Protein Family IF00463
Metagenome
Metatranscriptome
Isolate
145
Members
48
Samples
142
Scaffolds
94.48
Avg Length
Representative Sequence
- ID
- 3300001880|FAAS_10752774|FAAS_107527742
- Length
- 110 aa
- Sequence
- MTIDRVGPIEPIQPGKRPGKIGQVNESPNSDSISIXSEAQAKAELLRTQELAASAPDVRVERVAELKEKINDPAYLDERVINATANKLIDTLFGRGLKGDEVRPSGLIT*
Sample Types
Isolate
2.1%
Metagenome
95.9%
MAG
0.0%
Metatranscriptome
2.1%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
50.0%
Kalotermitidae
28.6%
Unclassified
9.5%
Rhinotermitidae
4.8%
Termopsidae
4.8%
Hodotermitidae
2.4%
Taxonomy
Archaea
1
Bacteria
136
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 2 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 3 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 4 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 5 | 3300021235 | Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA | Metatranscriptome | |
| 6 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 7 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 8 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 9 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 10 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 11 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 12 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 13 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 14 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 15 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 16 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 17 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 18 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 19 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 20 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 21 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 22 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 23 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 24 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 25 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 26 | 3300021239 | Termite gut microbial communities from nest from French Guiana - FG16_17_4 mRNA SA | Metatranscriptome | |
| 27 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 28 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 29 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 30 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 31 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 32 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 33 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 34 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 35 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 36 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 37 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 38 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 39 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 40 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 41 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 42 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 43 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 44 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 45 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 46 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 47 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 48 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_156401 | 3300042612 | Bacteria | 5552 |
| 2 | Ga0466705_191898 | 3300042612 | Bacteria | 13713 |
| 3 | Ga0223674_1014956 | 3300021235 | Bacteria | 674 |
| 4 | Ga0223677_1032876 | 3300021239 | Bacteria | 641 |
| 5 | Ga0466691_175959 | 3300042593 | Bacteria | 1115 |
| 6 | Ga0466694_054705 | 3300042594 | Bacteria | 2476 |
| 7 | Ga0466694_338256 | 3300042594 | Bacteria | 1264 |
| 8 | Ga0466694_409185 | 3300042594 | Bacteria | 3856 |
| 9 | Ga0466699_129934 | 3300042597 | Bacteria | 3966 |
| 10 | Ga0123353_12845576 | 3300010167 | Bacteria | 565 |
| 11 | Ga0466718_088135 | 3300042617 | Bacteria | 1755 |
| 12 | Ga0466723_318631 | 3300042618 | Bacteria | 5343 |
