Protein Family IF00466
Metagenome
Isolate
117
Members
37
Samples
108
Scaffolds
627.23
Avg Length
Representative Sequence
- ID
- 3300002449|JGI24698J34947_10000233|JGI24698J34947_100002333
- Length
- 654 aa
- Sequence
- MNFALKGRVMRINSNLILDDEGRVLILRGANLGGDSKIPFCPPGGEIDPEFLNTKKEISFIGRPFPLEEAESHFSRLKKAGLSFLRLLVTWEAVEHEGPGIYDEAYLAYLRKILLAAEKMDICVFIDPHQDVWSRWTGGDGAPAWTMEKLGMDLDKLDACGAAITRQRYSIYHKSKKHPDGSPYPKMIWPSNYNRYAAATMLSLFFAGITYAPDLQVDGENVQDWLQNRYIAAFRHVQRRLKNCAAIKGWGAMNEPHWGFVGQRNLKLIEDVMIPIGPRPTPWQSIRAASGYQVEVPVYGASSMGKRISHYETFNPQGISLFREGFSCPWKQAGVWKDEGGAPKLLRADHFSKYQDRSPEFADDFLKPFIVKYINAMKEADERGFFFIEGLPHCTDINSHPSWNSNDPCNVINAFHWYDGLSLFTKSFRSWFNVNIDAEKIIIGKKRVGAYFAKCLQKGIDCTRRKMGDVPCLLGEFGLAFDMNNRRGFTTGDYSQHEQALSMYYDAVDSNLLHSTIWNYSASNTNKYGDGWNDEDLSIFSEGRERAAAGWKRPYPMATAGKPVLFKWNRKRGEFVFRFYADREIVSPSLIYLPPEMAPSLEGTSPKIEVRTGGGENLRWEYRYEEQRLLIYNDDYSGEAELKIRSVLNQTLD*
Sample Types
Isolate
7.7%
Metagenome
92.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
48.6%
Unclassified
28.6%
Kalotermitidae
20.0%
Termopsidae
2.9%
Taxonomy
Archaea
0
Bacteria
114
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 2 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 3 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 4 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 5 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 6 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 7 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 8 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 9 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 10 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 11 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 12 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 13 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 14 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 15 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 16 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 17 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 18 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 19 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 20 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 21 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 22 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 23 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 24 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 25 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 26 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 27 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 28 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 29 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 30 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 31 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 32 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 33 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 34 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 35 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 36 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 37 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0415639_060150 | 3300038395 | Bacteria | 4346 |
