Protein Family IF00491

Metagenome Isolate
130 Members
46 Samples
122 Scaffolds
693.05 Avg Length

🧬 Representative Sequence

ID
3300002449|JGI24698J34947_10005628|JGI24698J34947_100056282
Length
728 aa
Sequence
MSKWGRKLLLMHTLIPYNAVMNRETKISELISKMTLEEKVSQLTHASPAIPRLGIPEYNWWNECLHGVARAGVATVFPQAIALAATFDETLVHEVAGAISDEARAKYNEAVKQGNRGQYWGLTFWTPNINIFRDPRWGRGQETYGEDPYLTGRIGLAFVRGLQGDDPENLKLAAXAKHYAVHSGPEKFRHTFNAVVSQKDLFETYLPAFRALVEAGVESVMGAYNRTLGEVCCASDYLIKDILRGRWAFKGHFVSDCWAIRDFHEHHKITKTPEESAALALNAGCDLNCGCTYPYLTASLKKGLVTEEAINTALERLLRTRFKLGMFDPPEHGRWGKLGRDVINCERHQKLALKAAEKSIVLLKNDKGLLPLDSSAKKLVVVGPAAANAHALFGNYYGVSSRFVTILEGLAEKVRDIYGINLEYRQGCLMYGYNNTSNPEFGQVEAAGMAMTFGQANPADIIIAVMGLDGAIEGEEGDAIASDSNGDRASIELPPWQLQFLQAIRAAGKSVILILTGGSPIAIPEDIADAIIFAWYPGELGGRAVADIIFGDVVPSGKLPITFPASTVQLPPYEDYSMKGRTYRYMTEKPLYPFGFGLSYTSFRFDSISLSAQSMSPNDTVTAAVTVSNTGKRDADEVVQIYIVKDDRGADDPLSSLKAFRRVSVPSGKSVTVEFELPAAAFETITAAGEPALIPGSYTVIAADSSPVSASTEKGAPAPVSAKVRVH*

📊 Sample Types

Isolate 6.2%
Metagenome 93.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 44.4%
Kalotermitidae 31.1%
Unclassified 17.8%
Rhinotermitidae 4.4%
Termopsidae 2.2%

