256_1863 | 535 |
| 64 | 3300042616 | Ga0466715_244540 | Ga0466715_244540_3733_5340 | 535 |
| 65 | 3300042618 | Ga0466723_106096 | Ga0466723_106096_22198_23805 | 535 |
| 66 | iso_pr_bacteria | 2820546020 | 2820546563 | 535 |
| 67 | 3300009826 | Ga0123355_10003310 | Ga0123355_100033102 | 536 |
| 68 | 3300010167 | Ga0123353_10040308 | Ga0123353_100403082 | 536 |
| 69 | 3300042590 | Ga0466690_200100 | Ga0466690_200100_452_2062 | 536 |
| 70 | 3300042601 | Ga0466707_248668 | Ga0466707_248668_85_1695 | 536 |
| 71 | 3300042602 | Ga0466713_025243 | Ga0466713_025243_3297_4907 | 536 |
| 72 | 3300042606 | Ga0466719_303212 | Ga0466719_303212_19973_21583 | 536 |
| 73 | 3300042612 | Ga0466705_050308 | Ga0466705_050308_18_1628 | 536 |
| 74 | 3300042615 | Ga0466711_181310 | Ga0466711_181310_16697_18307 | 536 |
| 75 | 3300042616 | Ga0466715_111177 | Ga0466715_111177_29_1639 | 536 |
| 76 | 3300042616 | Ga0466715_325083 | Ga0466715_325083_3035_4645 | 536 |
| 77 | 3300042618 | Ga0466723_101405 | Ga0466723_101405_10733_12343 | 536 |
| 78 | 3300042619 | Ga0466726_182456 | Ga0466726_182456_694_2322 | 536 |
| 79 | 3300042654 | Ga0466725_259712 | Ga0466725_259712_3180_4790 | 536 |
| 80 | 3300042659 | Ga0466733_086673 | Ga0466733_086673_1360_2970 | 536 |
| 81 | iso_pr_bacteria | 2529293168 | 2531452044 | 536 |
| 82 | iso_pr_bacteria | 2820005795 | 2820006976 | 536 |
| 83 | iso_pr_bacteria | 2820666966 | 2820667586 | 536 |
| 84 | 3300005201 | Ga0072941_1000935 | Ga0072941_100093584 | 537 |
| 85 | 3300010049 | Ga0123356_10012630 | Ga0123356_100126302 | 537 |
| 86 | 3300042590 | Ga0466690_283801 | Ga0466690_283801_1046_2659 | 537 |
| 87 | 3300042596 | Ga0466696_493332 | Ga0466696_493332_2968_4581 | 537 |
| 88 | 3300042602 | Ga0466713_029057 | Ga0466713_029057_1570_3183 | 537 |
| 89 | 3300042605 | Ga0466716_053025 | Ga0466716_053025_1307_2920 | 537 |
| 90 | 3300042606 | Ga0466719_121895 | Ga0466719_121895_2354_3967 | 537 |
| 91 | 3300042606 | Ga0466719_473962 | Ga0466719_473962_613_2226 | 537 |
| 92 | 3300042616 | Ga0466715_459474 | Ga0466715_459474_1135_2748 | 537 |
| 93 | 3300042620 | Ga0466728_094658 | Ga0466728_094658_2146_3759 | 537 |
| 94 | 3300042636 | Ga0466703_293360 | Ga0466703_293360_3993_5606 | 537 |
| 95 | 3300042636 | Ga0466703_321499 | Ga0466703_321499_2364_3977 | 537 |
| 96 | 3300042643 | Ga0466704_337647 | Ga0466704_337647_3220_4833 | 537 |
| 97 | iso_pr_bacteria | 2820661146 | 2820663442 | 537 |
| 98 | iso_pr_bacteria | 2820690275 | 2820692614 | 537 |
| 99 | 3300002450 | JGI24695J34938_10006918 | JGI24695J34938_100069182 | 538 |
| 100 | 3300005083 | Ga0068305_10002306 | Ga0068305_100023063 | 538 |
| 101 | 3300009826 | Ga0123355_10002318 | Ga0123355_100023185 | 538 |
| 102 | 3300009826 | Ga0123355_10165151 | Ga0123355_101651511 | 538 |
| 103 | 3300009826 | Ga0123355_10309306 | Ga0123355_103093061 | 538 |
| 104 | 3300010049 | Ga0123356_10196779 | Ga0123356_101967792 | 538 |