| 2 | Ga0466691_085450 | 3300042593 | Bacteria | 7150 |
| 3 | Ga0466699_122680 | 3300042597 | Bacteria | 7588 |
| 4 | JGI24698J34947_10000061 | 3300002449 | Bacteria | 33883 |
| 5 | JGI24698J34947_10005027 | 3300002449 | Bacteria | 7246 |
| 6 | JGI24698J34947_10008568 | 3300002449 | Bacteria | 5613 |
| 7 | JGI24698J34947_10021190 | 3300002449 | Bacteria | 3498 |
| 8 | JGI24695J34938_10000190 | 3300002450 | Bacteria | 57427 |
| 9 | JGI24695J34938_10006634 | 3300002450 | Bacteria | 6905 |
| 10 | JGI24695J34938_10009803 | 3300002450 | Bacteria | 5299 |
| 11 | JGI24695J34938_10015233 | 3300002450 | Bacteria | 3950 |
| 12 | Ga0072941_1023968 | 3300005201 | Bacteria | 6629 |
| 13 | Ga0123356_10023620 | 3300010049 | Bacteria | 5784 |
| 14 | Ga0466712_274451 | 3300042614 | Bacteria | 11220 |
| 15 | Ga0466712_303257 | 3300042614 | Unclassified | 4461 |
| 16 | Ga0466718_062648 | 3300042617 | Bacteria | 6108 |
| 17 | Ga0466718_131236 | 3300042617 | Bacteria | 16931 |
| 18 | Ga0466720_073547 | 3300042607 | Bacteria | 6563 |
| 19 | Ga0466720_217858 | 3300042607 | Bacteria | 11164 |
| 20 | Ga0466699_008368 | 3300042597 | Bacteria | 35242 |
| 21 | Ga0466699_169800 | 3300042597 | Bacteria | 16672 |
| 22 | AustNasuHG_c1012826 | 3300000089 | Bacteria | 2886 |
| 23 | JGI24698J34947_10009325 | 3300002449 | Unclassified | 5388 |
| 24 | JGI24698J34947_10010376 | 3300002449 | Bacteria | 5108 |
| 25 | JGI24698J34947_10024948 | 3300002449 | Bacteria | 3186 |
| 26 | JGI24695J34938_10000338 | 3300002450 | Bacteria | 46275 |
| 27 | JGI24695J34938_10000366 | 3300002450 | Bacteria | 44825 |
| 28 | Ga0072940_1010386 | 3300005200 | Bacteria | 7240 |
| 29 | Ga0072941_1012151 | 3300005201 | Bacteria | 14863 |
| 30 | Ga0123356_10001757 | 3300010049 | Bacteria | 23604 |
| 31 | Ga0123356_10026734 | 3300010049 | Bacteria | 5414 |
| 32 | Ga0466735_212933 | 3300042624 | Bacteria | 3401 |
| 33 | Ga0466702_222629 | 3300042635 | Bacteria | 24290 |
| 34 | Ga0466712_062366 | 3300042614 | Bacteria | 14422 |
| 35 | Ga0466712_127075 | 3300042614 | Bacteria | 33532 |
| 36 | Ga0466720_224848 | 3300042607 | Bacteria | 5637 |
| 37 | Ga0466694_319436 | 3300042594 | Bacteria | 51857 |
| 38 | AustNasuHG_c1000547 | 3300000089 | Bacteria | 13225 |
| 39 | JGI24698J34947_10024307 | 3300002449 | Bacteria | 3237 |
| 40 | JGI24695J34938_10000591 | 3300002450 | Bacteria | 34913 |
| 41 | JGI24695J34938_10017470 | 3300002450 | Bacteria | 3612 |
| 42 | Ga0072941_1062744 | 3300005201 | Bacteria | 3845 |
| 43 | Ga0466712_012702 | 3300042614 | Bacteria | 4877 |
| 44 | Ga0466712_043487 | 3300042614 | Bacteria | 20906 |
| 45 | Ga0466712_246247 | 3300042614 | Bacteria | 21510 |
| 46 | Ga0466718_044314 | 3300042617 | Bacteria | 20111 |
| 47 | JGI24698J34947_10013479 | 3300002449 | Bacteria | 4463 |
| 48 | JGI24698J34947_10020794 | 3300002449 | Bacteria | 3533 |
| 49 | JGI24698J34947_10047954 | 3300002449 | Bacteria | 2165 |
