Protein Family IF00546
Metagenome
Metatranscriptome
Isolate
114
Members
29
Samples
111
Scaffolds
199.06
Avg Length
Representative Sequence
- ID
- 3300002449|JGI24698J34947_10062458|JGI24698J34947_100624582
- Length
- 211 aa
- Sequence
- MKGAVSMKRFLGIVGAVLLLSLSSCASSPSAGVTRVDASTQTDLSGYWNDTDVKIVCEALIKDCLNSPRVDQAIKAMGGKTPIVLVGTFRNESSEHIDTGIISSTMEITIFNSGKMDFVAGGSKRDELRAERQDQQSNASEATAAALANEVGADFMLFGTVRAITDRAGNETVRTYFVTAEMTNVETNARMWMGQNNEIKKVIVRPKNKL*
Sample Types
Isolate
2.6%
Metagenome
96.5%
MAG
0.0%
Metatranscriptome
0.9%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
77.8%
Unclassified
14.8%
Rhinotermitidae
7.4%
Taxonomy
Archaea
0
Bacteria
102
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 2 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 3 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 4 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 5 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 6 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 7 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 8 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 9 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 10 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 11 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 12 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 13 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 14 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 15 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 16 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 17 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 18 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 19 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 20 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 21 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 22 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 23 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 24 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 25 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 26 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 27 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 28 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 29 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_080203 | 3300042656 | Bacteria | 4082 |
| 2 | JGI24698J34947_10014103 | 3300002449 | Bacteria | 4353 |
| 3 | JGI24697J35500_10834465 | 3300002507 | Unclassified | 743 |
| 4 | Ga0072941_1071323 | 3300005201 | Bacteria | 4129 |
| 5 | Ga0123353_11091364 | 3300010167 | Bacteria | 1061 |
| 6 | Ga0466700_221838 | 3300042600 | Bacteria | 1225 |
| 7 | Ga0466720_100750 | 3300042607 | Bacteria | 2849 |
| 8 | Ga0466720_133329 | 3300042607 | Bacteria | 1185 |
| 9 | Ga0255809_1023308 | 3300022820 | Bacteria | 888 |
| 10 | Ga0466694_209400 | 3300042594 | Bacteria | 1160 |
| 11 | Ga0466695_115832 | 3300042595 | Bacteria | 38752 |
