Protein Family IF00534

Metagenome Isolate
148 Members
42 Samples
142 Scaffolds
170.56 Avg Length

🧬 Representative Sequence

ID
3300002449|JGI24698J34947_10042491|JGI24698J34947_100424912
Length
198 aa
Sequence
MGGIRTFALTCIKYHLYIIRLWCIIYNNMIDRVLIDSLNLKSRDFAVRWKDQIRNAEQLKHYQTLDDGTLIEGCMPCFPLLSRTLDRGLDRSLVGGFFVKVGKERLHNGFPVSEVIFALNVAQKVVIEFLMTEFAPDNPMRMYQSMGALTRIAEFFLLGSFYVTKGFLEETYTSMSRHDKVSEDLLKKYFKDDFFFK*

📊 Sample Types

Isolate 4.0%
Metagenome 96.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 48.8%
Kalotermitidae 22.0%
Unclassified 17.1%
Rhinotermitidae 7.3%
Termopsidae 4.9%

🌳 Taxonomy

Archaea 2
Bacteria 129
Eukaryota 0
Viruses 0
Unclassified 17

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
2 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
3 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
4 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
5 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
6 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
7 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
8 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
9 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
10 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
11 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
12 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
13 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
14 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
15 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
16 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
17 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
18 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
19 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
20 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
21 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
22 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
23 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
24 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
25 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
26 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
27 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
28 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
29 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
30 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
31 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
32 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
33 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
34 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
35 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
36 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
37 2781125688 Treponema sp. Lab288P4bin13 Isolate Unclassified
38 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
39 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
40 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
41 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
42 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123354_10154206 3300010882 Bacteria 2765
2 JGI24698J34947_10023007 3300002449 Bacteria 3336
3 JGI24698J34947_10100919 3300002449 Unclassified 1298
4 Ga0072941_1066292 3300005201 Bacteria 1130
5 Ga0466698_234047 3300042610 Bacteria 1484
6 Ga0466690_019729 3300042590 Bacteria 15763
7 Ga0466690_336508 3300042590 Bacteria 10825
8 Ga0466691_176333 3300042593 Bacteria 9039
9 Ga0466699_064800 3300042597 Bacteria 4798
10 Ga0466712_016274 3300042614 Bacteria 13608
11 Ga0466712_195733 3300042614 Unclassified 1862
12 Ga0466712_279233 3300042614 Bacteria 8785
13 Ga0466703_003106 3300042636 Bacteria 32370
14 JGI24698J34947_10002354 3300002449 Bacteria 10172
15 JGI24698J34947_10006683 3300002449 Bacteria 6333
16 JGI24698J34947_10013742 3300002449 Bacteria 4410
17 JGI24698J34947_10021587 3300002449 Bacteria 3459
18 JGI24698J34947_10080285 3300002449 Unclassified 1533
19 JGI24698J34947_10106077 3300002449 Bacteria 1251
20 JGI24699J35502_11126624 3300002509 Bacteria 3995
21 Ga0072941_1031745 3300005201 Bacteria 3248
22 Ga0072941_1057518 3300005201 Bacteria 2546
23 Ga0466692_051610 3300042591 Bacteria 6399
24 Ga0466699_009400 3300042597 Bacteria 1871
25 Ga0466699_179096 3300042597 Bacteria 1089
26 Ga0466712_018786 3300042614 Bacteria 3452
27 Ga0466712_030109 3300042614 Bacteria 1815
28 Ga0466712_094637 3300042614 Bacteria 5761
29 Ga0466712_101071 3300042614 Bacteria 19503
30 Ga0466712_196166 3300042614 Bacteria 10205
31 Ga0466703_187584 3300042636 Bacteria 1387
32 Ga0466727_050357 3300042655 Bacteria 3001
33 Ga0466733_174334 3300042659 Bacteria 1265
34 Ga0123353_10471717 3300010167 Bacteria 1840
35 JGI24698J34947_10015817 3300002449 Bacteria 4103
36 JGI24698J34947_10030811 3300002449 Bacteria 2827
37 JGI24698J34947_10042491 3300002449 Bacteria 2335
38 JGI24698J34947_10058550 3300002449 Unclassified 1907
39 JGI24698J34947_10080284 3300002449 Bacteria 1533
