Protein Family IF00492

Metagenome Isolate
171 Members
117 Samples
106 Scaffolds
422.67 Avg Length

🧬 Representative Sequence

ID
3300002449|JGI24698J34947_10005769|JGI24698J34947_100057694
Length
455 aa
Sequence
MGINFPIPYTLSLKFKAIFYIPLMKTLSQTDPDIQALITKETERQEDGIELXASENYASKAVMEALGSPLTNKYSEGYVGKRXYGGNEIIDEVEAFAIERSKLLFGCEHVNVQPLSGSPANAAVYFATIKPGDKVLGLQLDHGGHLSHGHPVNFSGMLYNFTQYQVDKNTGRIDMDKVREIALREKPKMILAGFSAYSRNMEWKKFKEIADEIGAITFADIAHIAGLIAGKAIESPVPYFDIVSTTTHKTLRGPRGAIIMCKEPFAKAIDKSVFPGMQGGPHDHVTAAKAVAFEEALQPEFQTYAKRVIENAQAMAAKLMEAGFKIISDGTDNHLMVVDVTSKGISGKEAETILDKVGISTSRSTIPFDPRKPMDPSGVRLGTAAITTRGFDVEDTCAVAEFITQAIENRSDEAKLKRIRESLLELCKKRPLYNFPRAAPQTHSTPANQWIFPV*

📊 Sample Types

Isolate 38.0%
Metagenome 62.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 23.0%
Unclassified 21.2%
Elmidae 5.3%
Kalotermitidae 5.3%
Drosophilidae 4.4%
Formicidae 4.4%
Pyralidae 4.4%
Scarabaeidae 3.5%
Rhinotermitidae 3.5%
Cambaridae 2.7%
Apidae 1.8%
Culicidae 1.8%
Blattidae 1.8%
Termopsidae 1.8%
Bombycidae 1.8%
Ocypodidae 0.9%
Nephropidae 0.9%
Pentatomidae 0.9%
Portunidae 0.9%
Carabidae 0.9%
Noctuidae 0.9%
Armadillidiidae 0.9%
Eresidae 0.9%
Hydrophilidae 0.9%
Curculionidae 0.9%
Muscidae 0.9%
Dytiscidae 0.9%
Stratiomyidae 0.9%
Ixodidae 0.9%
Hodotermitidae 0.9%

🌳 Taxonomy

Archaea 0
Bacteria 161
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2731957677 Alkalihalobacillus trypoxylicola NBRC 102646 Isolate Scarabaeidae
2 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
3 2822450720 Bacillus toyonensis AFS052650 Isolate Scarabaeidae
4 2864782175 Bacillus toyonensis S00025 Isolate Elmidae
5 2870004507 Campylobacter coli 14983A Isolate Unclassified
6 2978778678 Bacillus cereus 25 Isolate Ocypodidae
7 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
8 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
9 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
10 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
11 8062637095 Yimella sp. cx-51 Isolate Cambaridae
12 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
13 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
14 2778260941 Unclassified Fibrobacteres Th196P3bin8 Isolate Unclassified
15 2818991478 Micromonospora palomenae DSM 102131 Isolate Pentatomidae
16 2820314258 Unclassified Firmicutes Nt197P4bin16 Isolate Unclassified
17 2651870343 Fructobacillus sp. EFB-N1 Isolate Apidae
18 2864816158 Priestia aryabhattai S00060 Isolate Elmidae
19 2969145278 Bacillus cereus 29 Isolate Portunidae
20 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
21 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
22 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
23 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
24 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
25 643886087 Bacillus thuringiensis sv. kurstaki T03a001 Isolate Pyralidae
26 643886090 Bacillus thuringiensis sv. pakistani t13001 Isolate Unclassified
27 8061100935 Bacillus thuringiensis sv. japonensis 62 Isolate
28 8062747827 Yimella sp. cx-51 Isolate Cambaridae
29 8064008355 Heyndrickxia oleronia Isolate Unclassified
30 8002448939 Spiroplasma endosymbiont of 'Nebria riversi' Nriv7 Isolate Carabidae
31 2563367190 Bacillus thuringiensis sv. aizawai Leapi01 Isolate Noctuidae
32 2740892545 Fibrobacteria bacterium GUT31 IN01_31 Isolate Unclassified
