Protein Family IF00465

Metagenome Isolate
162 Members
57 Samples
149 Scaffolds
457.14 Avg Length

🧬 Representative Sequence

ID
3300002449|JGI24698J34947_10000228|JGI24698J34947_100002282
Length
513 aa
Sequence
LWNLCFFVSIDMFYWLVLVLSIRVEYWVNPRYWRPGFLSAILPIVKKQKTFVFRCSSCGHEEPKWLGRCPECGEWNTLIETSISGNRGVNQGKRSAEAPPQSMPLSTVDPLEGTRIKSGIDELDRVLGGGIMKRSAILVGGEPGIGKSTLLLQTAAAAGTKGRVLYVTGEESAGQVKMRADRLGVSGDRIEIFCSGNLQEIQPIIEALKPVLIMIDSAQTLFSTEAGSTPGTVNQMKYCSWELISWIKEHDSALFLTAHVTKDGFISGPKSLEHMVDTVLYFEDSAQTANNGDTRFLRAVKNRFGSVDEIGIFTMGEKGLSAVEDPSLLFLVRREGDLPPGIATAAVLEGSRTLLVEIQALTVPAKGSISRVFSDRIDSARVSRVAAVIEKHLGLRLSDQDLYINIAGGIRIAEVGVELALACALYSARTGVPVPAKTAIAGELSLAGEVRPLRRLPIRVKTARNLGFTEFLGPASSAGAAVEAGAEAMPTEGFFAFRNIREAVKAVFSVKV*

📊 Sample Types

Isolate 8.0%
Metagenome 92.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 30.9%
Unclassified 29.1%
Kalotermitidae 25.5%
Rhinotermitidae 7.3%
Termopsidae 5.5%
Hodotermitidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 154
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
2 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
3 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
4 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
5 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
6 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
7 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
8 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
9 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
10 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
11 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
12 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
13 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
14 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
15 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
16 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
17 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
18 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
19 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
20 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
21 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
22 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
23 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
24 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
25 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
26 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
27 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
28 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
29 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
30 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
31 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
32 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
33 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
34 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
35 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
36 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
37 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
38 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
39 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
40 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
41 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
42 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
43 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
44 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
45 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
46 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
