Protein Family IF00525
Metagenome
Isolate
192
Members
71
Samples
186
Scaffolds
260.02
Avg Length
Representative Sequence
- ID
- 3300002449|JGI24698J34947_10031812|JGI24698J34947_100318123
- Length
- 287 aa
- Sequence
- VARPLSAVAYTETLREKTINLTCGGNIVSYWTDLSIDFANQRNYLDELFKIYPTTPDGIRDIDEDLWESIEKSFNNRNNVDLIAHLLRLDLFPLKDSYVAYLKRDPDAIQRNPNTINRLCGRLYDMGLDKIFERCSEPKETNRQIGPLFKRWLDNGGLGIKPVKIDDFQKNEENAILDASDTAMKSWCADHLYYVRDKGLDFVGRFNKKYVIGEAKFLTDFGGHQDTQFSDAISTITSSVDAITIAILDGVLYIKTKNKMHKNITETYSDYNIMSALVLRDFLYSL*
Sample Types
Isolate
3.1%
Metagenome
96.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
46.4%
Kalotermitidae
20.3%
Unclassified
13.0%
Formicidae
7.2%
Rhinotermitidae
5.8%
Termopsidae
4.3%
Hodotermitidae
1.4%
Passalidae
1.4%
Taxonomy
Archaea
2
Bacteria
165
Eukaryota
0
Viruses
0
Unclassified
25
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 2 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 3 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 4 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 5 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 6 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 7 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 8 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 9 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 10 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 11 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 12 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 13 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 14 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 15 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 16 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 17 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 18 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 19 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 20 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 21 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 22 | 2684622742 | Methanobrevibacter curvatus DSM11111 | Isolate | Unclassified |
| 23 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 24 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 25 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 26 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 27 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 28 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 29 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 30 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 31 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 32 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 33 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 34 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
| 35 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 36 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 37 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 38 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 39 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 40 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 41 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 42 | 2820025825 | Unclassified Spirochaetes Lab288P1bin8 | Isolate | Unclassified |