| 12 | Ga0466699_004591 | 3300042597 | Bacteria | 7325 |
| 13 | Ga0466699_044609 | 3300042597 | Bacteria | 2052 |
| 14 | Ga0466699_279640 | 3300042597 | Bacteria | 1451 |
| 15 | Ga0466712_309995 | 3300042614 | Bacteria | 5210 |
| 16 | JGI24698J34947_10005554 | 3300002449 | Bacteria | 6917 |
| 17 | JGI24698J34947_10010908 | 3300002449 | Bacteria | 4985 |
| 18 | JGI24698J34947_10038965 | 3300002449 | Bacteria | 2463 |
| 19 | JGI24698J34947_10039662 | 3300002449 | Unclassified | 2437 |
| 20 | JGI24697J35500_11259354 | 3300002507 | Bacteria | 2912 |
| 21 | Ga0072940_1486133 | 3300005200 | Bacteria | 2225 |
| 22 | Ga0072941_1126749 | 3300005201 | Bacteria | 7299 |
| 23 | Ga0466702_019013 | 3300042635 | Bacteria | 6112 |
| 24 | Ga0466720_116644 | 3300042607 | Bacteria | 39029 |
| 25 | Ga0466699_312078 | 3300042597 | Bacteria | 1403 |
| 26 | Ga0466712_057089 | 3300042614 | Bacteria | 2377 |
| 27 | JGI24698J34947_10044495 | 3300002449 | Bacteria | 2272 |
| 28 | JGI24697J35500_11199787 | 3300002507 | Bacteria | 1661 |
| 29 | Ga0068305_10037760 | 3300005083 | Bacteria | 15246 |
| 30 | Ga0072941_1002176 | 3300005201 | Bacteria | 7975 |
| 31 | Ga0072941_1117853 | 3300005201 | Unclassified | 1865 |
| 32 | Ga0123353_10274952 | 3300010167 | Bacteria | 2592 |
| 33 | Ga0466694_113507 | 3300042594 | Bacteria | 1882 |
| 34 | Ga0466694_216103 | 3300042594 | Bacteria | 1784 |
| 35 | Ga0466694_356089 | 3300042594 | Bacteria | 2601 |
| 36 | Ga0466712_252128 | 3300042614 | Bacteria | 14492 |
| 37 | Ga0466718_163549 | 3300042617 | Bacteria | 2969 |
| 38 | Ga0466732_002491 | 3300042656 | Bacteria | 2011 |
| 39 | JGI24698J34947_10025212 | 3300002449 | Unclassified | 3167 |
| 40 | Ga0072941_1010952 | 3300005201 | Bacteria | 15240 |
| 41 | Ga0415639_008480 | 3300038395 | Bacteria | 4028 |
| 42 | Ga0466694_189812 | 3300042594 | Bacteria | 1750 |
| 43 | Ga0466699_122625 | 3300042597 | Bacteria | 28030 |
| 44 | Ga0466712_114698 | 3300042614 | Bacteria | 5798 |
| 45 | Ga0466732_221855 | 3300042656 | Bacteria | 3235 |
| 46 | JGI24698J34947_10000008 | 3300002449 | Bacteria | 53028 |
| 47 | JGI24698J34947_10009305 | 3300002449 | Bacteria | 5394 |
| 48 | JGI24698J34947_10011883 | 3300002449 | Unclassified | 4782 |
| 49 | JGI24702J35022_10007384 | 3300002462 | Bacteria | 6300 |
| 50 | JGI24702J35022_10244033 | 3300002462 | Bacteria | 1043 |
| 51 | Ga0072941_1006909 | 3300005201 | Bacteria | 8682 |
| 52 | Ga0072941_1060933 | 3300005201 | Bacteria | 35234 |
| 53 | Ga0466731_046737 | 3300042622 | Bacteria | 1741 |
| 54 | Ga0466731_287202 | 3300042622 | Bacteria | 1206 |
| 55 | Ga0466701_085950 | 3300042598 | Bacteria | 1732 |
| 56 | Ga0466720_039585 | 3300042607 | Bacteria | 24073 |
| 57 | Ga0264413_105024 | 3300024493 | Bacteria | 15816 |
| 58 | Ga0466694_002032 | 3300042594 | Bacteria | 2494 |
| 59 | Ga0466694_157302 | 3300042594 | Bacteria | 23788 |
| 60 | Ga0466712_093007 | 3300042614 | Bacteria | 17888 |