| 105 | 3300042602 | Ga0466713_062099 | Ga0466713_062099_4238_5854 | 538 |
| 106 | 3300042616 | Ga0466715_241955 | Ga0466715_241955_537_2153 | 538 |
| 107 | 3300042624 | Ga0466735_103111 | Ga0466735_103111_295_1911 | 538 |
| 108 | 3300042643 | Ga0466704_506267 | Ga0466704_506267_9076_10692 | 538 |
| 109 | 3300042648 | Ga0466709_222083 | Ga0466709_222083_835_2451 | 538 |
| 110 | 3300042652 | Ga0466708_021980 | Ga0466708_021980_2243_3859 | 538 |
| 111 | 3300042655 | Ga0466727_150380 | Ga0466727_150380_1516_3132 | 538 |
| 112 | 3300042603 | Ga0466714_150022 | Ga0466714_150022_444_2063 | 539 |
| 113 | 3300042605 | Ga0466716_179312 | Ga0466716_179312_3461_5080 | 539 |
| 114 | 3300042606 | Ga0466719_117979 | Ga0466719_117979_5065_6684 | 539 |
| 115 | 3300042609 | Ga0466722_102355 | Ga0466722_102355_338_1957 | 539 |
| 116 | 3300042643 | Ga0466704_011570 | Ga0466704_011570_20225_21844 | 539 |
| 117 | 3300042643 | Ga0466704_099865 | Ga0466704_099865_9545_11164 | 539 |
| 118 | 3300042655 | Ga0466727_225171 | Ga0466727_225171_737_2356 | 539 |
| 119 | 3300042655 | Ga0466727_304622 | Ga0466727_304622_305_1924 | 539 |
| 120 | iso_pr_bacteria | 2590828841 | 2593260717 | 539 |
| 121 | iso_pr_bacteria | 2820533259 | 2820535032 | 539 |
| 122 | 3300042591 | Ga0466692_014346 | Ga0466692_014346_859_2481 | 540 |
| 123 | 3300042605 | Ga0466716_000163 | Ga0466716_000163_795_2417 | 540 |
| 124 | 3300042606 | Ga0466719_127301 | Ga0466719_127301_304_1926 | 540 |
| 125 | 3300042612 | Ga0466705_069098 | Ga0466705_069098_5126_6748 | 540 |
| 126 | 3300042615 | Ga0466711_364085 | Ga0466711_364085_106370_107992 | 540 |
| 127 | 3300042619 | Ga0466726_241035 | Ga0466726_241035_8261_9883 | 540 |
| 128 | 3300042620 | Ga0466728_083856 | Ga0466728_083856_19_1641 | 540 |
| 129 | 3300042620 | Ga0466728_125878 | Ga0466728_125878_12059_13681 | 540 |
| 130 | 3300005071 | Ga0068302_10395563 | Ga0068302_103955631 | 541 |
| 131 | 3300010049 | Ga0123356_10095189 | Ga0123356_100951892 | 541 |
| 132 | 3300042596 | Ga0466696_290089 | Ga0466696_290089_5692_7317 | 541 |
| 133 | 3300042596 | Ga0466696_329767 | Ga0466696_329767_2347_3972 | 541 |
| 134 | 3300042605 | Ga0466716_151046 | Ga0466716_151046_15691_17316 | 541 |
| 135 | 3300042606 | Ga0466719_295739 | Ga0466719_295739_18106_19731 | 541 |
| 136 | 3300042615 | Ga0466711_048496 | Ga0466711_048496_13995_15620 | 541 |
| 137 | 3300009826 | Ga0123355_10009052 | Ga0123355_100090526 | 542 |
| 138 | 3300042652 | Ga0466708_377185 | Ga0466708_377185_1078_2706 | 542 |
| 139 | 3300009826 | Ga0123355_10003176 | Ga0123355_100031764 | 543 |
| 140 | 3300009826 | Ga0123355_10039198 | Ga0123355_100391986 | 543 |
| 141 | 3300042593 | Ga0466691_158402 | Ga0466691_158402_1854_3485 | 543 |
| 142 | 3300042596 | Ga0466696_452388 | Ga0466696_452388_1665_3296 | 543 |
| 143 | 3300042652 | Ga0466708_003745 | Ga0466708_003745_4518_6149 | 543 |
| 144 | 3300042593 | Ga0466691_042856 | Ga0466691_042856_215_1849 | 544 |