| 50 | JGI24695J34938_10000181 | 3300002450 | Bacteria | 58662 |
| 51 | JGI24695J34938_10001748 | 3300002450 | Bacteria | 17965 |
| 52 | JGI24695J34938_10020044 | 3300002450 | Bacteria | 3299 |
| 53 | Ga0072941_1011859 | 3300005201 | Bacteria | 13484 |
| 54 | Ga0466712_044599 | 3300042614 | Bacteria | 16671 |
| 55 | Ga0466712_054361 | 3300042614 | Bacteria | 7582 |
| 56 | Ga0466712_084865 | 3300042614 | Bacteria | 39681 |
| 57 | Ga0466712_158877 | 3300042614 | Bacteria | 28725 |
| 58 | Ga0466715_070372 | 3300042616 | Bacteria | 4576 |
| 59 | Ga0264413_123900 | 3300024493 | Bacteria | 3613 |
| 60 | Ga0466691_027957 | 3300042593 | Bacteria | 22169 |
| 61 | JGI24698J34947_10000233 | 3300002449 | Bacteria | 23039 |
| 62 | JGI24698J34947_10009242 | 3300002449 | Bacteria | 5407 |
| 63 | JGI24702J35022_10013898 | 3300002462 | Bacteria | 4449 |
| 64 | Ga0466708_037564 | 3300042652 | Bacteria | 5239 |
| 65 | Ga0466712_066534 | 3300042614 | Bacteria | 29891 |
| 66 | Ga0466712_254864 | 3300042614 | Bacteria | 9024 |
| 67 | Ga0466712_318371 | 3300042614 | Bacteria | 8235 |
| 68 | Ga0466723_050790 | 3300042618 | Bacteria | 7951 |
| 69 | Ga0466723_198332 | 3300042618 | Bacteria | 2694 |
| 70 | Ga0466707_038654 | 3300042601 | Bacteria | 10703 |
| 71 | Ga0264413_104615 | 3300024493 | Bacteria | 27626 |
| 72 | Ga0264413_107331 | 3300024493 | Bacteria | 5846 |
| 73 | Ga0466699_117245 | 3300042597 | Bacteria | 16245 |
| 74 | Ga0466699_351125 | 3300042597 | Bacteria | 16883 |
| 75 | JGI24698J34947_10025331 | 3300002449 | Bacteria | 3159 |
| 76 | JGI24695J34938_10011318 | 3300002450 | Bacteria | 4813 |
| 77 | JGI24695J34938_10022998 | 3300002450 | Bacteria | 3013 |
| 78 | Ga0072941_1000430 | 3300005201 | Bacteria | 6075 |
| 79 | Ga0072941_1030846 | 3300005201 | Bacteria | 9286 |
| 80 | Ga0072941_1048034 | 3300005201 | Bacteria | 7495 |
| 81 | Ga0466712_081917 | 3300042614 | Bacteria | 63418 |
| 82 | Ga0466716_260907 | 3300042605 | Bacteria | 2510 |
| 83 | Ga0415639_151858 | 3300038395 | Bacteria | 2512 |
| 84 | Ga0466690_221697 | 3300042590 | Bacteria | 2821 |
| 85 | Ga0466693_011338 | 3300042592 | Bacteria | 13186 |
| 86 | Ga0466694_051046 | 3300042594 | Bacteria | 57740 |
| 87 | AustNasuHG_c1000051 | 3300000089 | Bacteria | 30422 |
| 88 | JGI24698J34947_10000645 | 3300002449 | Bacteria | 16857 |
| 89 | JGI24698J34947_10010700 | 3300002449 | Bacteria | 5035 |
| 90 | JGI24695J34938_10024237 | 3300002450 | Bacteria | 2916 |
| 91 | JGI24700J35501_10888740 | 3300002508 | Bacteria | 2629 |
| 92 | Ga0072940_1113867 | 3300005200 | Bacteria | 8981 |
| 93 | Ga0072941_1000431 | 3300005201 | Bacteria | 4044 |
| 94 | Ga0072941_1007538 | 3300005201 | Bacteria | 5801 |
| 95 | Ga0072941_1012346 | 3300005201 | Bacteria | 7254 |
| 96 | Ga0466712_280501 | 3300042614 | Unclassified | 2085 |
| 97 | Ga0466718_044170 | 3300042617 | Bacteria | 4468 |
| 98 | Ga0466718_129838 | 3300042617 | Bacteria | 24094 |
| 99 | Ga0415639_126248 | 3300038395 | Bacteria | 3244 |
| 100 | Ga0466690_200197 | 3300042590 | Bacteria | 3234 |