33 2772190761 Rhodococcus rhodnii NRRL B-16535 Isolate Unclassified
34 2791355481 Bacillus sp. ZY-1-1 Isolate Scarabaeidae
35 2843246524 Lysinibacillus sphaericus DSM 28 Isolate Unclassified
36 2863397684 Micromonospora polyrhachis DSM 45886 (Annotation) (version 2) Isolate Unclassified
37 2864895409 Bacillus aerius S00152 Isolate Elmidae
38 2864976888 Novosphingobium chloroacetimidivorans S00245 Isolate Elmidae
39 2909412500 Yimella sp. cx-573 Isolate Cambaridae
40 2916858470 Heyndrickxia oleronia Isolate Unclassified
41 2963635624 Unclassified Bacilli bacterium PM5-9 Isolate Blattidae
42 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
43 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
44 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
45 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
46 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
47 8022725327 Bacillus sp. SN10 Isolate Eresidae
48 8022781829 Bacillus sp. VKPM B-3276 Isolate Culicidae
49 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
50 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
51 2524614537 Lysinibacillus sphaericus OT4b.31 Isolate Unclassified
52 2751185832 Lysinibacillus sp. AR18-8 Isolate Unclassified
53 2773857779 Unclassified Fibrobacteres Co191P1bin69 Isolate Unclassified
54 2822232166 Bacillus toyonensis AFS084242 Isolate Scarabaeidae
55 2873595552 Erysipelothrix sp. HDW6C Isolate Hydrophilidae
56 2890957088 Psychrobacillus lasiicapitis NEAU-3TGS17 Isolate Formicidae
57 2834540479 Leuconostoc citreum DmW_111 Isolate Drosophilidae
58 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
59 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
60 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
61 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
62 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
63 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
64 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
65 2593339125 Clostridium sp. 5 Isolate Termitidae
66 2740892546 Fibrobacteria bacterium GUT307 IN01_307 Isolate Unclassified
67 2864801025 Bacillus aerius S00042 Isolate Elmidae
68 2900132049 Bartonella massiliensis OS09 Isolate Unclassified
69 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
70 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
71 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
72 643886085 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
73 643886091 Bacillus thuringiensis sv. thuringiensis T01001 Isolate Pyralidae
74 8067483258 Ochrobactrum soli MTP-C0764 Isolate Muscidae
75 2537562000 Bacillus cereus HD73 Isolate Pyralidae
76 2574180310 Bacillus licheniformis CG-B52 Isolate Unclassified
77 2695420964 Hyphomicrobiales bacterium JR021 Isolate Unclassified
78 2852016966 Micromonospora polyrhachis DSM 45886 Isolate Unclassified
79 2873593402 Erysipelothrix sp. HDW6A Isolate Dytiscidae
80 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
81 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
82 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
83 8061045771 Bacillus thuringiensis sv. kurstaki BGSC 4D1 Isolate Bombycidae
84 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
85 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
86 2209111004 Macrotermes natalensis queen gut microbiome Metagenome Termitidae