| 43 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 44 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 45 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 46 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 47 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 48 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 49 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 50 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 51 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 52 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 53 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 54 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 55 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 56 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 57 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 58 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 59 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 60 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 61 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 62 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 63 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 64 | 2820180635 | Unclassified Planctomycetes Lab288P3bin24 | Isolate | Unclassified |
| 65 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 66 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 67 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 68 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 69 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 70 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 71 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10198107 | 3300010049 | Unclassified | 2046 |
| 2 | Ga0123353_11186717 | 3300010167 | Bacteria | 1003 |
| 3 | JGI24698J34947_10019871 | 3300002449 | Unclassified | 3619 |
| 4 | JGI24702J35022_10122943 | 3300002462 | Bacteria | 1435 |
| 5 | JGI24702J35022_10262676 | 3300002462 | Unclassified | 1008 |
| 6 | Ga0068305_10078298 | 3300005083 | Unclassified | 1493 |
| 7 | Ga0466706_034499 | 3300042599 | Bacteria | 31321 |
| 8 | Ga0466707_244835 | 3300042601 | Bacteria | 2502 |
| 9 | Ga0466713_013184 | 3300042602 | Bacteria | 3454 |
| 10 | Ga0466714_076451 | 3300042603 | Bacteria | 1183 |
| 11 | Ga0466717_249333 | 3300042604 | Unclassified | 2340 |
| 12 | Ga0466719_076568 | 3300042606 | Bacteria | 6524 |
| 13 | Ga0466722_263896 | 3300042609 | Bacteria | 3228 |
| 14 | Ga0466698_347323 | 3300042610 | Bacteria | 1711 |
| 15 | Ga0466705_445328 | 3300042612 | Bacteria | 1760 |
| 16 | Ga0466711_067580 | 3300042615 | Bacteria | 6465 |
| 17 | Ga0466715_050246 | 3300042616 | Bacteria | 2592 |
| 18 | Ga0466715_365724 | 3300042616 | Bacteria | 1137 |
| 19 | Ga0466718_124198 | 3300042617 | Bacteria | 1222 |
| 20 | Ga0466726_108141 | 3300042619 | Bacteria | 2017 |
| 21 | Ga0466691_123258 | 3300042593 | Bacteria | 1690 |
| 22 | Ga0466731_125327 | 3300042622 | Unclassified | 15302 |
| 23 | Ga0466709_123014 | 3300042648 | Unclassified | 2579 |
| 24 | Ga0466708_294508 | 3300042652 | Bacteria | 46075 |
| 25 | Ga0466725_022888 | 3300042654 | Bacteria | 2181 |
| 26 | Ga0123357_10147296 | 3300009784 | Bacteria | 2870 |
| 27 | Ga0123356_10049096 | 3300010049 | Bacteria | 3928 |
| 28 | Ga0123353_10150317 | 3300010167 | Bacteria | 3719 |
| 29 | Ga0123353_10289886 | 3300010167 | Bacteria | 2507 |
| 30 | Ga0123353_10831167 | 3300010167 | Bacteria | 1270 |
| 31 | Ga0123354_10312079 | 3300010882 | Unclassified | 1466 |
| 32 | 2227278015 | 2225789004 | Archaea | 6848 |
| 33 | JGI24702J35022_10008326 | 3300002462 | Bacteria | 5874 |
| 34 | JGI24702J35022_10095903 | 3300002462 | Bacteria | 1618 |
| 35 | Ga0072941_1390418 | 3300005201 | Bacteria | 2140 |
| 36 | Ga0466700_255159 | 3300042600 | Bacteria | 1923 |
| 37 | Ga0466707_289605 | 3300042601 | Bacteria | 3081 |
| 38 | Ga0466714_168011 | 3300042603 | Bacteria | 2550 |
| 39 | Ga0466717_157528 | 3300042604 | Bacteria | 2038 |
| 40 | Ga0466716_014562 | 3300042605 | Bacteria | 2311 |
| 41 | Ga0466716_482624 | 3300042605 | Unclassified | 4730 |
| 42 | Ga0466719_022205 | 3300042606 | Bacteria | 9780 |
| 43 | Ga0466711_418449 | 3300042615 | Bacteria | 7652 |
| 44 | Ga0466718_113412 | 3300042617 | Bacteria | 1209 |
| 45 | Ga0466726_465860 | 3300042619 | Bacteria | 6629 |
| 46 | Ga0466690_232763 | 3300042590 | Bacteria | 1610 |