| 101 | Ga0466695_318085 | 3300042595 | Bacteria | 14282 |
| 102 | JGI24698J34947_10009454 | 3300002449 | Bacteria | 5351 |
| 103 | Ga0123353_10009629 | 3300010167 | Bacteria | 13373 |
| 104 | Ga0466712_104949 | 3300042614 | Bacteria | 16888 |
| 105 | Ga0466712_159058 | 3300042614 | Bacteria | 4193 |
| 106 | Ga0466718_056259 | 3300042617 | Bacteria | 4401 |
| 107 | Ga0466718_103375 | 3300042617 | Bacteria | 9563 |
| 108 | Ga0466728_246130 | 3300042620 | Bacteria | 4038 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300005200 | Ga0072940_1010386 | Ga0072940_10103867 | 515 |
| 2 | 3300005201 | Ga0072941_1062744 | Ga0072941_10627444 | 516 |
| 3 | 3300024493 | Ga0264413_123900 | Ga0264413_1239004 | 520 |
| 4 | 3300042616 | Ga0466715_070372 | Ga0466715_070372_2044_3768 | 574 |
| 5 | 3300042605 | Ga0466716_260907 | Ga0466716_260907_284_2062 | 592 |
| 6 | 3300042620 | Ga0466728_246130 | Ga0466728_246130_142_1920 | 592 |
| 7 | 3300042590 | Ga0466690_221697 | Ga0466690_221697_812_2605 | 597 |
| 8 | 3300002450 | JGI24695J34938_10015233 | JGI24695J34938_100152332 | 606 |
| 9 | 3300042618 | Ga0466723_050790 | Ga0466723_050790_948_2849 | 606 |
| 10 | 3300002450 | JGI24695J34938_10000591 | JGI24695J34938_1000059126 | 615 |
| 11 | 3300042624 | Ga0466735_212933 | Ga0466735_212933_72_1925 | 617 |
| 12 | 3300002449 | JGI24698J34947_10009325 | JGI24698J34947_100093255 | 619 |
| 13 | 3300002449 | JGI24698J34947_10013479 | JGI24698J34947_100134792 | 619 |
| 14 | 3300042607 | Ga0466720_073547 | Ga0466720_073547_3097_4956 | 619 |
| 15 | 3300042607 | Ga0466720_224848 | Ga0466720_224848_2206_4065 | 619 |
| 16 | 3300042614 | Ga0466712_254864 | Ga0466712_254864_6782_8644 | 620 |
| 17 | 3300002450 | JGI24695J34938_10000338 | JGI24695J34938_1000033816 | 621 |
| 18 | 3300002450 | JGI24695J34938_10011318 | JGI24695J34938_100113184 | 622 |
| 19 | 3300038395 | Ga0415639_126248 | Ga0415639_126248_800_2671 | 623 |
| 20 | 3300042617 | Ga0466718_044314 | Ga0466718_044314_14883_16754 | 623 |
| 21 | iso_pr_bacteria | 2819992462 | 2819994008 | 623 |
| 22 | iso_pr_bacteria | 2820020240 | 2820021355 | 623 |
| 23 | 3300000089 | AustNasuHG_c1000051 | AustNasuHG_100005121 | 624 |
| 24 | 3300042597 | Ga0466699_117245 | Ga0466699_117245_12553_14427 | 624 |
| 25 | 3300010049 | Ga0123356_10001757 | Ga0123356_1000175712 | 625 |
| 26 | 3300042597 | Ga0466699_122680 | Ga0466699_122680_3079_4956 | 625 |
| 27 | 3300042597 | Ga0466699_169800 | Ga0466699_169800_958_2838 | 626 |
| 28 | 3300042597 | Ga0466699_351125 | Ga0466699_351125_1149_3029 | 626 |
| 29 | 3300042614 | Ga0466712_081917 | Ga0466712_081917_31297_33177 | 626 |
| 30 | iso_pr_bacteria | 2781125644 | 2781295676 | 626 |
| 31 | 3300002449 | JGI24698J34947_10000061 | JGI24698J34947_100000616 | 627 |
| 32 | 3300002450 | JGI24695J34938_10000190 | JGI24695J34938_1000019051 | 627 |
| 33 | 3300042614 | Ga0466712_066534 | Ga0466712_066534_13064_14947 | 627 |
| 34 | 3300042635 | Ga0466702_222629 | Ga0466702_222629_16362_18245 | 627 |
| 35 | iso_pr_bacteria | 2781125645 | 2781300034 | 627 |