🌳 Taxonomy

Archaea 0
Bacteria 126
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
2 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
3 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
4 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
5 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
6 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
7 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
8 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
9 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
10 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
11 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
12 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
13 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
14 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
15 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
16 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
17 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
18 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
19 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
20 2781125682 Treponema sp. Lab288P1bin107 Isolate Unclassified
21 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
22 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
23 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
24 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
25 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
26 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
27 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
28 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
29 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
30 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
31 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
32 2820551407 Unclassified Firmicutes Emb289P4bin38 Isolate Unclassified
33 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
34 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
35 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
36 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
37 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
38 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
39 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
40 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
41 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
42 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
43 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
44 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
45 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
46 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_006114 3300042612 Bacteria 10361
2 Ga0466705_248911 3300042612 Bacteria 6313
3 Ga0415639_019797 3300038395 Bacteria 5193
4 Ga0415639_031726 3300038395 Bacteria 24566
5 AustNasuHG_c1015691 3300000089 Bacteria 2551
6 JGI24698J34947_10000971 3300002449 Bacteria 14665
7 Ga0072941_1003323 3300005201 Bacteria 61307
8 Ga0072941_1004158 3300005201 Bacteria 12275
9 Ga0466704_233633 3300042643 Bacteria 14067
10 Ga0466708_055288 3300042652 Bacteria 15683
11 Ga0466712_229358 3300042614 Bacteria 24428
12 Ga0466711_162655 3300042615 Bacteria 9232
13 Ga0466718_045569 3300042617 Bacteria 37794
14 Ga0466720_126036 3300042607 Bacteria 7907
15 Ga0466722_210060 3300042609 Bacteria 7982
16 Ga0466694_314535 3300042594 Bacteria 20936
17 JGI24695J34938_10013401 3300002450 Bacteria 4308
18 Ga0466702_279673 3300042635 Bacteria 21112
19 Ga0466708_085239 3300042652 Bacteria 30570
20 Ga0466712_033719 3300042614 Bacteria 14827
21 Ga0466712_040163 3300042614 Bacteria 22289
22 Ga0466712_054826 3300042614 Bacteria 21309
23 Ga0466712_311510 3300042614 Bacteria 26569
24 Ga0466723_161578 3300042618 Bacteria 33286
25 Ga0466726_003829 3300042619 Bacteria 4136
26 Ga0466728_116288 3300042620 Bacteria 6077
27 Ga0466716_098896 3300042605 Bacteria 6112
28 Ga0466720_086055 3300042607 Bacteria 13531
29 Ga0466698_079295 3300042610 Bacteria 4853
30 Ga0466699_079870 3300042597 Bacteria 2902
31 JGI24702J35022_10011192 3300002462 Bacteria 4998
32 Ga0072941_1006799 3300005201 Bacteria 21372
33 Ga0466712_142190 3300042614 Bacteria 5751
34 Ga0466718_058823 3300042617 Bacteria 5358