87 2590828839 Clostridium sp. 1 Isolate Termitidae
88 2778260937 Unclassified Fibrobacteres Co191P3bin40 Isolate Unclassified
89 2852123468 Lysinibacillus sphaericus KCCM 35418 Isolate Unclassified
90 2912849059 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
91 2963634138 Unclassified Bacilli bacterium PM5-3 Isolate Blattidae
92 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
93 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
94 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
95 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
96 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
97 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
98 8030337018 Tissierella sp. Yu-01 Isolate Stratiomyidae
99 650716015 Candidatus Midichloria mitochondrii IricVA Isolate Ixodidae
100 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
101 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
102 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
103 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
104 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
105 2820115951 Unclassified Proteobacteria Emb289P4bin33 Isolate Unclassified
106 2820507989 Unclassified Firmicutes Lab288P1bin41 Isolate Unclassified
107 2855361764 Lysinibacillus fusiformis Juneja Isolate Drosophilidae
108 2864909992 Bacillus velezensis S00166 Isolate Elmidae
109 3300028918 Ant gut bacterial community from Dolichoderus sp. 2-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC085 Metagenome Formicidae
110 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
111 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
112 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
113 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
114 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
115 8061039349 Bacillus thuringiensis sv. galleriae BGSC 4G4 Isolate Bombycidae
116 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
117 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_246007 3300042656 Unclassified 2087
2 AustNasuHG_c1002081 3300000089 Bacteria 7233
3 JGI24698J34947_10033727 3300002449 Unclassified 2683
4 CVPL010W_10000112 3300002931 Bacteria 60598
5 Ga0074278_134149 3300005721 Bacteria 51171
6 Ga0466718_013982 3300042617 Bacteria 9966
7 Ga0466718_052453 3300042617 Bacteria 2252
8 Ga0466707_022879 3300042601 Bacteria 60320
9 Ga0466707_102875 3300042601 Bacteria 1822
10 Ga0466713_108990 3300042602 Bacteria 3086
11 Ga0466722_238729 3300042609 Bacteria 12339
12 Ga0466734_005327 3300042623 Bacteria 3481
13 Ga0466702_280281 3300042635 Bacteria 2190
14 Ga0123353_10128696 3300010167 Unclassified 4066
15 Ga0123353_10334752 3300010167 Bacteria 2289
16 Ga0072940_1009313 3300005200 Bacteria 7759
17 Ga0072941_1007967 3300005201 Bacteria 24670
18 Ga0072941_1012473 3300005201 Bacteria 38576
19 Ga0072941_1035674 3300005201 Bacteria 19410
20 Ga0415639_288935 3300038395 Bacteria 1772
21 Ga0466690_262098 3300042590 Bacteria 18620
22 Ga0466694_256579 3300042594 Bacteria 16228
23 Ga0466712_154198 3300042614 Unclassified 11660
24 Ga0466715_277482 3300042616 Bacteria 4944
25 Ga0466707_285379 3300042601 Bacteria 21230
26 Ga0466707_315343 3300042601 Unclassified 2319
27 Ga0466717_046333 3300042604 Bacteria 2276
28 Ga0466720_048373 3300042607 Bacteria 52781
29 Ga0466732_110176 3300042656 Bacteria 8366