| 47 | Ga0466690_380155 | 3300042590 | Bacteria | 3357 |
| 48 | Ga0466691_042030 | 3300042593 | Bacteria | 3168 |
| 49 | Ga0466735_006284 | 3300042624 | Bacteria | 1668 |
| 50 | Ga0466735_066722 | 3300042624 | Bacteria | 2467 |
| 51 | Ga0466704_509064 | 3300042643 | Bacteria | 2727 |
| 52 | Ga0466708_364317 | 3300042652 | Bacteria | 9956 |
| 53 | Ga0466727_019761 | 3300042655 | Bacteria | 1015 |
| 54 | Ga0123355_10016695 | 3300009826 | Bacteria | 11583 |
| 55 | Ga0123353_10026823 | 3300010167 | Bacteria | 8810 |
| 56 | Ga0123353_10417117 | 3300010167 | Unclassified | 1991 |
| 57 | Ga0123354_10331729 | 3300010882 | Unclassified | 1385 |
| 58 | Ga0072940_1044166 | 3300005200 | Unclassified | 3185 |
| 59 | Ga0072941_1353510 | 3300005201 | Bacteria | 1252 |
| 60 | Ga0466706_138670 | 3300042599 | Bacteria | 17605 |
| 61 | Ga0466707_294232 | 3300042601 | Bacteria | 3157 |
| 62 | Ga0466713_007347 | 3300042602 | Bacteria | 1543 |
| 63 | Ga0466714_053027 | 3300042603 | Bacteria | 1683 |
| 64 | Ga0466719_082516 | 3300042606 | Bacteria | 1259 |
| 65 | Ga0466719_423274 | 3300042606 | Bacteria | 1773 |
| 66 | Ga0466705_257675 | 3300042612 | Bacteria | 21585 |
| 67 | Ga0466712_012164 | 3300042614 | Bacteria | 2123 |
| 68 | Ga0466712_217288 | 3300042614 | Bacteria | 3404 |
| 69 | Ga0466711_421374 | 3300042615 | Bacteria | 3253 |
| 70 | Ga0466718_077799 | 3300042617 | Bacteria | 2269 |
| 71 | Ga0466723_087233 | 3300042618 | Unclassified | 4907 |
| 72 | Ga0466726_248239 | 3300042619 | Bacteria | 1686 |
| 73 | Ga0466729_133234 | 3300042621 | Unclassified | 6354 |
| 74 | Ga0466690_223274 | 3300042590 | Bacteria | 2515 |
| 75 | Ga0466695_344238 | 3300042595 | Bacteria | 3363 |
| 76 | Ga0466734_067446 | 3300042623 | Bacteria | 2093 |
| 77 | Ga0466702_160181 | 3300042635 | Bacteria | 1571 |
| 78 | Ga0123357_10363574 | 3300009784 | Bacteria | 1367 |
| 79 | Ga0123356_10690167 | 3300010049 | Unclassified | 1190 |
| 80 | Ga0123353_10689554 | 3300010167 | Unclassified | 1436 |
| 81 | JGI24696J40584_12960941 | 3300002834 | Bacteria | 9548 |
| 82 | Ga0072940_1027426 | 3300005200 | Bacteria | 2318 |
| 83 | Ga0103265_1013842 | 3300007068 | Unclassified | 1053 |
| 84 | Ga0102735_1000309 | 3300007080 | Unclassified | 18588 |
| 85 | Ga0466733_079582 | 3300042659 | Bacteria | 3246 |
| 86 | Ga0466706_272460 | 3300042599 | Bacteria | 119515 |
| 87 | Ga0466712_108774 | 3300042614 | Bacteria | 1127 |
| 88 | Ga0466711_148604 | 3300042615 | Bacteria | 1828 |
| 89 | Ga0466715_050573 | 3300042616 | Bacteria | 7613 |
| 90 | Ga0466723_346610 | 3300042618 | Unclassified | 2140 |
| 91 | Ga0466726_158894 | 3300042619 | Bacteria | 1381 |
| 92 | Ga0466728_226079 | 3300042620 | Bacteria | 2423 |
| 93 | Ga0466729_125671 | 3300042621 | Bacteria | 2383 |
| 94 | Ga0264413_101222 | 3300024493 | Bacteria | 6339 |
| 95 | Ga0466690_165152 | 3300042590 | Unclassified | 3182 |
| 96 | Ga0466692_121037 | 3300042591 | Bacteria | 2687 |
| 97 | Ga0466696_123746 | 3300042596 | Bacteria | 3224 |
| 98 | Ga0466704_127982 | 3300042643 | Bacteria | 28123 |
| 99 | Ga0466727_001628 | 3300042655 | Bacteria | 1709 |
| 100 | Ga0123356_10218495 | 3300010049 | Bacteria | 1960 |
| 101 | Ga0123353_10170456 | 3300010167 | Bacteria | 3456 |
| 102 | JGI24698J34947_10031812 | 3300002449 | Bacteria | 2774 |
| 103 | JGI24696J40584_12951311 | 3300002834 | Bacteria | 2231 |
| 104 | Ga0072941_1126393 | 3300005201 | Bacteria | 2622 |
| 105 | Ga0466701_081495 | 3300042598 | Bacteria | 3361 |
| 106 | Ga0466707_044020 | 3300042601 | Bacteria | 10192 |
| 107 | Ga0466707_189241 | 3300042601 | Bacteria | 5638 |
| 108 | Ga0466707_198931 | 3300042601 | Bacteria | 8885 |
| 109 | Ga0466716_042436 | 3300042605 | Unclassified | 5273 |
| 110 | Ga0466716_149541 | 3300042605 | Bacteria | 9311 |
| 111 | Ga0466716_236306 | 3300042605 | Bacteria | 6323 |