| 61 | Ga0466712_133181 | 3300042614 | Unclassified | 4229 |
| 62 | Ga0466712_193697 | 3300042614 | Bacteria | 7397 |
| 63 | Ga0466718_018811 | 3300042617 | Bacteria | 10561 |
| 64 | JGI24698J34947_10000363 | 3300002449 | Bacteria | 20310 |
| 65 | JGI24698J34947_10003957 | 3300002449 | Bacteria | 8058 |
| 66 | JGI24698J34947_10004403 | 3300002449 | Bacteria | 7666 |
| 67 | JGI24698J34947_10040495 | 3300002449 | Unclassified | 2405 |
| 68 | JGI24698J34947_10054465 | 3300002449 | Bacteria | 1997 |
| 69 | JGI24695J34938_10006437 | 3300002450 | Bacteria | 7052 |
| 70 | JGI24697J35500_11274794 | 3300002507 | Bacteria | 9882 |
| 71 | Ga0072941_1136861 | 3300005201 | Bacteria | 3138 |
| 72 | Ga0466702_331367 | 3300042635 | Bacteria | 1108 |
| 73 | Ga0466700_384840 | 3300042600 | Bacteria | 1545 |
| 74 | Ga0466720_014621 | 3300042607 | Bacteria | 102324 |
| 75 | Ga0466720_043332 | 3300042607 | Bacteria | 3299 |
| 76 | Ga0466698_388829 | 3300042610 | Bacteria | 2194 |
| 77 | Ga0264413_102142 | 3300024493 | Unclassified | 11913 |
| 78 | Ga0415639_062105 | 3300038395 | Bacteria | 3540 |
| 79 | Ga0466699_069557 | 3300042597 | Bacteria | 8480 |
| 80 | Ga0466699_104692 | 3300042597 | Bacteria | 11328 |
| 81 | Ga0466699_425123 | 3300042597 | Bacteria | 8414 |
| 82 | Ga0466712_097720 | 3300042614 | Unclassified | 7920 |
| 83 | Ga0466718_096947 | 3300042617 | Bacteria | 1558 |
| 84 | Ga0466732_128172 | 3300042656 | Bacteria | 5882 |
| 85 | JGI24698J34947_10009564 | 3300002449 | Bacteria | 5319 |
| 86 | JGI24698J34947_10013386 | 3300002449 | Unclassified | 4480 |
| 87 | JGI24698J34947_10062458 | 3300002449 | Bacteria | 1829 |
| 88 | Ga0072941_1012642 | 3300005201 | Bacteria | 9566 |
| 89 | Ga0072941_1030090 | 3300005201 | Bacteria | 10702 |
| 90 | Ga0072941_1195790 | 3300005201 | Bacteria | 3742 |
| 91 | Ga0123356_10785882 | 3300010049 | Bacteria | 1123 |
| 92 | Ga0466720_012656 | 3300042607 | Bacteria | 64589 |
| 93 | Ga0466720_044791 | 3300042607 | Bacteria | 8960 |
| 94 | Ga0456237_0023231 | 3300041968 | Bacteria | 850 |
| 95 | Ga0466692_010036 | 3300042591 | Unclassified | 4061 |
| 96 | Ga0466699_020298 | 3300042597 | Bacteria | 5994 |
| 97 | Ga0466712_052180 | 3300042614 | Bacteria | 8782 |
| 98 | Ga0466712_076866 | 3300042614 | Bacteria | 9043 |
| 99 | Ga0466712_192561 | 3300042614 | Bacteria | 5272 |
| 100 | Ga0466712_233008 | 3300042614 | Bacteria | 3659 |
| 101 | Ga0466712_236738 | 3300042614 | Bacteria | 10767 |
| 102 | JGI24698J34947_10102822 | 3300002449 | Bacteria | 1280 |
| 103 | JGI24702J35022_10003712 | 3300002462 | Bacteria | 9180 |
| 104 | Ga0072941_1002570 | 3300005201 | Bacteria | 31727 |
| 105 | Ga0072941_1023985 | 3300005201 | Bacteria | 19114 |
| 106 | Ga0072941_1055117 | 3300005201 | Bacteria | 3929 |
| 107 | Ga0123353_10748926 | 3300010167 | Bacteria | 1360 |
| 108 | Ga0466720_001558 | 3300042607 | Bacteria | 13350 |
| 109 | Ga0466694_043546 | 3300042594 | Bacteria | 51657 |