40 JGI24698J34947_10156737 3300002449 Bacteria 938
41 Ga0466722_058856 3300042609 Bacteria 1710
42 Ga0466722_123447 3300042609 Bacteria 25254
43 Ga0466698_254369 3300042610 Bacteria 3210
44 Ga0415639_094940 3300038395 Bacteria 2936
45 Ga0466694_233481 3300042594 Bacteria 1190
46 Ga0466695_330656 3300042595 Bacteria 23944
47 Ga0466699_105364 3300042597 Bacteria 4552
48 Ga0466699_188118 3300042597 Bacteria 11803
49 Ga0466712_029559 3300042614 Bacteria 21198
50 Ga0466712_158367 3300042614 Unclassified 9867
51 Ga0466712_283400 3300042614 Bacteria 1058
52 Ga0466715_278161 3300042616 Bacteria 20583
53 Ga0466702_250998 3300042635 Bacteria 13798
54 Ga0466702_456698 3300042635 Bacteria 1328
55 Ga0123353_10210538 3300010167 Bacteria 3049
56 JGI24698J34947_10004811 3300002449 Bacteria 7385
57 JGI24698J34947_10051955 3300002449 Unclassified 2058
58 JGI24698J34947_10126450 3300002449 Bacteria 1100
59 JGI24698J34947_10149223 3300002449 Unclassified 973
60 JGI24698J34947_10151386 3300002449 Unclassified 963
61 JGI24695J34938_10187441 3300002450 Bacteria 858
62 Ga0072941_1022309 3300005201 Bacteria 5386
63 Ga0072941_1033075 3300005201 Bacteria 2338
64 Ga0072941_1066277 3300005201 Unclassified 1711
65 Ga0466700_181981 3300042600 Bacteria 1469
66 Ga0466698_276120 3300042610 Bacteria 1805
67 Ga0466657_150012 3300042582 Bacteria 2222
68 Ga0466699_059593 3300042597 Bacteria 1158
69 Ga0466712_022229 3300042614 Bacteria 2870
70 Ga0466712_193846 3300042614 Bacteria 14554
71 Ga0466726_335204 3300042619 Bacteria 1000
72 Ga0466704_236485 3300042643 Bacteria 37744
73 Ga0466709_340614 3300042648 Bacteria 7512
74 AustNasuHG_c1010325 3300000089 Bacteria 3255
75 JGI24698J34947_10017981 3300002449 Bacteria 3826
76 Ga0072941_1115872 3300005201 Bacteria 2100
77 Ga0466700_172209 3300042600 Bacteria 1157
78 Ga0466722_077709 3300042609 Bacteria 9068
79 Ga0466698_502714 3300042610 Bacteria 1443
80 Ga0466699_073409 3300042597 Bacteria 12367
81 Ga0466699_280968 3300042597 Bacteria 14109
82 Ga0466712_011126 3300042614 Bacteria 1908
83 Ga0466712_061257 3300042614 Bacteria 1676
84 Ga0466712_169423 3300042614 Bacteria 10051
85 Ga0466712_307983 3300042614 Bacteria 4478
86 Ga0466712_316562 3300042614 Unclassified 2087
87 Ga0466705_049406 3300042612 Bacteria 6601
88 Ga0123353_10802087 3300010167 Bacteria 1300
89 Ga0123354_10021784 3300010882 Bacteria 10102
90 JGI24698J34947_10001695 3300002449 Bacteria 11783
91 JGI24698J34947_10001921 3300002449 Bacteria 11065
92 JGI24698J34947_10018480 3300002449 Bacteria 3765
93 JGI24698J34947_10019125 3300002449 Bacteria 3698
94 JGI24698J34947_10040163 3300002449 Bacteria 2418
95 JGI24698J34947_10050639 3300002449 Bacteria 2093
96 JGI24698J34947_10101554 3300002449 Bacteria 1292
97 JGI24698J34947_10109123 3300002449 Bacteria 1226
98 Ga0072941_1115873 3300005201 Unclassified 1194
99 Ga0466698_386900 3300042610 Bacteria 2201
100 Ga0466692_152387 3300042591 Bacteria 29225
101 Ga0466695_301320 3300042595 Bacteria 1360
102 Ga0466699_164551 3300042597 Bacteria 1215
103 Ga0466699_337441 3300042597 Bacteria 2104
104 Ga0466712_032417 3300042614 Bacteria 10721
105 Ga0466712_093476 3300042614 Bacteria 14863
106 Ga0466712_238960 3300042614 Unclassified 1356
107 Ga0466712_254584 3300042614 Archaea 5287
108 Ga0466723_120152 3300042618 Bacteria 26361
109 Ga0466726_298641 3300042619 Unclassified 1114
110 Ga0466726_313078 3300042619 Bacteria 3588
111 Ga0466703_257815 3300042636 Bacteria 1100
112 Ga0123356_10670081 3300010049 Bacteria 1205
113 Ga0123353_10213867 3300010167 Bacteria 3021
114 Ga0072941_1001530 3300005201 Bacteria 8298
115 Ga0072941_1011779 3300005201 Bacteria 29388
116 Ga0072941_1021564 3300005201 Bacteria 10609
117 Ga0466700_312034 3300042600 Bacteria 5174
118 Ga0466707_381074 3300042601 Bacteria 1109
119 Ga0456237_0009667 3300041968 Bacteria 1434
120 Ga0466712_118912 3300042614 Bacteria 3773
121 Ga0466712_235198 3300042614 Unclassified 5374
122 Ga0466712_248752 3300042614 Bacteria 4553
123 Ga0466704_022527 3300042643 Unclassified 2186
124 Ga0466705_076053 3300042612 Bacteria 41201
125 Ga0466733_072759 3300042659 Bacteria 51080
126 JGI24698J34947_10003509 3300002449 Bacteria 8517
127 JGI24698J34947_10015200 3300002449 Archaea 4192
128 JGI24698J34947_10042063 3300002449 Bacteria 2350
129 JGI24698J34947_10048138 3300002449 Unclassified 2161
130 JGI24698J34947_10053577 3300002449 Bacteria 2018
131 JGI24698J34947_10235082 3300002449 Bacteria 694
132 JGI24702J35022_10003632 3300002462 Bacteria 9294
133 Ga0072941_1058198 3300005201 Unclassified 6641
134 Ga0466717_224278 3300042604 Bacteria 1949
135 Ga0466656_032644 3300042550 Bacteria 1290
136 Ga0466692_136853 3300042591 Bacteria 7958
137 Ga0466699_013348 3300042597 Bacteria 2132
138 Ga0466699_041707 3300042597 Bacteria 2480
139 Ga0466699_180190 3300042597 Bacteria 9824
140 Ga0466711_007410 3300042615 Bacteria 2634
141 Ga0466727_103857 3300042655 Bacteria 4071
142 Ga0466727_142779 3300042655 Bacteria 2123