30 Ga0102740_1000134 3300007140 Bacteria 19620
31 Ga0466692_092853 3300042591 Bacteria 4467
32 Ga0466692_138796 3300042591 Bacteria 17805
33 Ga0466694_066606 3300042594 Bacteria 3915
34 Ga0466712_040190 3300042614 Unclassified 6840
35 Ga0466712_053030 3300042614 Bacteria 13324
36 JGI24698J34947_10003352 3300002449 Bacteria 8695
37 JGI24698J34947_10005769 3300002449 Bacteria 6789
38 CVPL010W_10000168 3300002931 Bacteria 56046
39 Ga0072941_1023514 3300005201 Bacteria 14411
40 Ga0103264_1000499 3300007188 Bacteria 32791
41 Ga0466696_021862 3300042596 Bacteria 18962
42 Ga0466712_178204 3300042614 Bacteria 10590
43 Ga0466718_011023 3300042617 Unclassified 3564
44 Ga0466706_044135 3300042599 Bacteria 3498
45 Ga0466706_244002 3300042599 Bacteria 5169
46 Ga0466707_309775 3300042601 Unclassified 2267
47 Ga0466704_392400 3300042643 Bacteria 3942
48 Ga0466708_034858 3300042652 Bacteria 35107
49 Ga0160471_101298 3300012812 Bacteria 5134
50 JGI24698J34947_10001012 3300002449 Bacteria 14451
51 CVPL010W_10000001 3300002931 Bacteria 135542
52 Ga0072941_1011371 3300005201 Bacteria 34764
53 Ga0072941_1012977 3300005201 Bacteria 17127
54 Ga0264413_103442 3300024493 Bacteria 18937
55 Ga0466694_274911 3300042594 Bacteria 15471
56 Ga0466729_085051 3300042621 Bacteria 1928
57 Ga0466706_077120 3300042599 Bacteria 80581
58 Ga0466706_288606 3300042599 Bacteria 39888
59 Ga0466707_198504 3300042601 Bacteria 5345
60 Ga0466707_204600 3300042601 Unclassified 1340
61 Ga0466707_386338 3300042601 Bacteria 3499
62 Ga0466713_052636 3300042602 Bacteria 27053
63 Ga0466714_118225 3300042603 Bacteria 20677
64 Ga0466720_048242 3300042607 Bacteria 43364
65 Ga0466734_065983 3300042623 Bacteria 25275
66 Ga0466704_287526 3300042643 Bacteria 40864
67 Ga0466704_494301 3300042643 Bacteria 2763
68 Ga0466727_014784 3300042655 Bacteria 3484
69 Ga0466727_178847 3300042655 Bacteria 3081
70 Ga0466705_147979 3300042612 Bacteria 167577
71 JGI24705J35276_12237986 3300002504 Bacteria 14710
72 JGI24699J35502_11132437 3300002509 Unclassified 6865
73 Ga0415639_006795 3300038395 Bacteria 14399
74 Ga0466726_338034 3300042619 Bacteria 2862
75 Ga0466713_086110 3300042602 Bacteria 3292
76 Ga0466721_008626 3300042608 Bacteria 25610
77 Ga0466731_379732 3300042622 Bacteria 31002
78 Ga0466730_029885 3300042625 Bacteria 18252
79 Ga0123357_10009523 3300009784 Bacteria 12270
80 2211957656 2209111004 Bacteria 8543
81 JGI24698J34947_10002228 3300002449 Bacteria 10386
82 Ga0063521_1000146 3300003973 Bacteria 53228
83 Ga0104045_1000043 3300007085 Bacteria 50340
84 Ga0104048_1001670 3300007143 Bacteria 13032
85 Ga0160469_100001 3300012824 Bacteria 1115787
86 Ga0309901_1000013 3300028918 Bacteria 346588
87 Ga0466692_075180 3300042591 Bacteria 26895
88 Ga0466712_185215 3300042614 Bacteria 17545
89 Ga0466707_064600 3300042601 Bacteria 2867
90 Ga0466720_185331 3300042607 Bacteria 80374
91 Ga0466724_56819 3300042649 Bacteria 199566
92 Ga0123355_10000016 3300009826 Bacteria 163334
93 JGI24698J34947_10022259 3300002449 Bacteria 3402
94 JGI24695J34938_10003405 3300002450 Bacteria 11149
95 Ga0072941_1027518 3300005201 Bacteria 39253
96 Ga0074278_128543 3300005721 Bacteria 4061
97 Ga0456237_0000087 3300041968 Bacteria 12748
98 Ga0466694_194862 3300042594 Bacteria 3419
99 Ga0466715_519306 3300042616 Bacteria 2824
100 Ga0466726_415010 3300042619 Bacteria 15579