| 112 | Ga0466716_429742 | 3300042605 | Bacteria | 2397 |
| 113 | Ga0466716_461578 | 3300042605 | Bacteria | 1301 |
| 114 | Ga0466719_026307 | 3300042606 | Bacteria | 8745 |
| 115 | Ga0466711_423266 | 3300042615 | Bacteria | 37149 |
| 116 | Ga0466691_045616 | 3300042593 | Bacteria | 3772 |
| 117 | Ga0466699_135008 | 3300042597 | Bacteria | 3891 |
| 118 | Ga0466731_033720 | 3300042622 | Bacteria | 2567 |
| 119 | Ga0466708_189623 | 3300042652 | Bacteria | 33112 |
| 120 | Ga0123356_10115584 | 3300010049 | Bacteria | 2600 |
| 121 | Ga0123353_11178435 | 3300010167 | Bacteria | 1008 |
| 122 | JGI24698J34947_10014209 | 3300002449 | Unclassified | 4335 |
| 123 | JGI24695J34938_10021559 | 3300002450 | Bacteria | 3148 |
| 124 | JGI24702J35022_10039247 | 3300002462 | Bacteria | 2527 |
| 125 | JGI24702J35022_10224090 | 3300002462 | Bacteria | 1085 |
| 126 | JGI24696J40584_12943790 | 3300002834 | Bacteria | 1787 |
| 127 | Ga0102734_1000250 | 3300007129 | Bacteria | 20105 |
| 128 | Ga0466720_011308 | 3300042607 | Bacteria | 1648 |
| 129 | Ga0466697_087367 | 3300042611 | Bacteria | 1343 |
| 130 | Ga0466710_097916 | 3300042613 | Bacteria | 1494 |
| 131 | Ga0466711_015953 | 3300042615 | Bacteria | 2630 |
| 132 | Ga0466711_236984 | 3300042615 | Bacteria | 1619 |
| 133 | Ga0466718_134484 | 3300042617 | Bacteria | 1377 |
| 134 | Ga0264413_151874 | 3300024493 | Bacteria | 1433 |
| 135 | Ga0466657_375050 | 3300042582 | Bacteria | 1341 |
| 136 | Ga0466690_024123 | 3300042590 | Bacteria | 4047 |
| 137 | Ga0466690_192552 | 3300042590 | Bacteria | 1266 |
| 138 | Ga0466693_200661 | 3300042592 | Bacteria | 2528 |
| 139 | Ga0466693_369346 | 3300042592 | Bacteria | 1538 |
| 140 | Ga0466702_371511 | 3300042635 | Bacteria | 4194 |
| 141 | Ga0466703_426152 | 3300042636 | Bacteria | 2368 |
| 142 | Ga0466704_100779 | 3300042643 | Unclassified | 17435 |
| 143 | Ga0466708_209984 | 3300042652 | Bacteria | 4374 |
| 144 | Ga0123356_10411817 | 3300010049 | Bacteria | 1492 |
| 145 | Ga0103263_104786 | 3300007042 | Bacteria | 1559 |
| 146 | Ga0102739_1000797 | 3300007095 | Bacteria | 8153 |
| 147 | Ga0466732_269704 | 3300042656 | Bacteria | 4569 |
| 148 | Ga0466706_046747 | 3300042599 | Bacteria | 1789 |
| 149 | Ga0466706_049086 | 3300042599 | Bacteria | 3285 |
| 150 | Ga0466706_287434 | 3300042599 | Bacteria | 50218 |
| 151 | Ga0466721_109141 | 3300042608 | Bacteria | 4510 |
| 152 | Ga0466710_298606 | 3300042613 | Bacteria | 1723 |
| 153 | Ga0466712_167405 | 3300042614 | Unclassified | 1051 |
| 154 | Ga0466718_028738 | 3300042617 | Bacteria | 1046 |
| 155 | Ga0466726_240206 | 3300042619 | Bacteria | 1827 |
| 156 | Ga0456237_0003353 | 3300041968 | Bacteria | 2599 |
| 157 | Ga0466690_008807 | 3300042590 | Bacteria | 2479 |
| 158 | Ga0466692_088241 | 3300042591 | Bacteria | 4424 |
| 159 | Ga0466691_058858 | 3300042593 | Bacteria | 2248 |
| 160 | Ga0466691_138871 | 3300042593 | Bacteria | 9926 |
| 161 | Ga0466694_014085 | 3300042594 | Bacteria | 6200 |
| 162 | Ga0466699_206844 | 3300042597 | Bacteria | 1047 |
| 163 | Ga0466731_175886 | 3300042622 | Bacteria | 1338 |
| 164 | JGI24698J34947_10004925 | 3300002449 | Bacteria | 7317 |
| 165 | Ga0466733_101945 | 3300042659 | Unclassified | 1387 |
| 166 | Ga0466706_183616 | 3300042599 | Bacteria | 1509 |
| 167 | Ga0466706_200537 | 3300042599 | Bacteria | 3553 |
| 168 | Ga0466713_053681 | 3300042602 | Bacteria | 3030 |
| 169 | Ga0466713_054340 | 3300042602 | Bacteria | 5773 |
| 170 | Ga0466719_557172 | 3300042606 | Bacteria | 3473 |
| 171 | Ga0466720_090912 | 3300042607 | Bacteria | 1478 |
| 172 | Ga0466721_027046 | 3300042608 | Bacteria | 2149 |
| 173 | Ga0466721_226470 | 3300042608 | Bacteria | 2094 |
| 174 | Ga0466705_025236 | 3300042612 | Bacteria | 4854 |
| 175 | Ga0466705_456372 | 3300042612 | Bacteria | 15521 |
| 176 | Ga0466712_197360 | 3300042614 | Bacteria | 8603 |