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300002449 JGI24698J34947_10126450 JGI24698J34947_101264501 159
2 3300042590 Ga0466690_019729 Ga0466690_019729_8174_8689 159
3 3300042659 Ga0466733_072759 Ga0466733_072759_27593_28114 163
4 3300042614 Ga0466712_032417 Ga0466712_032417_5080_5577 165
5 3300042614 Ga0466712_169423 Ga0466712_169423_2258_2755 165
6 3300002449 JGI24698J34947_10030811 JGI24698J34947_100308112 166
7 3300042619 Ga0466726_335204 Ga0466726_335204_13_513 166
8 3300005201 Ga0072941_1022309 Ga0072941_10223092 168
9 3300042614 Ga0466712_158367 Ga0466712_158367_2828_3334 168
10 3300002449 JGI24698J34947_10080284 JGI24698J34947_100802842 169
11 3300042600 Ga0466700_312034 Ga0466700_312034_4226_4735 169
12 3300042614 Ga0466712_011126 Ga0466712_011126_473_982 169
13 3300042614 Ga0466712_016274 Ga0466712_016274_399_908 169
14 3300042614 Ga0466712_018786 Ga0466712_018786_1200_1709 169
15 3300042614 Ga0466712_022229 Ga0466712_022229_2102_2611 169
16 3300042614 Ga0466712_094637 Ga0466712_094637_73_582 169
17 3300042614 Ga0466712_101071 Ga0466712_101071_6237_6746 169
18 3300042614 Ga0466712_118912 Ga0466712_118912_2564_3073 169
19 3300042614 Ga0466712_193846 Ga0466712_193846_342_851 169
20 3300042614 Ga0466712_196166 Ga0466712_196166_6658_7167 169
21 3300042614 Ga0466712_235198 Ga0466712_235198_4326_4835 169
22 3300042614 Ga0466712_238960 Ga0466712_238960_196_705 169
23 3300042614 Ga0466712_279233 Ga0466712_279233_160_669 169
24 3300042635 Ga0466702_250998 Ga0466702_250998_9382_9891 169
25 3300002449 JGI24698J34947_10001695 JGI24698J34947_1000169513 170
26 3300002449 JGI24698J34947_10002354 JGI24698J34947_100023542 170
27 3300002449 JGI24698J34947_10003509 JGI24698J34947_100035092 170
28 3300002449 JGI24698J34947_10017981 JGI24698J34947_100179815 170
29 3300002449 JGI24698J34947_10018480 JGI24698J34947_100184805 170
30 3300002449 JGI24698J34947_10023007 JGI24698J34947_100230072 170
31 3300002449 JGI24698J34947_10040163 JGI24698J34947_100401632 170
32 3300002449 JGI24698J34947_10042063 JGI24698J34947_100420633 170
33 3300002449 JGI24698J34947_10048138 JGI24698J34947_100481383 170
34 3300002449 JGI24698J34947_10058550 JGI24698J34947_100585502 170
35 3300002449 JGI24698J34947_10080285 JGI24698J34947_100802851 170
36 3300002449 JGI24698J34947_10100919 JGI24698J34947_101009192 170
37 3300002449 JGI24698J34947_10106077 JGI24698J34947_101060771 170
38 3300002449 JGI24698J34947_10149223 JGI24698J34947_101492232 170
39 3300002449 JGI24698J34947_10151386 JGI24698J34947_101513862 170
40 3300002449 JGI24698J34947_10156737 JGI24698J34947_101567371 170
41 3300002449 JGI24698J34947_10235082 JGI24698J34947_102350822 170
42 3300005201 Ga0072941_1001530 Ga0072941_10015307 170
43 3300005201 Ga0072941_1011779 Ga0072941_101177921 170
44 3300005201 Ga0072941_1021564 Ga0072941_10215644 170
45 3300005201 Ga0072941_1031745 Ga0072941_10317452 170
46 3300005201 Ga0072941_1033075 Ga0072941_10330753 170
47 3300005201 Ga0072941_1066277 Ga0072941_10662772 170
48 3300005201 Ga0072941_1066292 Ga0072941_10662922 170