101 Ga0466720_089430 3300042607 Bacteria 42964
102 Ga0466702_011540 3300042635 Bacteria 2014
103 Ga0466708_068118 3300042652 Bacteria 6880
104 Ga0123355_10319215 3300009826 Bacteria 2095
105 Ga0123353_10117026 3300010167 Bacteria 4288
106 Ga0160442_100970 3300012806 Bacteria 4018

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042643 Ga0466704_494301 Ga0466704_494301_10_1194 394
2 3300042607 Ga0466720_185331 Ga0466720_185331_45830_47065 396
3 3300042607 Ga0466720_048242 Ga0466720_048242_5221_6459 404
4 3300010167 Ga0123353_10334752 Ga0123353_103347522 405
5 3300042599 Ga0466706_288606 Ga0466706_288606_7380_8606 408
6 3300002931 CVPL010W_10000001 CVPL010W_10000001137 409
7 3300024493 Ga0264413_103442 Ga0264413_1034427 409
8 iso_pr_bacteria 2873593402 2873593580 409
9 iso_pr_bacteria 2651870343 2654486228 410
10 iso_pr_bacteria 2834540479 2834541121 410
11 iso_pr_bacteria 2873595552 2873595774 410
12 iso_pr_bacteria 8030337018 8030337962 410
13 3300042594 Ga0466694_256579 Ga0466694_256579_8474_9709 411
14 3300042594 Ga0466694_274911 Ga0466694_274911_4170_5405 411
15 3300042603 Ga0466714_118225 Ga0466714_118225_11707_12942 411
16 3300042604 Ga0466717_046333 Ga0466717_046333_254_1489 411
17 3300042607 Ga0466720_048373 Ga0466720_048373_38867_40102 411
18 3300042607 Ga0466720_089430 Ga0466720_089430_332_1567 411
19 3300042614 Ga0466712_040190 Ga0466712_040190_4149_5384 411
20 3300042614 Ga0466712_178204 Ga0466712_178204_4471_5706 411
21 3300042614 Ga0466712_185215 Ga0466712_185215_13830_15065 411
22 3300042617 Ga0466718_052453 Ga0466718_052453_701_1936 411
23 3300042635 Ga0466702_280281 Ga0466702_280281_773_2008 411
24 3300042656 Ga0466732_110176 Ga0466732_110176_2125_3360 411
25 iso_pr_bacteria 2590828839 2593250120 411
26 iso_pr_bacteria 2593339125 2595065029 411
27 iso_pr_bacteria 2740892546 2743909955 411
28 iso_pr_bacteria 2778260937 2778348608 411
29 iso_pr_bacteria 2778260941 2778359407 411
30 iso_pr_bacteria 2890957088 2890959629 411
31 3300000089 AustNasuHG_c1002081 AustNasuHG_10020816 412
32 3300002449 JGI24698J34947_10002228 JGI24698J34947_100022288 412
33 3300002449 JGI24698J34947_10003352 JGI24698J34947_100033524 412
34 3300002450 JGI24695J34938_10003405 JGI24695J34938_100034059 412
35 3300005201 Ga0072941_1012473 Ga0072941_101247316 412
36 3300005201 Ga0072941_1012977 Ga0072941_10129776 412
37 3300005201 Ga0072941_1027518 Ga0072941_102751825 412
38 3300005201 Ga0072941_1035674 Ga0072941_10356743 412
39 3300007188 Ga0103264_1000499 Ga0103264_100049928 412
40 3300042599 Ga0466706_077120 Ga0466706_077120_17142_18380 412
41 3300042599 Ga0466706_244002 Ga0466706_244002_1526_2764 412
42 3300042617 Ga0466718_011023 Ga0466718_011023_875_2113 412
43 3300042623 Ga0466734_005327 Ga0466734_005327_1208_2446 412
44 iso_pr_bacteria 2820507989 2820509895 412
45 3300002509 JGI24699J35502_11132437 JGI24699J35502_111324374 413
46 3300042594 Ga0466694_066606 Ga0466694_066606_378_1619 413
47 3300042614 Ga0466712_053030 Ga0466712_053030_8351_9592 413
48 3300042616 Ga0466715_277482 Ga0466715_277482_2975_4216 413
49 3300042625 Ga0466730_029885 Ga0466730_029885_10646_11887 413
50 iso_pr_bacteria 2524614537 2524833187 413
51 iso_pr_bacteria 2537562000 2539438028 413
52 iso_pr_bacteria 2563367190 2565787906 413
53 iso_pr_bacteria 2731957677 2732688910 413
54 iso_pr_bacteria 2751185832 2753509294 413