| 36 | 3300002450 | JGI24695J34938_10000366 | JGI24695J34938_1000036623 | 628 |
| 37 | 3300002450 | JGI24695J34938_10006634 | JGI24695J34938_100066345 | 628 |
| 38 | 3300005201 | Ga0072941_1000430 | Ga0072941_10004306 | 628 |
| 39 | 3300005201 | Ga0072941_1012151 | Ga0072941_101215110 | 628 |
| 40 | 3300010049 | Ga0123356_10026734 | Ga0123356_100267343 | 628 |
| 41 | 3300038395 | Ga0415639_060150 | Ga0415639_060150_1804_3690 | 628 |
| 42 | iso_pr_bacteria | 2781125634 | 2781275251 | 628 |
| 43 | 3300010049 | Ga0123356_10023620 | Ga0123356_100236202 | 629 |
| 44 | 3300042592 | Ga0466693_011338 | Ga0466693_011338_10369_12258 | 629 |
| 45 | 3300042617 | Ga0466718_129838 | Ga0466718_129838_13477_15366 | 629 |
| 46 | 3300042617 | Ga0466718_131236 | Ga0466718_131236_8357_10246 | 629 |
| 47 | 3300000089 | AustNasuHG_c1000547 | AustNasuHG_10005474 | 630 |
| 48 | 3300002449 | JGI24698J34947_10009454 | JGI24698J34947_100094543 | 630 |
| 49 | 3300002450 | JGI24695J34938_10001748 | JGI24695J34938_100017486 | 630 |
| 50 | 3300002450 | JGI24695J34938_10009803 | JGI24695J34938_100098034 | 631 |
| 51 | 3300002450 | JGI24695J34938_10024237 | JGI24695J34938_100242372 | 631 |
| 52 | 3300005200 | Ga0072940_1113867 | Ga0072940_11138673 | 631 |
| 53 | 3300005201 | Ga0072941_1012346 | Ga0072941_10123464 | 632 |
| 54 | 3300010167 | Ga0123353_10009629 | Ga0123353_100096295 | 632 |
| 55 | 3300042594 | Ga0466694_051046 | Ga0466694_051046_30141_32039 | 632 |
| 56 | 3300042614 | Ga0466712_054361 | Ga0466712_054361_3974_5872 | 632 |
| 57 | 3300042614 | Ga0466712_084865 | Ga0466712_084865_2426_4324 | 632 |
| 58 | iso_pr_bacteria | 2781125648 | 2781306050 | 632 |
| 59 | 3300002450 | JGI24695J34938_10020044 | JGI24695J34938_100200442 | 633 |
| 60 | 3300005201 | Ga0072941_1000431 | Ga0072941_10004313 | 633 |
| 61 | 3300024493 | Ga0264413_104615 | Ga0264413_1046153 | 633 |
| 62 | 3300024493 | Ga0264413_107331 | Ga0264413_1073314 | 633 |
| 63 | 3300042597 | Ga0466699_008368 | Ga0466699_008368_6084_7985 | 633 |
| 64 | 3300042614 | Ga0466712_303257 | Ga0466712_303257_1674_3575 | 633 |
| 65 | 3300042617 | Ga0466718_044170 | Ga0466718_044170_1697_3598 | 633 |
| 66 | 3300042617 | Ga0466718_056259 | Ga0466718_056259_162_2063 | 633 |
| 67 | 3300042617 | Ga0466718_103375 | Ga0466718_103375_6819_8720 | 633 |
| 68 | iso_pr_bacteria | 2819994798 | 2819994815 | 633 |
| 69 | 3300000089 | AustNasuHG_c1012826 | AustNasuHG_10128262 | 634 |
| 70 | 3300002449 | JGI24698J34947_10025331 | JGI24698J34947_100253312 | 634 |
| 71 | 3300002508 | JGI24700J35501_10888740 | JGI24700J35501_108887401 | 634 |
| 72 | 3300005201 | Ga0072941_1007538 | Ga0072941_10075386 | 634 |
| 73 | 3300042614 | Ga0466712_159058 | Ga0466712_159058_386_2290 | 634 |
| 74 | 3300042614 | Ga0466712_246247 | Ga0466712_246247_17605_19509 | 634 |
| 75 | 3300042617 | Ga0466718_062648 | Ga0466718_062648_2062_3966 | 634 |
| 76 | 3300042618 | Ga0466723_198332 | Ga0466723_198332_487_2391 | 634 |
| 77 | 3300002449 | JGI24698J34947_10005027 | JGI24698J34947_100050273 | 635 |
| 78 | 3300002449 | JGI24698J34947_10010700 | JGI24698J34947_100107004 | 635 |