35 Ga0466718_060846 3300042617 Unclassified 5284
36 Ga0466721_252112 3300042608 Bacteria 2172
37 Ga0466722_006875 3300042609 Bacteria 5077
38 Ga0466691_050768 3300042593 Bacteria 73218
39 AustNasuHG_c1017438 3300000089 Unclassified 2388
40 JGI24695J34938_10012868 3300002450 Bacteria 4417
41 Ga0466703_005378 3300042636 Bacteria 21587
42 Ga0466704_475978 3300042643 Bacteria 49461
43 Ga0466709_050184 3300042648 Bacteria 11660
44 Ga0123356_10000292 3300010049 Bacteria 57576
45 Ga0123356_10043022 3300010049 Bacteria 4205
46 Ga0123354_10199183 3300010882 Bacteria 2209
47 Ga0466712_196064 3300042614 Bacteria 8133
48 Ga0466712_318831 3300042614 Bacteria 13299
49 Ga0466728_143358 3300042620 Bacteria 14463
50 Ga0466720_009690 3300042607 Bacteria 7803
51 Ga0466720_012731 3300042607 Bacteria 38091
52 Ga0466720_020503 3300042607 Bacteria 7200
53 Ga0466694_300225 3300042594 Bacteria 7630
54 Ga0466696_298956 3300042596 Bacteria 3765
55 Ga0466696_418989 3300042596 Bacteria 5568
56 Ga0466699_006203 3300042597 Bacteria 4558
57 Ga0466699_281422 3300042597 Bacteria 13155
58 Ga0072940_1057666 3300005200 Bacteria 7262
59 Ga0123357_10000140 3300009784 Bacteria 63300
60 Ga0466712_016804 3300042614 Bacteria 11341
61 Ga0466712_190364 3300042614 Bacteria 6472
62 Ga0466718_011480 3300042617 Bacteria 8518
63 Ga0466718_022824 3300042617 Bacteria 6783
64 Ga0466723_305983 3300042618 Bacteria 3988
65 Ga0466716_091245 3300042605 Bacteria 7246
66 Ga0466720_011344 3300042607 Bacteria 20957
67 Ga0466732_287796 3300042656 Bacteria 3037
68 Ga0466692_202348 3300042591 Bacteria 11392
69 Ga0466694_250118 3300042594 Bacteria 44488
70 AustNasuHG_c1011247 3300000089 Bacteria 3103
71 JGI24698J34947_10005743 3300002449 Bacteria 6803
72 JGI24702J35022_10000482 3300002462 Bacteria 24054
73 Ga0072941_1004616 3300005201 Bacteria 18977
74 Ga0123356_10000186 3300010049 Bacteria 71358
75 Ga0466712_126441 3300042614 Bacteria 83990
76 Ga0466711_367581 3300042615 Bacteria 22515
77 Ga0466718_013140 3300042617 Bacteria 10114
78 Ga0466723_135272 3300042618 Bacteria 14640
79 Ga0466720_001847 3300042607 Bacteria 14739
80 Ga0466732_297993 3300042656 Bacteria 7106
81 Ga0466690_299107 3300042590 Bacteria 3710
82 Ga0466692_113399 3300042591 Bacteria 14052
83 Ga0466695_218867 3300042595 Bacteria 114312
84 AustNasuHG_c1014765 3300000089 Unclassified 2646
85 JGI24698J34947_10001143 3300002449 Bacteria 13784
86 JGI24698J34947_10005628 3300002449 Bacteria 6871
87 JGI24695J34938_10000316 3300002450 Bacteria 47576
88 JGI24695J34938_10000906 3300002450 Bacteria 27340
89 JGI24695J34938_10008031 3300002450 Bacteria 6084
90 JGI24695J34938_10009420 3300002450 Bacteria 5430
91 JGI24695J34938_10015624 3300002450 Bacteria 3890
92 JGI24702J35022_10006867 3300002462 Bacteria 6553
93 Ga0072941_1002032 3300005201 Bacteria 29987
94 Ga0072941_1007693 3300005201 Bacteria 51270
95 Ga0072941_1012361 3300005201 Unclassified 5496
96 Ga0123357_10000154 3300009784 Bacteria 61166
97 Ga0466709_155933 3300042648 Bacteria 22062
98 Ga0466712_009402 3300042614 Bacteria 14469
99 Ga0466715_216961 3300042616 Bacteria 4695
100 Ga0466718_053153 3300042617 Bacteria 9206
101 Ga0466716_035235 3300042605 Bacteria 2540
102 Ga0466719_118797 3300042606 Bacteria 11038
103 Ga0466720_055547 3300042607 Bacteria 8449
104 Ga0466720_163947 3300042607 Bacteria 6855
105 Ga0466722_105684 3300042609 Bacteria 11256
106 Ga0466699_010155 3300042597 Bacteria 15771
107 Ga0466699_116566 3300042597 Bacteria 14666
108 Ga0466699_328840 3300042597 Bacteria 14017
109 JGI24698J34947_10000646 3300002449 Bacteria 16856
110 JGI24698J34947_10001069 3300002449 Bacteria 14094
111 JGI24698J34947_10014499 3300002449 Bacteria 4291
112 JGI24695J34938_10000190 3300002450 Bacteria 57427
113 JGI24695J34938_10000234 3300002450 Bacteria 52922
114 JGI24695J34938_10003443 3300002450 Bacteria 11051
115 JGI24695J34938_10007033 3300002450 Bacteria 6663
116 JGI24695J34938_10007827 3300002450 Bacteria 6187
117 Ga0072941_1006486 3300005201 Bacteria 33115
118 Ga0123353_10040123 3300010167 Bacteria 7382
119 Ga0466720_014684 3300042607 Bacteria 5900
120 Ga0466720_036422 3300042607 Bacteria 3534
121 Ga0466720_038694 3300042607 Bacteria 8475
122 Ga0466720_039745 3300042607 Bacteria 2907