| 145 | 3300042596 | Ga0466696_123484 | Ga0466696_123484_1008_2642 | 544 |
| 146 | 3300042603 | Ga0466714_128332 | Ga0466714_128332_35577_37214 | 545 |
| 147 | 3300042612 | Ga0466705_110916 | Ga0466705_110916_44290_45927 | 545 |
| 148 | 3300042616 | Ga0466715_421137 | Ga0466715_421137_3008_4645 | 545 |
| 149 | 3300042636 | Ga0466703_146010 | Ga0466703_146010_1035_2747 | 545 |
| 150 | 3300042643 | Ga0466704_303329 | Ga0466704_303329_1002_2675 | 545 |
| 151 | 3300042643 | Ga0466704_479369 | Ga0466704_479369_1063_2700 | 545 |
| 152 | 3300042615 | Ga0466711_035438 | Ga0466711_035438_12_1652 | 546 |
| 153 | 3300042636 | Ga0466703_106697 | Ga0466703_106697_25687_27327 | 546 |
| 154 | 3300042636 | Ga0466703_309775 | Ga0466703_309775_2197_3837 | 546 |
| 155 | 3300042648 | Ga0466709_039865 | Ga0466709_039865_19179_20819 | 546 |
| 156 | 3300042616 | Ga0466715_036720 | Ga0466715_036720_2709_4352 | 547 |
| 157 | 3300042655 | Ga0466727_328565 | Ga0466727_328565_1794_3437 | 547 |
| 158 | iso_pr_bacteria | 2513237174 | 2514074407 | 547 |
| 159 | iso_pr_bacteria | 2519899775 | 2520953364 | 547 |
| 160 | iso_pr_bacteria | 2660238275 | 2661719217 | 547 |
| 161 | iso_pr_bacteria | 2671180601 | 2673427255 | 547 |
| 162 | iso_pr_bacteria | 2684622916 | 2686083246 | 547 |
| 163 | iso_pr_bacteria | 2684622917 | 2686084731 | 547 |
| 164 | iso_pr_bacteria | 2684622918 | 2686086416 | 547 |
| 165 | iso_pr_bacteria | 2802429577 | 2805812900 | 547 |
| 166 | iso_pr_bacteria | 2808606957 | 2811756694 | 547 |
| 167 | iso_pr_bacteria | 8024981139 | 8024982603 | 547 |
| 168 | iso_pr_bacteria | 8024986378 | 8024987828 | 547 |
| 169 | iso_pr_bacteria | 8032009961 | 8032011126 | 547 |
| 170 | iso_pr_bacteria | 8110340172 | 8110340564 | 547 |
| 171 | 3300042596 | Ga0466696_073454 | Ga0466696_073454_137_1783 | 548 |
| 172 | 3300042596 | Ga0466696_259712 | Ga0466696_259712_9600_11246 | 548 |
| 173 | 3300042636 | Ga0466703_270850 | Ga0466703_270850_4478_6130 | 550 |
| 174 | 3300042601 | Ga0466707_309035 | Ga0466707_309035_930_2585 | 551 |
| 175 | 3300042602 | Ga0466713_110078 | Ga0466713_110078_46661_48316 | 551 |
| 176 | 3300042648 | Ga0466709_368918 | Ga0466709_368918_8188_9843 | 551 |
| 177 | 3300042593 | Ga0466691_119084 | Ga0466691_119084_10158_11816 | 552 |
| 178 | 3300042596 | Ga0466696_116428 | Ga0466696_116428_1505_3163 | 552 |
| 179 | 3300042606 | Ga0466719_014220 | Ga0466719_014220_2619_4277 | 552 |
| 180 | iso_pr_bacteria | 8110341875 | 8110342648 | 554 |
| 181 | 3300042618 | Ga0466723_069694 | Ga0466723_069694_1650_3323 | 557 |
| 182 | 3300002450 | JGI24695J34938_10000057 | JGI24695J34938_1000005766 | 564 |
| 183 | iso_pr_bacteria | 2597490194 | 2598674761 | 596 |
| 184 | iso_pr_bacteria | 2693429521 | 2693516408 | 596 |
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF08125 | GO:0016491 | oxidoreductase activity | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.89 | 0.92 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.