47 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
48 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
49 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
50 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
51 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
52 2781125691 Treponema sp. Th196P3bin73 Isolate Unclassified
53 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
54 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
55 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
56 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
57 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123353_10424580 3300010167 Bacteria 1968
2 Ga0466711_410308 3300042615 Bacteria 7589
3 Ga0466723_234195 3300042618 Bacteria 3733
4 Ga0466728_064424 3300042620 Bacteria 3885
5 Ga0415639_011990 3300038395 Bacteria 15522
6 Ga0466690_125906 3300042590 Bacteria 4285
7 Ga0466690_335423 3300042590 Bacteria 3593
8 Ga0466699_007354 3300042597 Bacteria 15094
9 AustNasuHG_c1002424 3300000089 Bacteria 6736
10 JGI24698J34947_10000228 3300002449 Bacteria 23201
11 JGI24698J34947_10003600 3300002449 Bacteria 8414
12 JGI24698J34947_10006626 3300002449 Unclassified 6362
13 JGI24695J34938_10000339 3300002450 Bacteria 46161
14 Ga0068305_10031381 3300005083 Unclassified 5224
15 Ga0466703_270977 3300042636 Bacteria 5269
16 Ga0466704_151413 3300042643 Bacteria 12514
17 Ga0466709_268114 3300042648 Bacteria 29907
18 Ga0466707_259536 3300042601 Bacteria 2023
19 Ga0466713_017301 3300042602 Bacteria 11158
20 Ga0466716_093597 3300042605 Bacteria 3941
21 Ga0466716_157008 3300042605 Bacteria 1833
22 Ga0466705_022934 3300042612 Bacteria 6801
23 Ga0123355_10415997 3300009826 Bacteria 1722
24 Ga0466715_156533 3300042616 Bacteria 9385
25 Ga0466718_034807 3300042617 Bacteria 3794
26 Ga0466723_200749 3300042618 Bacteria 72306
27 Ga0466726_160164 3300042619 Bacteria 1964
28 Ga0466729_012776 3300042621 Bacteria 4274
29 Ga0456237_0003335 3300041968 Bacteria 2606
30 Ga0466690_215198 3300042590 Bacteria 2267
31 Ga0466695_217089 3300042595 Bacteria 2435
32 Ga0466696_110214 3300042596 Bacteria 5353
33 Ga0466699_345901 3300042597 Bacteria 6095
34 JGI24698J34947_10000599 3300002449 Bacteria 17242
35 JGI24698J34947_10009139 3300002449 Bacteria 5437
36 Ga0466729_235441 3300042621 Bacteria 2408
37 Ga0466703_100612 3300042636 Bacteria 66039
38 Ga0466709_077961 3300042648 Bacteria 2321
39 Ga0466727_010715 3300042655 Bacteria 1822
40 Ga0466706_091635 3300042599 Bacteria 2697
41 Ga0466713_041035 3300042602 Bacteria 22462
42 Ga0466719_050778 3300042606 Bacteria 24110
43 Ga0466720_218407 3300042607 Bacteria 1616
44 Ga0466722_234349 3300042609 Bacteria 6590
45 Ga0123356_10000063 3300010049 Bacteria 111723
46 Ga0466712_111653 3300042614 Unclassified 2465
47 Ga0466711_196122 3300042615 Bacteria 16619
48 Ga0466711_484865 3300042615 Bacteria 4088
49 Ga0466715_016482 3300042616 Bacteria 19232
50 Ga0466715_487341 3300042616 Bacteria 37758
51 Ga0466723_028525 3300042618 Bacteria 8291
52 Ga0466723_167234 3300042618 Unclassified 5133
53 Ga0264413_105092 3300024493 Bacteria 2086
54 Ga0466690_229942 3300042590 Bacteria 13697
55 Ga0466691_207329 3300042593 Bacteria 5395
56 Ga0466694_279878 3300042594 Bacteria 3512
57 Ga0466699_175508 3300042597 Bacteria 18938
58 JGI24695J34938_10000429 3300002450 Bacteria 40528
59 Ga0072941_1000180 3300005201 Bacteria 54954
60 Ga0466735_204709 3300042624 Bacteria 1649
61 Ga0466703_191246 3300042636 Bacteria 6355
62 Ga0466709_387536 3300042648 Bacteria 11594
63 Ga0466708_054951 3300042652 Bacteria 12911