49 3300010167 Ga0123353_10210538 Ga0123353_102105383 170
50 3300042597 Ga0466699_013348 Ga0466699_013348_781_1293 170
51 3300042597 Ga0466699_041707 Ga0466699_041707_847_1359 170
52 3300042597 Ga0466699_064800 Ga0466699_064800_2237_2749 170
53 3300042597 Ga0466699_073409 Ga0466699_073409_2369_2881 170
54 3300042597 Ga0466699_105364 Ga0466699_105364_2291_2803 170
55 3300042597 Ga0466699_164551 Ga0466699_164551_650_1162 170
56 3300042597 Ga0466699_179096 Ga0466699_179096_503_1015 170
57 3300042597 Ga0466699_188118 Ga0466699_188118_10253_10765 170
58 3300042597 Ga0466699_337441 Ga0466699_337441_980_1492 170
59 3300042604 Ga0466717_224278 Ga0466717_224278_1066_1578 170
60 3300042609 Ga0466722_058856 Ga0466722_058856_236_748 170
61 3300042610 Ga0466698_386900 Ga0466698_386900_1437_1949 170
62 3300042614 Ga0466712_093476 Ga0466712_093476_4628_5140 170
63 3300042614 Ga0466712_195733 Ga0466712_195733_784_1296 170
64 3300042619 Ga0466726_313078 Ga0466726_313078_1792_2304 170
65 3300042635 Ga0466702_456698 Ga0466702_456698_152_664 170
66 iso_pr_bacteria 2781125687 2781419876 170
67 3300002449 JGI24698J34947_10019125 JGI24698J34947_100191256 171
68 3300002449 JGI24698J34947_10051955 JGI24698J34947_100519552 171
69 3300010049 Ga0123356_10670081 Ga0123356_106700812 171
70 3300010167 Ga0123353_10213867 Ga0123353_102138672 171
71 3300010167 Ga0123353_10802087 Ga0123353_108020872 171
72 3300010882 Ga0123354_10021784 Ga0123354_100217847 171
73 3300038395 Ga0415639_094940 Ga0415639_094940_374_889 171
74 3300041968 Ga0456237_0009667 Ga0456237_0009667_898_1413 171
75 3300042550 Ga0466656_032644 Ga0466656_032644_10_525 171
76 3300042582 Ga0466657_150012 Ga0466657_150012_1040_1555 171
77 3300042590 Ga0466690_336508 Ga0466690_336508_10098_10613 171
78 3300042591 Ga0466692_136853 Ga0466692_136853_3859_4374 171
79 3300042591 Ga0466692_152387 Ga0466692_152387_16978_17493 171
80 3300042593 Ga0466691_176333 Ga0466691_176333_518_1033 171
81 3300042595 Ga0466695_301320 Ga0466695_301320_478_993 171
82 3300042595 Ga0466695_330656 Ga0466695_330656_12050_12565 171
83 3300042597 Ga0466699_009400 Ga0466699_009400_924_1439 171
84 3300042597 Ga0466699_059593 Ga0466699_059593_152_667 171
85 3300042597 Ga0466699_180190 Ga0466699_180190_9006_9521 171
86 3300042597 Ga0466699_280968 Ga0466699_280968_3039_3554 171
87 3300042600 Ga0466700_172209 Ga0466700_172209_284_799 171
88 3300042600 Ga0466700_181981 Ga0466700_181981_659_1174 171
89 3300042601 Ga0466707_381074 Ga0466707_381074_300_815 171
90 3300042609 Ga0466722_077709 Ga0466722_077709_3661_4176 171
91 3300042610 Ga0466698_234047 Ga0466698_234047_46_561 171
92 3300042610 Ga0466698_254369 Ga0466698_254369_757_1272 171
93 3300042610 Ga0466698_276120 Ga0466698_276120_624_1139 171
94 3300042610 Ga0466698_502714 Ga0466698_502714_523_1038 171
95 3300042612 Ga0466705_049406 Ga0466705_049406_5295_5810 171
96 3300042614 Ga0466712_029559 Ga0466712_029559_16521_17036 171
97 3300042614 Ga0466712_030109 Ga0466712_030109_881_1396 171
98 3300042614 Ga0466712_061257 Ga0466712_061257_857_1372 171