| 177 | Ga0466715_313716 | 3300042616 | Bacteria | 6561 |
| 178 | Ga0466718_147647 | 3300042617 | Bacteria | 15576 |
| 179 | Ga0466718_156481 | 3300042617 | Bacteria | 1236 |
| 180 | Ga0466718_158165 | 3300042617 | Bacteria | 1943 |
| 181 | Ga0466693_291076 | 3300042592 | Bacteria | 1658 |
| 182 | Ga0466691_053230 | 3300042593 | Bacteria | 2856 |
| 183 | Ga0466735_225000 | 3300042624 | Bacteria | 1205 |
| 184 | Ga0466703_126847 | 3300042636 | Bacteria | 1936 |
| 185 | Ga0466708_143936 | 3300042652 | Bacteria | 19825 |
| 186 | Ga0466708_260058 | 3300042652 | Bacteria | 2479 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042616 | Ga0466715_313716 | Ga0466715_313716_1573_2277 | 234 |
| 2 | 3300042616 | Ga0466715_365724 | Ga0466715_365724_93_800 | 235 |
| 3 | 3300042602 | Ga0466713_013184 | Ga0466713_013184_164_880 | 238 |
| 4 | 3300042612 | Ga0466705_456372 | Ga0466705_456372_7359_8081 | 240 |
| 5 | 3300042652 | Ga0466708_209984 | Ga0466708_209984_3497_4219 | 240 |
| 6 | 3300042598 | Ga0466701_081495 | Ga0466701_081495_2053_2835 | 242 |
| 7 | 3300042615 | Ga0466711_236984 | Ga0466711_236984_40_771 | 243 |
| 8 | 3300042617 | Ga0466718_124198 | Ga0466718_124198_10_741 | 243 |
| 9 | 3300042615 | Ga0466711_423266 | Ga0466711_423266_28492_29235 | 247 |
| 10 | 3300042624 | Ga0466735_225000 | Ga0466735_225000_256_1005 | 249 |
| 11 | 3300042597 | Ga0466699_135008 | Ga0466699_135008_1933_2715 | 251 |
| 12 | 3300042604 | Ga0466717_157528 | Ga0466717_157528_381_1163 | 252 |
| 13 | 3300042605 | Ga0466716_014562 | Ga0466716_014562_1242_2000 | 252 |
| 14 | 3300007080 | Ga0102735_1000309 | Ga0102735_100030911 | 254 |
| 15 | iso_pr_bacteria | 2820025825 | 2820026720 | 254 |
| 16 | 3300042615 | Ga0466711_015953 | Ga0466711_015953_192_962 | 256 |
| 17 | 3300042615 | Ga0466711_418449 | Ga0466711_418449_1497_2276 | 259 |
| 18 | 3300042621 | Ga0466729_133234 | Ga0466729_133234_2495_3274 | 259 |
| 19 | iso_pu_archaea | 2684622742 | 2685522176 | 259 |
| 20 | 3300007068 | Ga0103265_1013842 | Ga0103265_10138422 | 260 |
| 21 | 3300007095 | Ga0102739_1000797 | Ga0102739_10007974 | 260 |
| 22 | 3300007129 | Ga0102734_1000250 | Ga0102734_10002504 | 260 |
| 23 | 3300024493 | Ga0264413_101222 | Ga0264413_1012224 | 260 |
| 24 | 3300024493 | Ga0264413_151874 | Ga0264413_1518741 | 260 |
| 25 | 3300041968 | Ga0456237_0003353 | Ga0456237_0003353_204_986 | 260 |
| 26 | 3300042582 | Ga0466657_375050 | Ga0466657_375050_403_1185 | 260 |
| 27 | 3300042590 | Ga0466690_008807 | Ga0466690_008807_1485_2267 | 260 |
| 28 | 3300042590 | Ga0466690_165152 | Ga0466690_165152_1198_1980 | 260 |
| 29 | 3300042590 | Ga0466690_232763 | Ga0466690_232763_727_1509 | 260 |
| 30 | 3300042591 | Ga0466692_088241 | Ga0466692_088241_330_1112 | 260 |
| 31 | 3300042592 | Ga0466693_200661 | Ga0466693_200661_20_802 | 260 |
| 32 | 3300042592 | Ga0466693_291076 | Ga0466693_291076_471_1253 | 260 |
| 33 | 3300042592 | Ga0466693_369346 | Ga0466693_369346_148_930 | 260 |
| 34 | 3300042593 | Ga0466691_042030 | Ga0466691_042030_270_1052 | 260 |
| 35 | 3300042593 | Ga0466691_045616 | Ga0466691_045616_568_1350 | 260 |
| 36 | 3300042593 | Ga0466691_053230 | Ga0466691_053230_1043_1825 | 260 |
| 37 | 3300042593 | Ga0466691_058858 | Ga0466691_058858_197_979 | 260 |
| 38 | 3300042593 | Ga0466691_123258 | Ga0466691_123258_683_1465 | 260 |
| 39 | 3300042593 | Ga0466691_138871 | Ga0466691_138871_8628_9410 | 260 |
| 40 | 3300042594 | Ga0466694_014085 | Ga0466694_014085_4777_5559 | 260 |
| 41 | 3300042595 | Ga0466695_344238 | Ga0466695_344238_495_1277 | 260 |
| 42 | 3300042596 | Ga0466696_123746 | Ga0466696_123746_2095_2877 | 260 |
| 43 | 3300042597 | Ga0466699_206844 | Ga0466699_206844_147_929 | 260 |
| 44 | 3300042599 | Ga0466706_034499 | Ga0466706_034499_28952_29734 | 260 |
| 45 | 3300042599 | Ga0466706_046747 | Ga0466706_046747_346_1128 | 260 |