| 79 | 3300002449 | JGI24698J34947_10021190 | JGI24698J34947_100211902 | 635 |
| 80 | 3300002449 | JGI24698J34947_10024307 | JGI24698J34947_100243072 | 635 |
| 81 | 3300002449 | JGI24698J34947_10024948 | JGI24698J34947_100249482 | 635 |
| 82 | 3300002449 | JGI24698J34947_10047954 | JGI24698J34947_100479541 | 635 |
| 83 | 3300005201 | Ga0072941_1023968 | Ga0072941_10239684 | 635 |
| 84 | 3300005201 | Ga0072941_1048034 | Ga0072941_10480343 | 635 |
| 85 | 3300042595 | Ga0466695_318085 | Ga0466695_318085_6432_8339 | 635 |
| 86 | 3300042607 | Ga0466720_217858 | Ga0466720_217858_4391_6298 | 635 |
| 87 | 3300042614 | Ga0466712_104949 | Ga0466712_104949_6858_8765 | 635 |
| 88 | 3300042614 | Ga0466712_280501 | Ga0466712_280501_77_1984 | 635 |
| 89 | iso_pr_bacteria | 2781125641 | 2781291467 | 635 |
| 90 | iso_pr_bacteria | 2781125695 | 2781439012 | 635 |
| 91 | 3300002449 | JGI24698J34947_10020794 | JGI24698J34947_100207942 | 636 |
| 92 | 3300002450 | JGI24695J34938_10000181 | JGI24695J34938_1000018122 | 636 |
| 93 | 3300002450 | JGI24695J34938_10017470 | JGI24695J34938_100174703 | 636 |
| 94 | 3300002462 | JGI24702J35022_10013898 | JGI24702J35022_100138981 | 636 |
| 95 | 3300038395 | Ga0415639_151858 | Ga0415639_151858_427_2337 | 636 |
| 96 | 3300042614 | Ga0466712_127075 | Ga0466712_127075_18019_19929 | 636 |
| 97 | 3300042614 | Ga0466712_158877 | Ga0466712_158877_14594_16504 | 636 |
| 98 | 3300042614 | Ga0466712_043487 | Ga0466712_043487_2859_4772 | 637 |
| 99 | 3300002449 | JGI24698J34947_10008568 | JGI24698J34947_100085687 | 638 |
| 100 | 3300042614 | Ga0466712_062366 | Ga0466712_062366_6330_8246 | 638 |
| 101 | 3300042652 | Ga0466708_037564 | Ga0466708_037564_3247_5223 | 638 |
| 102 | 3300002449 | JGI24698J34947_10010376 | JGI24698J34947_100103765 | 639 |
| 103 | 3300005201 | Ga0072941_1030846 | Ga0072941_10308462 | 639 |
| 104 | 3300042590 | Ga0466690_200197 | Ga0466690_200197_1057_2979 | 640 |
| 105 | 3300042614 | Ga0466712_012702 | Ga0466712_012702_1409_3331 | 640 |
| 106 | 3300042614 | Ga0466712_274451 | Ga0466712_274451_6401_8323 | 640 |
| 107 | 3300042614 | Ga0466712_318371 | Ga0466712_318371_3977_5899 | 640 |
| 108 | 3300002449 | JGI24698J34947_10000645 | JGI24698J34947_1000064512 | 641 |
| 109 | 3300002449 | JGI24698J34947_10009242 | JGI24698J34947_100092424 | 641 |
| 110 | 3300005201 | Ga0072941_1011859 | Ga0072941_101185913 | 641 |
| 111 | 3300042593 | Ga0466691_085450 | Ga0466691_085450_4495_6429 | 644 |
| 112 | 3300042594 | Ga0466694_319436 | Ga0466694_319436_26697_28631 | 644 |
| 113 | 3300042601 | Ga0466707_038654 | Ga0466707_038654_4252_6186 | 644 |
| 114 | 3300042614 | Ga0466712_044599 | Ga0466712_044599_10599_12533 | 644 |
| 115 | 3300042593 | Ga0466691_027957 | Ga0466691_027957_5254_7197 | 647 |
| 116 | 3300002450 | JGI24695J34938_10022998 | JGI24695J34938_100229981 | 648 |
| 117 | 3300002449 | JGI24698J34947_10000233 | JGI24698J34947_100002333 | 654 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.94 | 0.94 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.