| 110 | Ga0466694_223559 | 3300042594 | Bacteria | 1517 |
| 111 | Ga0466712_107605 | 3300042614 | Unclassified | 2543 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300024493 | Ga0264413_102142 | Ga0264413_1021428 | 177 |
| 2 | 3300002450 | JGI24695J34938_10006437 | JGI24695J34938_100064376 | 178 |
| 3 | 3300042594 | Ga0466694_002032 | Ga0466694_002032_274_876 | 184 |
| 4 | 3300042594 | Ga0466694_043546 | Ga0466694_043546_44244_44846 | 185 |
| 5 | 3300038395 | Ga0415639_062105 | Ga0415639_062105_29_589 | 186 |
| 6 | 3300042614 | Ga0466712_052180 | Ga0466712_052180_2270_2875 | 186 |
| 7 | 3300042635 | Ga0466702_019013 | Ga0466702_019013_1948_2547 | 186 |
| 8 | 3300005201 | Ga0072941_1030090 | Ga0072941_10300904 | 187 |
| 9 | 3300038395 | Ga0415639_008480 | Ga0415639_008480_241_804 | 187 |
| 10 | 3300042656 | Ga0466732_080203 | Ga0466732_080203_2021_2629 | 187 |
| 11 | 3300002507 | JGI24697J35500_10834465 | JGI24697J35500_108344651 | 188 |
| 12 | 3300010167 | Ga0123353_10748926 | Ga0123353_107489261 | 188 |
| 13 | 3300042607 | Ga0466720_116644 | Ga0466720_116644_25746_26354 | 189 |
| 14 | 3300042597 | Ga0466699_020298 | Ga0466699_020298_1765_2376 | 190 |
| 15 | 3300002462 | JGI24702J35022_10007384 | JGI24702J35022_100073846 | 191 |
| 16 | 3300005201 | Ga0072941_1006909 | Ga0072941_10069093 | 192 |
| 17 | 3300042597 | Ga0466699_004591 | Ga0466699_004591_4639_5241 | 192 |
| 18 | 3300042607 | Ga0466720_039585 | Ga0466720_039585_22437_23042 | 192 |
| 19 | 3300042614 | Ga0466712_107605 | Ga0466712_107605_806_1417 | 192 |
| 20 | 3300042635 | Ga0466702_331367 | Ga0466702_331367_135_752 | 192 |
| 21 | 3300002449 | JGI24698J34947_10000008 | JGI24698J34947_1000000823 | 193 |
| 22 | 3300002449 | JGI24698J34947_10009305 | JGI24698J34947_100093054 | 193 |
| 23 | 3300042614 | Ga0466712_097720 | Ga0466712_097720_6258_6869 | 193 |
| 24 | 3300042614 | Ga0466712_193697 | Ga0466712_193697_5076_5687 | 195 |
| 25 | 3300002449 | JGI24698J34947_10010908 | JGI24698J34947_100109082 | 198 |
| 26 | 3300042610 | Ga0466698_388829 | Ga0466698_388829_1164_1760 | 198 |
| 27 | 3300005201 | Ga0072941_1010952 | Ga0072941_101095212 | 199 |
| 28 | 3300042591 | Ga0466692_010036 | Ga0466692_010036_2313_2936 | 199 |
| 29 | 3300042594 | Ga0466694_113507 | Ga0466694_113507_822_1421 | 199 |
| 30 | 3300042594 | Ga0466694_189812 | Ga0466694_189812_600_1199 | 199 |
| 31 | 3300042594 | Ga0466694_356089 | Ga0466694_356089_1541_2140 | 199 |
| 32 | 3300042614 | Ga0466712_057089 | Ga0466712_057089_666_1265 | 199 |
| 33 | 3300042614 | Ga0466712_192561 | Ga0466712_192561_3561_4160 | 199 |
| 34 | 3300042614 | Ga0466712_236738 | Ga0466712_236738_1180_1779 | 199 |
| 35 | 3300002449 | JGI24698J34947_10011883 | JGI24698J34947_100118834 | 200 |
| 36 | 3300002507 | JGI24697J35500_11259354 | JGI24697J35500_112593542 | 200 |
| 37 | 3300005201 | Ga0072941_1071323 | Ga0072941_10713233 | 200 |