| 46 | 3300042599 | Ga0466706_138670 | Ga0466706_138670_439_1221 | 260 |
| 47 | 3300042599 | Ga0466706_200537 | Ga0466706_200537_283_1065 | 260 |
| 48 | 3300042599 | Ga0466706_272460 | Ga0466706_272460_91985_92767 | 260 |
| 49 | 3300042599 | Ga0466706_287434 | Ga0466706_287434_46875_47657 | 260 |
| 50 | 3300042600 | Ga0466700_255159 | Ga0466700_255159_968_1750 | 260 |
| 51 | 3300042601 | Ga0466707_044020 | Ga0466707_044020_8481_9263 | 260 |
| 52 | 3300042601 | Ga0466707_198931 | Ga0466707_198931_6007_6789 | 260 |
| 53 | 3300042601 | Ga0466707_244835 | Ga0466707_244835_258_1040 | 260 |
| 54 | 3300042601 | Ga0466707_289605 | Ga0466707_289605_1195_1977 | 260 |
| 55 | 3300042601 | Ga0466707_294232 | Ga0466707_294232_1117_1899 | 260 |
| 56 | 3300042602 | Ga0466713_054340 | Ga0466713_054340_1529_2311 | 260 |
| 57 | 3300042603 | Ga0466714_053027 | Ga0466714_053027_67_849 | 260 |
| 58 | 3300042603 | Ga0466714_076451 | Ga0466714_076451_226_1008 | 260 |
| 59 | 3300042604 | Ga0466717_249333 | Ga0466717_249333_1061_1843 | 260 |
| 60 | 3300042605 | Ga0466716_042436 | Ga0466716_042436_4437_5219 | 260 |
| 61 | 3300042605 | Ga0466716_149541 | Ga0466716_149541_7011_7793 | 260 |
| 62 | 3300042605 | Ga0466716_236306 | Ga0466716_236306_311_1093 | 260 |
| 63 | 3300042605 | Ga0466716_429742 | Ga0466716_429742_1203_1985 | 260 |
| 64 | 3300042605 | Ga0466716_461578 | Ga0466716_461578_179_961 | 260 |
| 65 | 3300042605 | Ga0466716_482624 | Ga0466716_482624_2588_3370 | 260 |
| 66 | 3300042606 | Ga0466719_022205 | Ga0466719_022205_8093_8875 | 260 |
| 67 | 3300042606 | Ga0466719_026307 | Ga0466719_026307_1457_2239 | 260 |
| 68 | 3300042606 | Ga0466719_076568 | Ga0466719_076568_4531_5313 | 260 |
| 69 | 3300042606 | Ga0466719_082516 | Ga0466719_082516_350_1132 | 260 |
| 70 | 3300042606 | Ga0466719_557172 | Ga0466719_557172_2233_3015 | 260 |
| 71 | 3300042607 | Ga0466720_011308 | Ga0466720_011308_800_1582 | 260 |
| 72 | 3300042607 | Ga0466720_090912 | Ga0466720_090912_562_1344 | 260 |
| 73 | 3300042608 | Ga0466721_027046 | Ga0466721_027046_196_978 | 260 |
| 74 | 3300042608 | Ga0466721_109141 | Ga0466721_109141_1468_2250 | 260 |
| 75 | 3300042608 | Ga0466721_226470 | Ga0466721_226470_368_1150 | 260 |
| 76 | 3300042610 | Ga0466698_347323 | Ga0466698_347323_777_1559 | 260 |
| 77 | 3300042611 | Ga0466697_087367 | Ga0466697_087367_143_925 | 260 |
| 78 | 3300042612 | Ga0466705_025236 | Ga0466705_025236_500_1282 | 260 |
| 79 | 3300042612 | Ga0466705_257675 | Ga0466705_257675_11707_12489 | 260 |
| 80 | 3300042612 | Ga0466705_445328 | Ga0466705_445328_41_823 | 260 |
| 81 | 3300042613 | Ga0466710_097916 | Ga0466710_097916_32_814 | 260 |
| 82 | 3300042613 | Ga0466710_298606 | Ga0466710_298606_446_1228 | 260 |
| 83 | 3300042614 | Ga0466712_012164 | Ga0466712_012164_469_1251 | 260 |
| 84 | 3300042614 | Ga0466712_108774 | Ga0466712_108774_200_982 | 260 |
| 85 | 3300042614 | Ga0466712_167405 | Ga0466712_167405_200_982 | 260 |
| 86 | 3300042614 | Ga0466712_197360 | Ga0466712_197360_5941_6723 | 260 |
| 87 | 3300042614 | Ga0466712_217288 | Ga0466712_217288_1843_2625 | 260 |
| 88 | 3300042615 | Ga0466711_067580 | Ga0466711_067580_849_1631 | 260 |
| 89 | 3300042615 | Ga0466711_421374 | Ga0466711_421374_1460_2242 | 260 |
| 90 | 3300042617 | Ga0466718_028738 | Ga0466718_028738_79_861 | 260 |
| 91 | 3300042617 | Ga0466718_077799 | Ga0466718_077799_1038_1820 | 260 |
| 92 | 3300042617 | Ga0466718_113412 | Ga0466718_113412_135_917 | 260 |
| 93 | 3300042617 | Ga0466718_134484 | Ga0466718_134484_463_1245 | 260 |
| 94 | 3300042617 | Ga0466718_147647 | Ga0466718_147647_688_1470 | 260 |
| 95 | 3300042617 | Ga0466718_156481 | Ga0466718_156481_331_1113 | 260 |
| 96 | 3300042617 | Ga0466718_158165 | Ga0466718_158165_971_1753 | 260 |
| 97 | 3300042618 | Ga0466723_087233 | Ga0466723_087233_2277_3059 | 260 |