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300005200 Ga0072940_1057666 Ga0072940_10576663 576
2 3300005201 Ga0072941_1012361 Ga0072941_10123613 593
3 3300005201 Ga0072941_1007693 Ga0072941_100769317 600
4 3300005201 Ga0072941_1006799 Ga0072941_100679923 632
5 iso_pr_bacteria 2820551407 2820551548 639
6 3300009784 Ga0123357_10000154 Ga0123357_100001544 640
7 3300042608 Ga0466721_252112 Ga0466721_252112_19_1974 651
8 3300005201 Ga0072941_1003323 Ga0072941_100332322 656
9 3300002450 JGI24695J34938_10000906 JGI24695J34938_1000090616 658
10 3300010882 Ga0123354_10199183 Ga0123354_101991831 675
11 3300042597 Ga0466699_079870 Ga0466699_079870_732_2819 677
12 3300042595 Ga0466695_218867 Ga0466695_218867_1188_3269 679
13 3300042612 Ga0466705_248911 Ga0466705_248911_2347_4434 679
14 3300042636 Ga0466703_005378 Ga0466703_005378_447_2534 682
15 3300042594 Ga0466694_250118 Ga0466694_250118_4915_7005 683
16 3300002450 JGI24695J34938_10000234 JGI24695J34938_1000023419 684
17 3300000089 AustNasuHG_c1017438 AustNasuHG_10174381 686
18 3300042607 Ga0466720_014684 Ga0466720_014684_2687_4762 686
19 3300042607 Ga0466720_036422 Ga0466720_036422_885_2972 687
20 3300042597 Ga0466699_006203 Ga0466699_006203_2384_4504 688
21 3300042607 Ga0466720_055547 Ga0466720_055547_42_2141 688
22 3300002449 JGI24698J34947_10005743 JGI24698J34947_100057431 689
23 3300042607 Ga0466720_011344 Ga0466720_011344_80_2176 689
24 3300042594 Ga0466694_314535 Ga0466694_314535_3475_5562 690
25 3300002450 JGI24695J34938_10015624 JGI24695J34938_100156243 691
26 3300042607 Ga0466720_009690 Ga0466720_009690_1753_3861 691
27 3300042617 Ga0466718_011480 Ga0466718_011480_4728_6827 691
28 3300042607 Ga0466720_012731 Ga0466720_012731_4862_6940 692
29 3300042607 Ga0466720_039745 Ga0466720_039745_80_2191 692
30 3300042615 Ga0466711_367581 Ga0466711_367581_757_2838 693
31 3300042619 Ga0466726_003829 Ga0466726_003829_759_2855 693
32 iso_pr_bacteria 2781125662 2781335892 693
33 3300010049 Ga0123356_10000292 Ga0123356_1000029230 694
34 3300042617 Ga0466718_053153 Ga0466718_053153_4592_6676 694
35 3300042652 Ga0466708_085239 Ga0466708_085239_23197_25281 694
36 3300042656 Ga0466732_287796 Ga0466732_287796_574_2673 694
37 3300042656 Ga0466732_297993 Ga0466732_297993_984_3068 694
38 iso_pr_bacteria 2781125696 2781440970 694
39 3300002450 JGI24695J34938_10003443 JGI24695J34938_1000344310 695
40 3300002462 JGI24702J35022_10011192 JGI24702J35022_100111923 695
41 3300038395 Ga0415639_031726 Ga0415639_031726_12331_14418 695
42 3300042594 Ga0466694_300225 Ga0466694_300225_4563_6650 695
43 3300042596 Ga0466696_418989 Ga0466696_418989_1809_3896 695
44 3300042597 Ga0466699_328840 Ga0466699_328840_2373_4460 695
45 3300042605 Ga0466716_098896 Ga0466716_098896_3340_5427 695
46 3300042609 Ga0466722_006875 Ga0466722_006875_761_2848 695
47 3300042609 Ga0466722_105684 Ga0466722_105684_7483_9570 695
48 3300042609 Ga0466722_210060 Ga0466722_210060_3671_5758 695
49 3300042610 Ga0466698_079295 Ga0466698_079295_2352_4439 695
50 3300042614 Ga0466712_033719 Ga0466712_033719_931_3018 695
51 3300042614 Ga0466712_126441 Ga0466712_126441_40555_42642 695
52 3300042614 Ga0466712_311510 Ga0466712_311510_7180_9267 695
53 3300042616 Ga0466715_216961 Ga0466715_216961_486_2573 695
54 3300042617 Ga0466718_013140 Ga0466718_013140_4316_6403 695
55 3300042617 Ga0466718_022824 Ga0466718_022824_188_2275 695
56 3300042617 Ga0466718_045569 Ga0466718_045569_29476_31563 695
57 3300042617 Ga0466718_060846 Ga0466718_060846_1736_3823 695
58 3300042618 Ga0466723_305983 Ga0466723_305983_392_2479 695
59 3300042643 Ga0466704_233633 Ga0466704_233633_1555_3642 695
60 3300042648 Ga0466709_155933 Ga0466709_155933_10450_12537 695
61 iso_pr_bacteria 2781125642 2781293089 695
62 iso_pr_bacteria 2781125658 2781324562 695
63 3300000089 AustNasuHG_c1011247 AustNasuHG_10112472 696
64 3300000089 AustNasuHG_c1014765 AustNasuHG_10147652 696
65 3300000089 AustNasuHG_c1015691 AustNasuHG_10156911 696
66 3300002449 JGI24698J34947_10001143 JGI24698J34947_100011436 696
67 3300002450 JGI24695J34938_10000190 JGI24695J34938_1000019039 696
68 3300002450 JGI24695J34938_10000316 JGI24695J34938_100003162 696
69 3300002450 JGI24695J34938_10007033 JGI24695J34938_100070334 696