64 Ga0466708_298842 3300042652 Bacteria 10039
65 Ga0466713_047218 3300042602 Bacteria 6203
66 Ga0466717_266080 3300042604 Bacteria 3291
67 Ga0466716_298563 3300042605 Bacteria 1667
68 Ga0466719_503398 3300042606 Bacteria 1898
69 Ga0123356_10000299 3300010049 Bacteria 57073
70 Ga0466712_265968 3300042614 Unclassified 14233
71 Ga0466715_315390 3300042616 Bacteria 5290
72 Ga0466718_127016 3300042617 Bacteria 2663
73 Ga0466726_257251 3300042619 Bacteria 17671
74 Ga0466729_196442 3300042621 Bacteria 4923
75 Ga0466690_131691 3300042590 Bacteria 32508
76 Ga0466695_121101 3300042595 Bacteria 6620
77 Ga0466696_256809 3300042596 Bacteria 1567
78 Ga0068305_10040429 3300005083 Bacteria 22658
79 Ga0072941_1002416 3300005201 Unclassified 6298
80 Ga0123357_10002380 3300009784 Bacteria 20942
81 Ga0466735_005070 3300042624 Bacteria 2049
82 Ga0466708_048008 3300042652 Bacteria 9513
83 Ga0466708_186978 3300042652 Bacteria 16520
84 Ga0466706_287397 3300042599 Bacteria 2685
85 Ga0466716_194855 3300042605 Bacteria 9681
86 Ga0466705_050869 3300042612 Bacteria 37849
87 Ga0123356_10131055 3300010049 Bacteria 2457
88 Ga0123353_10228450 3300010167 Bacteria 2904
89 Ga0123353_10541553 3300010167 Bacteria 1682
90 Ga0466723_167395 3300042618 Bacteria 3870
91 Ga0264413_108850 3300024493 Bacteria 5307
92 Ga0466692_152387 3300042591 Bacteria 29225
93 Ga0466693_328961 3300042592 Bacteria 11085
94 Ga0466691_138447 3300042593 Bacteria 5698
95 Ga0466694_156129 3300042594 Bacteria 74614
96 Ga0466694_158877 3300042594 Bacteria 17130
97 Ga0466696_110638 3300042596 Bacteria 39746
98 Ga0466696_113081 3300042596 Bacteria 3462
99 Ga0466696_328932 3300042596 Bacteria 6273
100 Ga0466699_341963 3300042597 Unclassified 1364
101 Ga0466699_393350 3300042597 Bacteria 5651
102 JGI24695J34938_10007080 3300002450 Bacteria 6633
103 Ga0466709_106710 3300042648 Bacteria 6239
104 Ga0466708_023289 3300042652 Bacteria 34585
105 Ga0466708_065397 3300042652 Bacteria 17220
106 Ga0466708_088485 3300042652 Bacteria 6997
107 Ga0466708_196954 3300042652 Unclassified 1609
108 Ga0466708_268643 3300042652 Bacteria 13669
109 Ga0466708_402467 3300042652 Bacteria 7049
110 Ga0466700_092661 3300042600 Bacteria 2959
111 Ga0466705_134115 3300042612 Bacteria 13835
112 Ga0123357_10190733 3300009784 Bacteria 2362
113 Ga0123355_10012757 3300009826 Bacteria 13031
114 Ga0466715_090509 3300042616 Bacteria 2175
115 Ga0466726_332717 3300042619 Bacteria 8555
116 Ga0466694_066336 3300042594 Bacteria 9198
117 Ga0466729_200625 3300042621 Bacteria 1726
118 Ga0466703_357216 3300042636 Bacteria 7322
119 Ga0466704_415790 3300042643 Bacteria 9920
120 Ga0466719_535255 3300042606 Bacteria 28946
121 Ga0123356_10003502 3300010049 Bacteria 16427
122 Ga0466715_201539 3300042616 Bacteria 4080
123 Ga0466715_373815 3300042616 Bacteria 7242
124 Ga0466723_111695 3300042618 Bacteria 17779
125 Ga0466723_178668 3300042618 Bacteria 30352
126 Ga0466723_225377 3300042618 Bacteria 3660
127 Ga0466726_089562 3300042619 Bacteria 2336
128 Ga0466726_103471 3300042619 Bacteria 1888
129 Ga0466726_198371 3300042619 Bacteria 1870
130 Ga0466726_371729 3300042619 Bacteria 5444
131 Ga0466691_092215 3300042593 Bacteria 4860
132 Ga0466691_145543 3300042593 Bacteria 12166
133 Ga0072941_1004758 3300005201 Bacteria 15451
134 Ga0466735_057159 3300042624 Bacteria 4426
135 Ga0466708_086441 3300042652 Bacteria 5223
136 Ga0466716_316599 3300042605 Bacteria 6560
137 Ga0466719_516124 3300042606 Bacteria 2135
138 Ga0123356_10008920 3300010049 Bacteria 9927
139 Ga0466711_099713 3300042615 Bacteria 7714
140 Ga0466718_156290 3300042617 Bacteria 3055