| 98 | 3300042618 | Ga0466723_346610 | Ga0466723_346610_984_1766 | 260 |
| 99 | 3300042619 | Ga0466726_108141 | Ga0466726_108141_769_1551 | 260 |
| 100 | 3300042619 | Ga0466726_158894 | Ga0466726_158894_482_1264 | 260 |
| 101 | 3300042619 | Ga0466726_240206 | Ga0466726_240206_313_1095 | 260 |
| 102 | 3300042620 | Ga0466728_226079 | Ga0466728_226079_1499_2281 | 260 |
| 103 | 3300042621 | Ga0466729_125671 | Ga0466729_125671_560_1342 | 260 |
| 104 | 3300042622 | Ga0466731_033720 | Ga0466731_033720_556_1338 | 260 |
| 105 | 3300042622 | Ga0466731_125327 | Ga0466731_125327_11277_12059 | 260 |
| 106 | 3300042622 | Ga0466731_175886 | Ga0466731_175886_452_1234 | 260 |
| 107 | 3300042623 | Ga0466734_067446 | Ga0466734_067446_1134_1916 | 260 |
| 108 | 3300042624 | Ga0466735_006284 | Ga0466735_006284_699_1481 | 260 |
| 109 | 3300042624 | Ga0466735_066722 | Ga0466735_066722_69_851 | 260 |
| 110 | 3300042635 | Ga0466702_160181 | Ga0466702_160181_668_1450 | 260 |
| 111 | 3300042635 | Ga0466702_371511 | Ga0466702_371511_498_1280 | 260 |
| 112 | 3300042636 | Ga0466703_126847 | Ga0466703_126847_125_907 | 260 |
| 113 | 3300042636 | Ga0466703_426152 | Ga0466703_426152_278_1060 | 260 |
| 114 | 3300042643 | Ga0466704_100779 | Ga0466704_100779_2253_3035 | 260 |
| 115 | 3300042643 | Ga0466704_127982 | Ga0466704_127982_10886_11668 | 260 |
| 116 | 3300042648 | Ga0466709_123014 | Ga0466709_123014_1539_2321 | 260 |
| 117 | 3300042652 | Ga0466708_143936 | Ga0466708_143936_4469_5251 | 260 |
| 118 | 3300042652 | Ga0466708_260058 | Ga0466708_260058_1422_2204 | 260 |
| 119 | 3300042652 | Ga0466708_294508 | Ga0466708_294508_23650_24432 | 260 |
| 120 | 3300042654 | Ga0466725_022888 | Ga0466725_022888_1011_1793 | 260 |
| 121 | 3300042655 | Ga0466727_001628 | Ga0466727_001628_699_1481 | 260 |
| 122 | 3300042656 | Ga0466732_269704 | Ga0466732_269704_856_1638 | 260 |
| 123 | 3300042659 | Ga0466733_101945 | Ga0466733_101945_88_870 | 260 |
| 124 | iso_pr_bacteria | 2820180635 | 2820183149 | 260 |
| 125 | iso_pr_bacteria | 2820737921 | 2820739267 | 260 |
| 126 | iso_pr_bacteria | 2820744581 | 2820744680 | 260 |
| 127 | iso_pr_bacteria | 2820746860 | 2820747079 | 260 |
| 128 | 3300002449 | JGI24698J34947_10004925 | JGI24698J34947_100049253 | 261 |
| 129 | 3300002449 | JGI24698J34947_10014209 | JGI24698J34947_100142093 | 261 |
| 130 | 3300002449 | JGI24698J34947_10019871 | JGI24698J34947_100198712 | 261 |
| 131 | 3300002450 | JGI24695J34938_10021559 | JGI24695J34938_100215593 | 261 |
| 132 | 3300002462 | JGI24702J35022_10008326 | JGI24702J35022_100083265 | 261 |
| 133 | 3300002462 | JGI24702J35022_10039247 | JGI24702J35022_100392472 | 261 |
| 134 | 3300002462 | JGI24702J35022_10095903 | JGI24702J35022_100959031 | 261 |
| 135 | 3300002462 | JGI24702J35022_10122943 | JGI24702J35022_101229431 | 261 |
| 136 | 3300002462 | JGI24702J35022_10224090 | JGI24702J35022_102240901 | 261 |
| 137 | 3300002462 | JGI24702J35022_10262676 | JGI24702J35022_102626761 | 261 |
| 138 | 3300002834 | JGI24696J40584_12943790 | JGI24696J40584_129437902 | 261 |
| 139 | 3300002834 | JGI24696J40584_12960941 | JGI24696J40584_129609415 | 261 |
| 140 | 3300005083 | Ga0068305_10078298 | Ga0068305_100782982 | 261 |
| 141 | 3300005200 | Ga0072940_1027426 | Ga0072940_10274261 | 261 |
| 142 | 3300005200 | Ga0072940_1044166 | Ga0072940_10441663 | 261 |
| 143 | 3300005201 | Ga0072941_1126393 | Ga0072941_11263932 | 261 |
| 144 | 3300005201 | Ga0072941_1353510 | Ga0072941_13535102 | 261 |
| 145 | 3300005201 | Ga0072941_1390418 | Ga0072941_13904181 | 261 |
| 146 | 3300009784 | Ga0123357_10147296 | Ga0123357_101472962 | 261 |
| 147 | 3300009784 | Ga0123357_10363574 | Ga0123357_103635741 | 261 |
| 148 | 3300009826 | Ga0123355_10016695 | Ga0123355_100166954 | 261 |
| 149 | 3300010049 | Ga0123356_10049096 | Ga0123356_100490965 | 261 |