99 3300042614 Ga0466712_248752 Ga0466712_248752_1522_2037 171
100 3300042614 Ga0466712_254584 Ga0466712_254584_1362_1877 171
101 3300042614 Ga0466712_283400 Ga0466712_283400_240_755 171
102 3300042614 Ga0466712_307983 Ga0466712_307983_2196_2711 171
103 3300042614 Ga0466712_316562 Ga0466712_316562_1405_1920 171
104 3300042615 Ga0466711_007410 Ga0466711_007410_1624_2139 171
105 3300042616 Ga0466715_278161 Ga0466715_278161_16763_17278 171
106 3300042618 Ga0466723_120152 Ga0466723_120152_25587_26102 171
107 3300042619 Ga0466726_298641 Ga0466726_298641_514_1029 171
108 3300042636 Ga0466703_003106 Ga0466703_003106_29966_30481 171
109 3300042636 Ga0466703_187584 Ga0466703_187584_220_735 171
110 3300042636 Ga0466703_257815 Ga0466703_257815_209_724 171
111 3300042643 Ga0466704_022527 Ga0466704_022527_806_1321 171
112 3300042648 Ga0466709_340614 Ga0466709_340614_6812_7327 171
113 3300042655 Ga0466727_050357 Ga0466727_050357_1021_1536 171
114 3300042655 Ga0466727_103857 Ga0466727_103857_391_906 171
115 3300042655 Ga0466727_142779 Ga0466727_142779_449_964 171
116 iso_pr_bacteria 2781125688 2781424601 171
117 iso_pr_bacteria 2781125689 2781425517 171
118 iso_pr_bacteria 2781125694 2781436022 171
119 iso_pr_bacteria 2781125697 2781442487 171
120 iso_pr_bacteria 650716099 650880247 171
121 3300000089 AustNasuHG_c1010325 AustNasuHG_10103254 172
122 3300002449 JGI24698J34947_10001921 JGI24698J34947_100019216 172
123 3300002449 JGI24698J34947_10004811 JGI24698J34947_100048116 172
124 3300002449 JGI24698J34947_10006683 JGI24698J34947_100066834 172
125 3300002449 JGI24698J34947_10013742 JGI24698J34947_100137427 172
126 3300002449 JGI24698J34947_10015200 JGI24698J34947_100152006 172
127 3300002449 JGI24698J34947_10015817 JGI24698J34947_100158176 172
128 3300002449 JGI24698J34947_10021587 JGI24698J34947_100215874 172
129 3300002449 JGI24698J34947_10050639 JGI24698J34947_100506393 172
130 3300002449 JGI24698J34947_10053577 JGI24698J34947_100535773 172
131 3300002449 JGI24698J34947_10101554 JGI24698J34947_101015541 172
132 3300002449 JGI24698J34947_10109123 JGI24698J34947_101091232 172
133 3300002462 JGI24702J35022_10003632 JGI24702J35022_1000363211 172
134 3300002509 JGI24699J35502_11126624 JGI24699J35502_111266245 172
135 3300005201 Ga0072941_1058198 Ga0072941_10581982 172
136 3300005201 Ga0072941_1115872 Ga0072941_11158722 172
137 3300010882 Ga0123354_10154206 Ga0123354_101542062 172
138 3300042609 Ga0466722_123447 Ga0466722_123447_22448_22966 172
139 3300042612 Ga0466705_076053 Ga0466705_076053_37476_37994 172
140 3300042643 Ga0466704_236485 Ga0466704_236485_3280_3798 172
141 3300042659 Ga0466733_174334 Ga0466733_174334_506_1024 172
142 3300010167 Ga0123353_10471717 Ga0123353_104717172 173
143 3300042594 Ga0466694_233481 Ga0466694_233481_112_633 173
144 3300002450 JGI24695J34938_10187441 JGI24695J34938_101874412 174
145 3300005201 Ga0072941_1057518 Ga0072941_10575182 174
146 3300005201 Ga0072941_1115873 Ga0072941_11158732 174
147 3300042591 Ga0466692_051610 Ga0466692_051610_3073_3606 177
148 3300002449 JGI24698J34947_10042491 JGI24698J34947_100424912 198