| 38 | 3300042594 | Ga0466694_216103 | Ga0466694_216103_963_1565 | 200 |
| 39 | 3300042594 | Ga0466694_223559 | Ga0466694_223559_549_1151 | 200 |
| 40 | 3300042595 | Ga0466695_115832 | Ga0466695_115832_24977_25579 | 200 |
| 41 | 3300042597 | Ga0466699_312078 | Ga0466699_312078_535_1137 | 200 |
| 42 | 3300042607 | Ga0466720_012656 | Ga0466720_012656_8896_9498 | 200 |
| 43 | 3300042607 | Ga0466720_014621 | Ga0466720_014621_67246_67848 | 200 |
| 44 | 3300042614 | Ga0466712_093007 | Ga0466712_093007_12587_13189 | 200 |
| 45 | 3300042614 | Ga0466712_309995 | Ga0466712_309995_54_656 | 200 |
| 46 | 3300042617 | Ga0466718_096947 | Ga0466718_096947_756_1358 | 200 |
| 47 | 3300042617 | Ga0466718_163549 | Ga0466718_163549_38_640 | 200 |
| 48 | 3300042622 | Ga0466731_287202 | Ga0466731_287202_95_697 | 200 |
| 49 | 3300002449 | JGI24698J34947_10003957 | JGI24698J34947_100039575 | 201 |
| 50 | 3300002449 | JGI24698J34947_10004403 | JGI24698J34947_100044035 | 201 |
| 51 | 3300002449 | JGI24698J34947_10005554 | JGI24698J34947_100055543 | 201 |
| 52 | 3300002449 | JGI24698J34947_10009564 | JGI24698J34947_100095644 | 201 |
| 53 | 3300002449 | JGI24698J34947_10054465 | JGI24698J34947_100544652 | 201 |
| 54 | 3300005201 | Ga0072941_1002176 | Ga0072941_10021765 | 201 |
| 55 | 3300005201 | Ga0072941_1012642 | Ga0072941_10126429 | 201 |
| 56 | 3300005201 | Ga0072941_1055117 | Ga0072941_10551172 | 201 |
| 57 | 3300005201 | Ga0072941_1117853 | Ga0072941_11178531 | 201 |
| 58 | 3300010167 | Ga0123353_10274952 | Ga0123353_102749522 | 201 |
| 59 | 3300024493 | Ga0264413_105024 | Ga0264413_10502414 | 201 |
| 60 | 3300042594 | Ga0466694_157302 | Ga0466694_157302_931_1536 | 201 |
| 61 | 3300042594 | Ga0466694_209400 | Ga0466694_209400_189_794 | 201 |
| 62 | 3300042597 | Ga0466699_069557 | Ga0466699_069557_2348_2953 | 201 |
| 63 | 3300042597 | Ga0466699_104692 | Ga0466699_104692_8227_8832 | 201 |
| 64 | 3300042597 | Ga0466699_122625 | Ga0466699_122625_15125_15730 | 201 |
| 65 | 3300042597 | Ga0466699_279640 | Ga0466699_279640_776_1381 | 201 |
| 66 | 3300042597 | Ga0466699_425123 | Ga0466699_425123_1886_2491 | 201 |
| 67 | 3300042598 | Ga0466701_085950 | Ga0466701_085950_566_1171 | 201 |
| 68 | 3300042607 | Ga0466720_001558 | Ga0466720_001558_3703_4308 | 201 |
| 69 | 3300002449 | JGI24698J34947_10014103 | JGI24698J34947_100141032 | 202 |
| 70 | 3300002507 | JGI24697J35500_11274794 | JGI24697J35500_112747948 | 202 |
| 71 | 3300005201 | Ga0072941_1195790 | Ga0072941_11957902 | 202 |
| 72 | 3300010049 | Ga0123356_10785882 | Ga0123356_107858822 | 202 |
| 73 | 3300010167 | Ga0123353_11091364 | Ga0123353_110913641 | 202 |
| 74 | 3300022820 | Ga0255809_1023308 | Ga0255809_10233082 | 202 |
| 75 | 3300042597 | Ga0466699_044609 | Ga0466699_044609_833_1456 | 202 |
| 76 | 3300042600 | Ga0466700_221838 | Ga0466700_221838_499_1107 | 202 |
| 77 | 3300042607 | Ga0466720_043332 | Ga0466720_043332_2375_2983 | 202 |