141 Ga0466692_016827 3300042591 Bacteria 9713
142 Ga0466692_105569 3300042591 Bacteria 2034
143 Ga0466691_032182 3300042593 Bacteria 10851
144 Ga0466691_056863 3300042593 Bacteria 29448
145 Ga0466704_024494 3300042643 Bacteria 5660
146 Ga0466708_183502 3300042652 Bacteria 5984
147 Ga0466716_257433 3300042605 Bacteria 7922
148 Ga0466719_037614 3300042606 Bacteria 10591
149 Ga0466720_106412 3300042607 Bacteria 2736

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042636 Ga0466703_100612 Ga0466703_100612_39745_40854 369
2 3300042597 Ga0466699_341963 Ga0466699_341963_60_1181 373
3 3300024493 Ga0264413_105092 Ga0264413_1050921 375
4 3300042591 Ga0466692_016827 Ga0466692_016827_4412_5590 392
5 3300042590 Ga0466690_335423 Ga0466690_335423_2321_3565 396
6 3300042599 Ga0466706_287397 Ga0466706_287397_14_1210 398
7 3300042652 Ga0466708_054951 Ga0466708_054951_11232_12434 400
8 3300042624 Ga0466735_005070 Ga0466735_005070_723_1931 402
9 3300042618 Ga0466723_234195 Ga0466723_234195_1927_3237 406
10 3300042648 Ga0466709_077961 Ga0466709_077961_248_1480 410
11 3300042648 Ga0466709_106710 Ga0466709_106710_921_2372 413
12 3300042596 Ga0466696_110638 Ga0466696_110638_14162_15412 416
13 3300042606 Ga0466719_516124 Ga0466719_516124_47_1501 416
14 3300005201 Ga0072941_1002416 Ga0072941_10024161 419
15 3300042594 Ga0466694_158877 Ga0466694_158877_5170_6540 420
16 3300005201 Ga0072941_1000180 Ga0072941_100018034 423
17 3300005201 Ga0072941_1004758 Ga0072941_10047585 423
18 3300042602 Ga0466713_017301 Ga0466713_017301_8077_9447 429
19 3300042596 Ga0466696_110214 Ga0466696_110214_2234_3538 434
20 3300042616 Ga0466715_201539 Ga0466715_201539_1737_3047 436
21 3300042616 Ga0466715_373815 Ga0466715_373815_5669_7075 436
22 3300010049 Ga0123356_10131055 Ga0123356_101310552 438
23 3300042605 Ga0466716_194855 Ga0466716_194855_5647_6981 438
24 3300042652 Ga0466708_023289 Ga0466708_023289_28842_30176 438
25 3300010049 Ga0123356_10000299 Ga0123356_1000029959 439
26 3300042593 Ga0466691_092215 Ga0466691_092215_442_1830 439
27 3300042599 Ga0466706_091635 Ga0466706_091635_1236_2570 439
28 3300042615 Ga0466711_196122 Ga0466711_196122_13788_15206 439
29 3300042593 Ga0466691_207329 Ga0466691_207329_1724_3133 440
30 3300042619 Ga0466726_089562 Ga0466726_089562_553_1875 440
31 3300042616 Ga0466715_016482 Ga0466715_016482_11176_12609 442
32 3300042617 Ga0466718_034807 Ga0466718_034807_456_1805 442
33 3300042619 Ga0466726_257251 Ga0466726_257251_429_1757 442
34 3300042616 Ga0466715_156533 Ga0466715_156533_676_2022 443
35 3300042606 Ga0466719_037614 Ga0466719_037614_5516_6913 445
36 3300042619 Ga0466726_160164 Ga0466726_160164_47_1387 446
37 iso_pr_bacteria 2781125697 2781442273 446
38 3300038395 Ga0415639_011990 Ga0415639_011990_2569_3930 447
39 3300042618 Ga0466723_167234 Ga0466723_167234_2732_4117 447
40 3300042591 Ga0466692_105569 Ga0466692_105569_311_1657 448
41 3300042612 Ga0466705_050869 Ga0466705_050869_17113_18558 448
42 3300042652 Ga0466708_196954 Ga0466708_196954_52_1449 449
43 3300042617 Ga0466718_156290 Ga0466718_156290_1332_2684 450
44 3300042619 Ga0466726_103471 Ga0466726_103471_472_1824 450
45 3300042624 Ga0466735_057159 Ga0466735_057159_1721_3154 450
46 3300042618 Ga0466723_167395 Ga0466723_167395_524_1915 451
47 3300042648 Ga0466709_268114 Ga0466709_268114_22980_24350 451
48 3300042618 Ga0466723_111695 Ga0466723_111695_9841_11220 452
49 3300000089 AustNasuHG_c1002424 AustNasuHG_10024245 453
50 3300042596 Ga0466696_256809 Ga0466696_256809_83_1546 453
51 3300042605 Ga0466716_257433 Ga0466716_257433_5418_6797 453