70 3300002450 JGI24695J34938_10008031 JGI24695J34938_100080313 696
71 3300002450 JGI24695J34938_10013401 JGI24695J34938_100134012 696
72 3300010049 Ga0123356_10000186 Ga0123356_1000018643 696
73 3300042614 Ga0466712_040163 Ga0466712_040163_2363_4453 696
74 3300042614 Ga0466712_142190 Ga0466712_142190_3511_5601 696
75 3300042614 Ga0466712_196064 Ga0466712_196064_1826_3916 696
76 3300042620 Ga0466728_143358 Ga0466728_143358_9661_11766 696
77 3300002449 JGI24698J34947_10000971 JGI24698J34947_100009718 697
78 3300010049 Ga0123356_10043022 Ga0123356_100430223 697
79 3300042597 Ga0466699_281422 Ga0466699_281422_5048_7141 697
80 3300042614 Ga0466712_190364 Ga0466712_190364_278_2371 697
81 3300005201 Ga0072941_1006486 Ga0072941_100648620 698
82 3300042607 Ga0466720_001847 Ga0466720_001847_10629_12728 699
83 3300042607 Ga0466720_086055 Ga0466720_086055_3158_5257 699
84 3300042607 Ga0466720_126036 Ga0466720_126036_2451_4550 699
85 3300042607 Ga0466720_163947 Ga0466720_163947_3331_5445 699
86 3300042652 Ga0466708_055288 Ga0466708_055288_2391_4490 699
87 3300002450 JGI24695J34938_10009420 JGI24695J34938_100094202 700
88 3300042590 Ga0466690_299107 Ga0466690_299107_713_2815 700
89 3300042591 Ga0466692_113399 Ga0466692_113399_458_2560 700
90 3300042593 Ga0466691_050768 Ga0466691_050768_15297_17399 700
91 3300042596 Ga0466696_298956 Ga0466696_298956_398_2500 700
92 3300042607 Ga0466720_020503 Ga0466720_020503_2071_4173 700
93 3300042612 Ga0466705_006114 Ga0466705_006114_7297_9399 700
94 3300042614 Ga0466712_229358 Ga0466712_229358_21284_23386 700
95 3300042618 Ga0466723_161578 Ga0466723_161578_12727_14829 700
96 3300042643 Ga0466704_475978 Ga0466704_475978_7108_9210 700
97 3300002450 JGI24695J34938_10012868 JGI24695J34938_100128682 701
98 3300042591 Ga0466692_202348 Ga0466692_202348_8570_10675 701
99 3300042605 Ga0466716_091245 Ga0466716_091245_4921_7026 701
100 3300042606 Ga0466719_118797 Ga0466719_118797_8583_10688 701
101 3300042618 Ga0466723_135272 Ga0466723_135272_10547_12652 701
102 3300042648 Ga0466709_050184 Ga0466709_050184_8336_10441 701
103 3300002449 JGI24698J34947_10000646 JGI24698J34947_100006468 702
104 3300042605 Ga0466716_035235 Ga0466716_035235_46_2178 702
105 3300042614 Ga0466712_016804 Ga0466712_016804_639_2747 702
106 3300042620 Ga0466728_116288 Ga0466728_116288_2400_4508 702
107 3300002462 JGI24702J35022_10000482 JGI24702J35022_1000048210 703
108 3300042617 Ga0466718_058823 Ga0466718_058823_513_2624 703
109 3300002450 JGI24695J34938_10007827 JGI24695J34938_100078272 705
110 3300038395 Ga0415639_019797 Ga0415639_019797_1827_3944 705
111 3300002462 JGI24702J35022_10006867 JGI24702J35022_100068672 706
112 3300042597 Ga0466699_116566 Ga0466699_116566_7513_9633 706
113 3300010167 Ga0123353_10040123 Ga0123353_100401233 707
114 3300042614 Ga0466712_009402 Ga0466712_009402_4287_6410 707
115 3300042614 Ga0466712_318831 Ga0466712_318831_8867_10990 707
116 iso_pr_bacteria 2781125666 2781343481 707
117 3300002449 JGI24698J34947_10014499 JGI24698J34947_100144992 708
118 3300009784 Ga0123357_10000140 Ga0123357_100001405 708
119 3300042607 Ga0466720_038694 Ga0466720_038694_5503_7629 708
120 iso_pr_bacteria 2781125682 2781409938 708
121 iso_pr_bacteria 2781125697 2781442888 710
122 3300042614 Ga0466712_054826 Ga0466712_054826_5064_7205 713
123 3300042635 Ga0466702_279673 Ga0466702_279673_2934_5075 713
124 3300005201 Ga0072941_1004158 Ga0072941_10041586 714
125 3300042615 Ga0466711_162655 Ga0466711_162655_509_2659 716
126 3300042597 Ga0466699_010155 Ga0466699_010155_7526_9679 717
127 3300005201 Ga0072941_1002032 Ga0072941_100203224 721
128 3300005201 Ga0072941_1004616 Ga0072941_100461621 724
129 3300002449 JGI24698J34947_10001069 JGI24698J34947_100010698 727
130 3300002449 JGI24698J34947_10005628 JGI24698J34947_100056282 728

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF14310 Fn3-like Fibronectin type III-like domain 637 706 0.98
PF01915 Glyco_hydro_3_C Glycosyl hydrolase family 3 C-terminal domain 360 600 0.92
PF00933 Glyco_hydro_3 Glycosyl hydrolase family 3 N terminal domain 51 319 0.86

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.93 0.94 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.