55 iso_pr_bacteria 2767802234 2769332490 413
56 iso_pr_bacteria 2820314258 2820316216 413
57 iso_pr_bacteria 2822232166 2822237950 413
58 iso_pr_bacteria 2822450720 2822454572 413
59 iso_pr_bacteria 2843246524 2843250706 413
60 iso_pr_bacteria 2852123468 2852127860 413
61 iso_pr_bacteria 2855361764 2855362851 413
62 iso_pr_bacteria 2864782175 2864786474 413
63 iso_pr_bacteria 2912849059 2912854586 413
64 iso_pr_bacteria 2916858470 2916858632 413
65 iso_pr_bacteria 2963634138 2963635377 413
66 iso_pr_bacteria 2963635624 2963636312 413
67 iso_pr_bacteria 2969145278 2969146226 413
68 iso_pr_bacteria 2978778678 2978778740 413
69 iso_pr_bacteria 643886085 644682669 413
70 iso_pr_bacteria 643886087 644670291 413
71 iso_pr_bacteria 643886090 644664245 413
72 iso_pr_bacteria 643886091 644651354 413
73 iso_pr_bacteria 8022725327 8022730266 413
74 iso_pr_bacteria 8022781829 8022787505 413
75 iso_pr_bacteria 8061039349 8061045063 413
76 iso_pr_bacteria 8061045771 8061051092 413
77 iso_pr_bacteria 8061100935 8061106202 413
78 iso_pr_bacteria 8064008355 8064013599 413
79 3300002449 JGI24698J34947_10022259 JGI24698J34947_100222593 414
80 3300002449 JGI24698J34947_10033727 JGI24698J34947_100337272 414
81 3300002504 JGI24705J35276_12237986 JGI24705J35276_122379864 414
82 3300002931 CVPL010W_10000112 CVPL010W_1000011222 414
83 3300003973 Ga0063521_1000146 Ga0063521_100014618 414
84 3300042601 Ga0466707_285379 Ga0466707_285379_3470_4714 414
85 3300042622 Ga0466731_379732 Ga0466731_379732_14456_15700 414
86 iso_pr_bacteria 2740892545 2743907546 414
87 iso_pr_bacteria 2864816158 2864820691 414
88 iso_pr_bacteria 2870004507 2870006057 414
89 2209111004 2211957656 2211987252 415
90 3300002449 JGI24698J34947_10001012 JGI24698J34947_100010126 415
91 3300005201 Ga0072941_1011371 Ga0072941_101137129 415
92 3300005201 Ga0072941_1023514 Ga0072941_10235146 415
93 3300010167 Ga0123353_10117026 Ga0123353_101170262 415
94 3300010167 Ga0123353_10128696 Ga0123353_101286963 415
95 3300012812 Ga0160471_101298 Ga0160471_1012983 415
96 3300038395 Ga0415639_288935 Ga0415639_288935_498_1745 415
97 3300042594 Ga0466694_194862 Ga0466694_194862_358_1605 415
98 3300042601 Ga0466707_386338 Ga0466707_386338_1889_3136 415
99 iso_pr_bacteria 2574180310 2576358821 415
100 iso_pr_bacteria 2773857779 2774479233 415
101 iso_pr_bacteria 2791355481 2794425738 415
102 iso_pr_bacteria 2864801025 2864801621 415
103 iso_pr_bacteria 2864895409 2864895831 415
104 iso_pr_bacteria 2864909992 2864912153 415
105 iso_pr_bacteria 8043041867 8043044379 415
106 3300009826 Ga0123355_10000016 Ga0123355_10000016112 416
107 3300038395 Ga0415639_006795 Ga0415639_006795_8817_10067 416
108 3300042596 Ga0466696_021862 Ga0466696_021862_2828_4078 416
109 3300042599 Ga0466706_044135 Ga0466706_044135_1921_3171 416
110 3300042608 Ga0466721_008626 Ga0466721_008626_5275_6555 416
111 3300042612 Ga0466705_147979 Ga0466705_147979_16878_18128 416
112 3300042617 Ga0466718_013982 Ga0466718_013982_6634_7884 416
113 3300042643 Ga0466704_287526 Ga0466704_287526_29944_31194 416
114 3300042643 Ga0466704_392400 Ga0466704_392400_385_1635 416
115 iso_pr_bacteria 2772190761 2772887210 418
116 3300042601 Ga0466707_198504 Ga0466707_198504_67_1326 419
117 3300042601 Ga0466707_204600 Ga0466707_204600_30_1289 419
118 3300042601 Ga0466707_309775 Ga0466707_309775_526_1785 419