52 3300042614 Ga0466712_265968 Ga0466712_265968_12704_14110 453
53 iso_pr_bacteria 2781125665 2781341351 453
54 3300005083 Ga0068305_10040429 Ga0068305_1004042914 455
55 3300010167 Ga0123353_10228450 Ga0123353_102284502 455
56 3300041968 Ga0456237_0003335 Ga0456237_0003335_108_1475 455
57 3300042601 Ga0466707_259536 Ga0466707_259536_128_1495 455
58 3300042606 Ga0466719_503398 Ga0466719_503398_430_1827 455
59 3300042648 Ga0466709_387536 Ga0466709_387536_7912_9312 455
60 3300042652 Ga0466708_048008 Ga0466708_048008_1003_2370 455
61 3300042652 Ga0466708_298842 Ga0466708_298842_1363_2793 455
62 3300005083 Ga0068305_10031381 Ga0068305_100313817 456
63 3300042624 Ga0466735_204709 Ga0466735_204709_58_1431 457
64 3300042605 Ga0466716_093597 Ga0466716_093597_1152_2546 458
65 iso_pr_bacteria 2781125656 2781321940 458
66 iso_pr_bacteria 650716099 650877790 458
67 3300042590 Ga0466690_229942 Ga0466690_229942_12293_13672 459
68 3300042605 Ga0466716_298563 Ga0466716_298563_221_1600 459
69 3300042617 Ga0466718_127016 Ga0466718_127016_1175_2554 459
70 3300042636 Ga0466703_191246 Ga0466703_191246_1021_2400 459
71 iso_pr_bacteria 2781125632 2781269378 459
72 3300042594 Ga0466694_279878 Ga0466694_279878_1108_2490 460
73 3300042596 Ga0466696_328932 Ga0466696_328932_4430_5812 460
74 3300042602 Ga0466713_047218 Ga0466713_047218_4743_6188 460
75 3300042618 Ga0466723_225377 Ga0466723_225377_668_2140 460
76 3300042636 Ga0466703_270977 Ga0466703_270977_2931_4313 460
77 3300042643 Ga0466704_024494 Ga0466704_024494_376_1758 460
78 iso_pr_bacteria 2781125691 2781429408 460
79 3300042593 Ga0466691_032182 Ga0466691_032182_4431_5816 461
80 3300042597 Ga0466699_175508 Ga0466699_175508_477_1862 461
81 3300042597 Ga0466699_345901 Ga0466699_345901_4584_5969 461
82 3300042597 Ga0466699_393350 Ga0466699_393350_4189_5574 461
83 3300042607 Ga0466720_218407 Ga0466720_218407_198_1583 461
84 3300002450 JGI24695J34938_10000429 JGI24695J34938_1000042910 462
85 3300042592 Ga0466693_328961 Ga0466693_328961_7551_8939 462
86 3300042597 Ga0466699_007354 Ga0466699_007354_3163_4602 462
87 3300042618 Ga0466723_200749 Ga0466723_200749_20348_21754 462
88 3300042618 Ga0466723_178668 Ga0466723_178668_11886_13277 463
89 3300042652 Ga0466708_183502 Ga0466708_183502_2332_3723 463
90 3300010049 Ga0123356_10000063 Ga0123356_100000637 464
91 3300042619 Ga0466726_332717 Ga0466726_332717_792_2204 464
92 3300042621 Ga0466729_235441 Ga0466729_235441_652_2046 464
93 3300042652 Ga0466708_065397 Ga0466708_065397_1782_3176 464
94 3300042590 Ga0466690_215198 Ga0466690_215198_253_1650 465
95 3300042616 Ga0466715_090509 Ga0466715_090509_338_1735 465
96 3300042652 Ga0466708_088485 Ga0466708_088485_4985_6382 465
97 3300042652 Ga0466708_268643 Ga0466708_268643_6715_8112 465
98 3300042652 Ga0466708_402467 Ga0466708_402467_1044_2441 465
99 3300042594 Ga0466694_156129 Ga0466694_156129_14168_15589 466
100 3300042606 Ga0466719_535255 Ga0466719_535255_8235_9692 466
101 3300042612 Ga0466705_134115 Ga0466705_134115_4594_6036 466
102 3300042652 Ga0466708_186978 Ga0466708_186978_10258_11658 466
103 3300042612 Ga0466705_022934 Ga0466705_022934_5080_6483 467
104 3300042615 Ga0466711_410308 Ga0466711_410308_5329_6732 467
105 3300042616 Ga0466715_315390 Ga0466715_315390_1392_2795 467
106 3300042619 Ga0466726_198371 Ga0466726_198371_51_1454 467
107 3300002449 JGI24698J34947_10000599 JGI24698J34947_100005995 468
108 3300002449 JGI24698J34947_10003600 JGI24698J34947_100036007 468
109 3300002449 JGI24698J34947_10006626 JGI24698J34947_100066264 468
110 3300042593 Ga0466691_056863 Ga0466691_056863_14097_15503 468