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
3zta-assembly1.cif.gz_A-2 The bacterial stressosome: a modular system that has been adapted to control secondary messenger signaling 0.83 42 173
3pmc-assembly1.cif.gz_B Crystal structure of the sporulation inhibitor pXO2-61 from Bacillus anthracis 0.813 34 171
3pmd-assembly1.cif.gz_A-2 Crystal structure of the sporulation inhibitor pXO1-118 from Bacillus anthracis 0.786 30 184
5ohf-assembly4.cif.gz_G Globin sensor domain of AfGcHK (FeIII form) in complex with cyanide, partially reduced 0.76 27 167
5ohf-assembly2.cif.gz_C Globin sensor domain of AfGcHK (FeIII form) in complex with cyanide, partially reduced 0.752 27 167
IDDescriptionScoreStartEndSuperfamily
3pmcA00 Mainly Alpha;Orthogonal Bundle;Globin-like;Histidine kinase N-terminal domain 0.8138 33 171 1.10.490.70
1ykuB00 Mainly Alpha;Orthogonal Bundle;Globin-like;Histidine kinase N-terminal domain 0.8113 34 170 1.10.490.70
3pmdA00 Mainly Alpha;Orthogonal Bundle;Globin-like;Histidine kinase N-terminal domain 0.7856 30 184 1.10.490.70
6m9aC00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.7402 30 167 1.10.490.10
af_A4I382_78_219_1.10.490.10 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.7392 35 166 1.10.490.10
IDDescriptionScoreStartEndGO Terms
AF-F5YRJ9-F1-model_v4 RsbT co-antagonist protein RsbRD N-terminal domain-containing protein 0.9271 33 197
AF-A0A7V3NZD3-F1-model_v4 Uncharacterized/unreviewed 0.9184 33 176

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.77 0.82 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.