| 78 | 3300042607 | Ga0466720_044791 | Ga0466720_044791_2028_2636 | 202 |
| 79 | 3300042607 | Ga0466720_100750 | Ga0466720_100750_361_969 | 202 |
| 80 | 3300042614 | Ga0466712_076866 | Ga0466712_076866_3064_3672 | 202 |
| 81 | 3300042656 | Ga0466732_221855 | Ga0466732_221855_1619_2227 | 202 |
| 82 | iso_pr_bacteria | 2781125631 | 2781267680 | 202 |
| 83 | 3300002449 | JGI24698J34947_10013386 | JGI24698J34947_100133863 | 203 |
| 84 | 3300002462 | JGI24702J35022_10003712 | JGI24702J35022_100037126 | 203 |
| 85 | 3300002462 | JGI24702J35022_10244033 | JGI24702J35022_102440332 | 203 |
| 86 | 3300005200 | Ga0072940_1486133 | Ga0072940_14861332 | 203 |
| 87 | 3300042600 | Ga0466700_384840 | Ga0466700_384840_763_1374 | 203 |
| 88 | 3300042607 | Ga0466720_133329 | Ga0466720_133329_14_625 | 203 |
| 89 | 3300042614 | Ga0466712_114698 | Ga0466712_114698_1723_2334 | 203 |
| 90 | 3300042614 | Ga0466712_233008 | Ga0466712_233008_1076_1687 | 203 |
| 91 | 3300042614 | Ga0466712_252128 | Ga0466712_252128_11836_12447 | 203 |
| 92 | 3300042656 | Ga0466732_002491 | Ga0466732_002491_1094_1705 | 203 |
| 93 | iso_pr_bacteria | 2781125689 | 2781425467 | 203 |
| 94 | 3300002449 | JGI24698J34947_10000363 | JGI24698J34947_100003634 | 204 |
| 95 | 3300002449 | JGI24698J34947_10025212 | JGI24698J34947_100252124 | 204 |
| 96 | 3300002449 | JGI24698J34947_10038965 | JGI24698J34947_100389653 | 204 |
| 97 | 3300002449 | JGI24698J34947_10039662 | JGI24698J34947_100396622 | 204 |
| 98 | 3300002449 | JGI24698J34947_10044495 | JGI24698J34947_100444952 | 204 |
| 99 | 3300002449 | JGI24698J34947_10102822 | JGI24698J34947_101028222 | 204 |
| 100 | 3300002507 | JGI24697J35500_11199787 | JGI24697J35500_111997872 | 204 |
| 101 | 3300005201 | Ga0072941_1002570 | Ga0072941_100257015 | 204 |
| 102 | 3300005201 | Ga0072941_1023985 | Ga0072941_10239855 | 204 |
| 103 | 3300005201 | Ga0072941_1136861 | Ga0072941_11368613 | 204 |
| 104 | 3300041968 | Ga0456237_0023231 | Ga0456237_0023231_17_631 | 204 |
| 105 | 3300042614 | Ga0466712_133181 | Ga0466712_133181_2824_3438 | 204 |
| 106 | 3300042617 | Ga0466718_018811 | Ga0466718_018811_4713_5327 | 204 |
| 107 | 3300002449 | JGI24698J34947_10040495 | JGI24698J34947_100404952 | 205 |
| 108 | 3300042622 | Ga0466731_046737 | Ga0466731_046737_912_1529 | 205 |
| 109 | 3300042656 | Ga0466732_128172 | Ga0466732_128172_2701_3318 | 205 |
| 110 | iso_pr_bacteria | 2781125693 | 2781434831 | 205 |
| 111 | 3300005083 | Ga0068305_10037760 | Ga0068305_100377606 | 206 |
| 112 | 3300005201 | Ga0072941_1060933 | Ga0072941_106093331 | 206 |
| 113 | 3300005201 | Ga0072941_1126749 | Ga0072941_11267494 | 206 |
| 114 | 3300002449 | JGI24698J34947_10062458 | JGI24698J34947_100624582 | 211 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13036 | LpoB | Peptidoglycan-synthase activator LpoB | 52 | 196 | 0.97 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.66 | 0.77 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.