119 3300042601 Ga0466707_315343 Ga0466707_315343_535_1794 419
120 3300042621 Ga0466729_085051 Ga0466729_085051_360_1619 419
121 3300042602 Ga0466713_052636 Ga0466713_052636_23312_24574 420
122 3300042616 Ga0466715_519306 Ga0466715_519306_928_2190 420
123 3300042623 Ga0466734_065983 Ga0466734_065983_21429_22721 420
124 3300042652 Ga0466708_034858 Ga0466708_034858_31505_32767 420
125 3300042652 Ga0466708_068118 Ga0466708_068118_3358_4620 420
126 3300042655 Ga0466727_178847 Ga0466727_178847_1363_2625 420
127 3300042656 Ga0466732_246007 Ga0466732_246007_676_1938 420
128 3300005201 Ga0072941_1007967 Ga0072941_10079673 422
129 3300002931 CVPL010W_10000168 CVPL010W_1000016832 423
130 3300007140 Ga0102740_1000134 Ga0102740_10001349 423
131 3300042590 Ga0466690_262098 Ga0466690_262098_11929_13200 423
132 iso_pr_bacteria 650716015 650987035 423
133 3300007085 Ga0104045_1000043 Ga0104045_100004316 424
134 3300007143 Ga0104048_1001670 Ga0104048_10016704 424
135 3300012806 Ga0160442_100970 Ga0160442_1009704 424
136 3300042619 Ga0466726_415010 Ga0466726_415010_13455_14729 424
137 iso_pr_bacteria 2909412500 2909413125 425
138 iso_pr_bacteria 8062637095 8062639246 425
139 iso_pr_bacteria 8062747827 8062749578 425
140 iso_pr_bacteria 2695420964 2698253974 428
141 iso_pr_bacteria 2820115951 2820120276 428
142 3300009784 Ga0123357_10009523 Ga0123357_100095238 429
143 3300028918 Ga0309901_1000013 Ga0309901_1000013309 431
144 3300042614 Ga0466712_154198 Ga0466712_154198_5706_7001 431
145 3300042635 Ga0466702_011540 Ga0466702_011540_619_1920 433
146 3300042649 Ga0466724_56819 Ga0466724_56819_46531_47838 435
147 iso_pr_bacteria 2864976888 2864977337 435
148 3300005721 Ga0074278_128543 Ga0074278_1285433 436
149 3300005721 Ga0074278_134149 Ga0074278_13414918 436
150 3300012824 Ga0160469_100001 Ga0160469_100001516 437
151 iso_pr_bacteria 2900132049 2900133535 437
152 iso_pr_bacteria 2818991478 2819788063 438
153 iso_pr_bacteria 2852016966 2852021084 438
154 iso_pr_bacteria 2863397684 2863401802 438
155 iso_pr_bacteria 8067483258 8067487013 439
156 3300005200 Ga0072940_1009313 Ga0072940_10093136 441
157 iso_pr_bacteria 8002448939 8002450967 449
158 3300002449 JGI24698J34947_10005769 JGI24698J34947_100057694 455
159 3300042602 Ga0466713_108990 Ga0466713_108990_1369_2814 467
160 3300009826 Ga0123355_10319215 Ga0123355_103192152 475
161 3300042602 Ga0466713_086110 Ga0466713_086110_804_2309 487
162 3300042601 Ga0466707_022879 Ga0466707_022879_17348_18829 493
163 3300042591 Ga0466692_075180 Ga0466692_075180_24323_25816 497
164 3300042601 Ga0466707_064600 Ga0466707_064600_332_1825 497
165 3300042601 Ga0466707_102875 Ga0466707_102875_272_1774 500
166 3300042609 Ga0466722_238729 Ga0466722_238729_10473_11975 500
167 3300041968 Ga0456237_0000087 Ga0456237_0000087_359_1864 501
168 3300042591 Ga0466692_092853 Ga0466692_092853_2101_3606 501
169 3300042619 Ga0466726_338034 Ga0466726_338034_1252_2757 501
170 3300042591 Ga0466692_138796 Ga0466692_138796_1799_3307 502
171 3300042655 Ga0466727_014784 Ga0466727_014784_1535_3043 502

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00464 SHMT Serine hydroxymethyltransferase 27 403 0.99
PF00155 Aminotran_1_2 Aminotransferase class I and II 108 363 0.7

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.9 0.94 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.