| 150 | 3300010049 | Ga0123356_10115584 | Ga0123356_101155842 | 261 |
| 151 | 3300010049 | Ga0123356_10198107 | Ga0123356_101981072 | 261 |
| 152 | 3300010049 | Ga0123356_10411817 | Ga0123356_104118172 | 261 |
| 153 | 3300010049 | Ga0123356_10690167 | Ga0123356_106901672 | 261 |
| 154 | 3300010167 | Ga0123353_10026823 | Ga0123353_100268236 | 261 |
| 155 | 3300010167 | Ga0123353_10150317 | Ga0123353_101503173 | 261 |
| 156 | 3300010167 | Ga0123353_10170456 | Ga0123353_101704563 | 261 |
| 157 | 3300010167 | Ga0123353_10289886 | Ga0123353_102898863 | 261 |
| 158 | 3300010167 | Ga0123353_10417117 | Ga0123353_104171172 | 261 |
| 159 | 3300010167 | Ga0123353_10689554 | Ga0123353_106895541 | 261 |
| 160 | 3300010167 | Ga0123353_11178435 | Ga0123353_111784351 | 261 |
| 161 | 3300010167 | Ga0123353_11186717 | Ga0123353_111867172 | 261 |
| 162 | 3300010882 | Ga0123354_10312079 | Ga0123354_103120792 | 261 |
| 163 | 3300042602 | Ga0466713_007347 | Ga0466713_007347_96_881 | 261 |
| 164 | 3300042609 | Ga0466722_263896 | Ga0466722_263896_182_967 | 261 |
| 165 | 3300042619 | Ga0466726_465860 | Ga0466726_465860_1636_2421 | 261 |
| 166 | 3300042652 | Ga0466708_364317 | Ga0466708_364317_8399_9184 | 261 |
| 167 | 3300042659 | Ga0466733_079582 | Ga0466733_079582_1159_1944 | 261 |
| 168 | 3300042590 | Ga0466690_223274 | Ga0466690_223274_1390_2181 | 263 |
| 169 | 3300042599 | Ga0466706_049086 | Ga0466706_049086_1451_2242 | 263 |
| 170 | 2225789004 | 2227278015 | 2227729677 | 264 |
| 171 | 3300002834 | JGI24696J40584_12951311 | JGI24696J40584_129513113 | 264 |
| 172 | 3300042590 | Ga0466690_380155 | Ga0466690_380155_266_1060 | 264 |
| 173 | 3300042591 | Ga0466692_121037 | Ga0466692_121037_1008_1802 | 264 |
| 174 | 3300042601 | Ga0466707_189241 | Ga0466707_189241_1822_2616 | 264 |
| 175 | 3300042606 | Ga0466719_423274 | Ga0466719_423274_505_1299 | 264 |
| 176 | 3300042616 | Ga0466715_050573 | Ga0466715_050573_1587_2381 | 264 |
| 177 | 3300042619 | Ga0466726_248239 | Ga0466726_248239_111_905 | 264 |
| 178 | 3300042643 | Ga0466704_509064 | Ga0466704_509064_1403_2200 | 265 |
| 179 | 3300007042 | Ga0103263_104786 | Ga0103263_1047862 | 266 |
| 180 | 3300010167 | Ga0123353_10831167 | Ga0123353_108311672 | 266 |
| 181 | 3300010882 | Ga0123354_10331729 | Ga0123354_103317292 | 266 |
| 182 | 3300042615 | Ga0466711_148604 | Ga0466711_148604_134_934 | 266 |
| 183 | 3300042652 | Ga0466708_189623 | Ga0466708_189623_30796_31596 | 266 |
| 184 | 3300042590 | Ga0466690_024123 | Ga0466690_024123_1091_1894 | 267 |
| 185 | 3300042616 | Ga0466715_050246 | Ga0466715_050246_281_1084 | 267 |
| 186 | 3300042655 | Ga0466727_019761 | Ga0466727_019761_194_997 | 267 |
| 187 | 3300042590 | Ga0466690_192552 | Ga0466690_192552_401_1213 | 270 |
| 188 | 3300042599 | Ga0466706_183616 | Ga0466706_183616_98_916 | 272 |
| 189 | 3300010049 | Ga0123356_10218495 | Ga0123356_102184952 | 275 |
| 190 | 3300042603 | Ga0466714_168011 | Ga0466714_168011_1605_2435 | 276 |
| 191 | 3300042602 | Ga0466713_053681 | Ga0466713_053681_512_1363 | 283 |
| 192 | 3300002449 | JGI24698J34947_10031812 | JGI24698J34947_100318123 | 287 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF06300 | Tsp45I | Tsp45I type II restriction enzyme | 30 | 286 | 0.98 |
Structural Annotation β Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3dzc-assembly1.cif.gz_B | 2.35 Angstrom resolution structure of WecB (VC0917), a UDP-N-acetylglucosamine 2-epimerase from Vibrio cholerae. | 0.5 | 215 | 285 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A439A7Z4-F1-model_v4 | Uncharacterized/unreviewed | 0.9799 | 184 | 286 | |
| AF-A0A1F7VKV4-F1-model_v4 | Uncharacterized/unreviewed | 0.9653 | 31 | 286 |
GO:0004519
|
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.69 | 0.72 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.