111 3300042595 Ga0466695_121101 Ga0466695_121101_3165_4571 468
112 3300042614 Ga0466712_111653 Ga0466712_111653_43_1449 468
113 3300042619 Ga0466726_371729 Ga0466726_371729_373_1842 468
114 3300042620 Ga0466728_064424 Ga0466728_064424_1514_2920 468
115 3300042636 Ga0466703_357216 Ga0466703_357216_312_1751 468
116 3300042652 Ga0466708_086441 Ga0466708_086441_2097_3527 468
117 3300002449 JGI24698J34947_10009139 JGI24698J34947_100091394 469
118 3300042590 Ga0466690_125906 Ga0466690_125906_696_2105 469
119 3300042593 Ga0466691_145543 Ga0466691_145543_3166_4575 469
120 3300042618 Ga0466723_028525 Ga0466723_028525_3985_5394 469
121 3300042621 Ga0466729_012776 Ga0466729_012776_529_1938 469
122 3300042643 Ga0466704_415790 Ga0466704_415790_3562_4971 469
123 3300042616 Ga0466715_487341 Ga0466715_487341_31596_33008 470
124 3300010167 Ga0123353_10424580 Ga0123353_104245801 471
125 3300042595 Ga0466695_217089 Ga0466695_217089_135_1550 471
126 3300042621 Ga0466729_196442 Ga0466729_196442_1589_3004 471
127 3300042590 Ga0466690_131691 Ga0466690_131691_14477_15895 472
128 3300042602 Ga0466713_041035 Ga0466713_041035_20807_22225 472
129 3300042655 Ga0466727_010715 Ga0466727_010715_244_1662 472
130 3300002450 JGI24695J34938_10000339 JGI24695J34938_1000033944 474
131 iso_pr_bacteria 2781125635 2781278914 474
132 iso_pr_bacteria 2781125645 2781300044 474
133 3300002450 JGI24695J34938_10007080 JGI24695J34938_100070806 475
134 3300010167 Ga0123353_10541553 Ga0123353_105415531 475
135 3300042605 Ga0466716_316599 Ga0466716_316599_4773_6200 475
136 3300009784 Ga0123357_10190733 Ga0123357_101907331 476
137 3300042596 Ga0466696_113081 Ga0466696_113081_924_2387 476
138 3300042604 Ga0466717_266080 Ga0466717_266080_535_1965 476
139 3300042615 Ga0466711_484865 Ga0466711_484865_1630_3060 476
140 iso_pr_bacteria 2781125660 2781330320 476
141 iso_pr_bacteria 2781125690 2781428377 476
142 3300010049 Ga0123356_10008920 Ga0123356_1000892010 477
143 iso_pr_bacteria 2781125655 2781318920 477
144 3300009826 Ga0123355_10012757 Ga0123355_100127577 478
145 3300009826 Ga0123355_10415997 Ga0123355_104159971 478
146 3300042591 Ga0466692_152387 Ga0466692_152387_13273_14760 478
147 3300042593 Ga0466691_138447 Ga0466691_138447_2076_3512 478
148 iso_pr_bacteria 2781125663 2781337975 478
149 iso_pr_bacteria 2781125666 2781345183 478
150 3300009784 Ga0123357_10002380 Ga0123357_1000238014 479
151 3300010049 Ga0123356_10003502 Ga0123356_100035028 479
152 3300042643 Ga0466704_151413 Ga0466704_151413_4957_6396 479
153 3300042606 Ga0466719_050778 Ga0466719_050778_8734_10224 482
154 3300042621 Ga0466729_200625 Ga0466729_200625_169_1623 484
155 3300042594 Ga0466694_066336 Ga0466694_066336_2017_3492 485
156 3300042600 Ga0466700_092661 Ga0466700_092661_31_1488 485
157 3300042615 Ga0466711_099713 Ga0466711_099713_5782_7245 487
158 3300042607 Ga0466720_106412 Ga0466720_106412_317_1822 501
159 3300002449 JGI24698J34947_10000228 JGI24698J34947_100002282 513
160 3300042605 Ga0466716_157008 Ga0466716_157008_26_1588 520
161 3300024493 Ga0264413_108850 Ga0264413_1088508 530
162 3300042609 Ga0466722_234349 Ga0466722_234349_1581_3245 531

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF18073 Rubredoxin_2 Rubredoxin metal binding domain 53 80 0.97
PF13541 ChlI Subunit ChlI of Mg-chelatase 383 475 0.93
PF06745 ATPase KaiC 116 189 0.9
PF13481 AAA_25 AAA domain 114 264 0.82
PF03796 DnaB_C DnaB-like helicase C terminal domain 116 218 0.76

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.74 0.84 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.