| 13 | Ga0466728_480781 | 3300042620 | Bacteria | 1220 |
| 14 | Ga0466719_095789 | 3300042606 | Bacteria | 2335 |
| 15 | Ga0466703_224971 | 3300042636 | Bacteria | 1239 |
| 16 | Ga0466704_091843 | 3300042643 | Bacteria | 7660 |
| 17 | Ga0466708_062334 | 3300042652 | Bacteria | 3471 |
| 18 | FAAS_10752774 | 3300001880 | Bacteria | 574 |
| 19 | Ga0264413_117112 | 3300024493 | Bacteria | 9748 |
| 20 | Ga0466691_214983 | 3300042593 | Bacteria | 12008 |
| 21 | Ga0466694_040298 | 3300042594 | Bacteria | 14270 |
| 22 | Ga0466694_306182 | 3300042594 | Bacteria | 2978 |
| 23 | Ga0466699_001046 | 3300042597 | Bacteria | 6902 |
| 24 | Ga0123356_10496339 | 3300010049 | Bacteria | 1376 |
| 25 | Ga0123356_11150159 | 3300010049 | Bacteria | 943 |
| 26 | Ga0123353_10049375 | 3300010167 | Bacteria | 6702 |
| 27 | Ga0466718_160162 | 3300042617 | Bacteria | 4322 |
| 28 | Ga0466728_007949 | 3300042620 | Bacteria | 3303 |
| 29 | Ga0466707_103022 | 3300042601 | Bacteria | 1433 |
| 30 | Ga0466709_164978 | 3300042648 | Bacteria | 16343 |
| 31 | Ga0466708_157107 | 3300042652 | Bacteria | 3996 |
| 32 | JGI24702J35022_10039633 | 3300002462 | Bacteria | 2513 |
| 33 | JGI24696J40584_12873518 | 3300002834 | Bacteria | 1055 |
| 34 | Ga0466732_269773 | 3300042656 | Bacteria | 2335 |
| 35 | Ga0466692_027733 | 3300042591 | Bacteria | 5945 |
| 36 | Ga0466691_057326 | 3300042593 | Bacteria | 4006 |
| 37 | Ga0466695_261664 | 3300042595 | Bacteria | 4412 |
| 38 | Ga0466699_399799 | 3300042597 | Bacteria | 6929 |
| 39 | Ga0466715_084688 | 3300042616 | Bacteria | 4250 |
| 40 | Ga0466715_429864 | 3300042616 | Bacteria | 2141 |
| 41 | Ga0466718_058358 | 3300042617 | Bacteria | 3466 |
| 42 | Ga0466728_128392 | 3300042620 | Bacteria | 7773 |
| 43 | Ga0466707_228432 | 3300042601 | Bacteria | 2194 |
| 44 | Ga0466719_423876 | 3300042606 | Bacteria | 8084 |
| 45 | Ga0466731_080513 | 3300042622 | Bacteria | 1013 |
| 46 | Ga0466730_089406 | 3300042625 | Bacteria | 1637 |
| 47 | Ga0466703_218726 | 3300042636 | Bacteria | 2167 |
| 48 | Ga0466704_138518 | 3300042643 | Bacteria | 1861 |
| 49 | Ga0466704_216927 | 3300042643 | Bacteria | 9594 |
| 50 | JGI24695J34938_10190223 | 3300002450 | Bacteria | 852 |
| 51 | JGI24702J35022_10012603 | 3300002462 | Bacteria | 4694 |
| 52 | JGI24696J40584_12691766 | 3300002834 | Bacteria | 729 |
| 53 | Ga0466705_038113 | 3300042612 | Bacteria | 3302 |
| 54 | Ga0466705_179514 | 3300042612 | Bacteria | 6721 |
| 55 | Ga0466732_359926 | 3300042656 | Bacteria | 1506 |
| 56 | Ga0264413_107980 | 3300024493 | Bacteria | 2698 |
| 57 | Ga0466694_068107 | 3300042594 | Bacteria | 1229 |
| 58 | Ga0466699_003624 | 3300042597 | Bacteria | 19542 |
| 59 | Ga0466699_018631 | 3300042597 | Bacteria | 2862 |
| 60 | Ga0123353_10129411 | 3300010167 | Bacteria | 4053 |
| 61 | Ga0466712_291170 | 3300042614 | Bacteria | 1734 |
| 62 | Ga0466711_208392 | 3300042615 | Bacteria | 8698 |
| 63 | Ga0466715_021318 | 3300042616 | Bacteria | 41129 |
| 64 | Ga0466723_369640 | 3300042618 | Bacteria | 2974 |
| 65 | Ga0466707_071981 | 3300042601 | Bacteria | 1235 |
| 66 | Ga0466698_127505 | 3300042610 | Bacteria | 18075 |
| 67 | Ga0466704_092751 | 3300042643 | Bacteria | 1515 |
| 68 | Ga0466708_025900 | 3300042652 | Bacteria | 14574 |
| 69 | JGI24702J35022_10012754 | 3300002462 | Bacteria | 4664 |
| 70 | JGI24702J35022_10178905 | 3300002462 | Bacteria | 1204 |
| 71 | Ga0466705_106377 | 3300042612 | Bacteria | 3406 |
| 72 | Ga0223674_1002735 | 3300021235 | Bacteria | 648 |
| 73 | Ga0466693_381167 | 3300042592 | Bacteria | 1596 |
| 74 | Ga0123357_10109099 | 3300009784 | Bacteria | 3537 |
| 75 | Ga0123356_12279429 | 3300010049 | Bacteria | 677 |
| 76 | Ga0123354_10410429 | 3300010882 | Bacteria | 1136 |
| 77 | Ga0466711_452266 | 3300042615 | Bacteria | 1114 |
| 78 | Ga0466715_012544 | 3300042616 | Bacteria | 5678 |
| 79 | Ga0466715_323110 | 3300042616 | Bacteria | 5328 |
| 80 | Ga0466715_327274 | 3300042616 | Bacteria | 11914 |
| 81 | Ga0466718_098039 | 3300042617 | Bacteria | 3885 |
| 82 | Ga0466726_338994 | 3300042619 | Bacteria | 2685 |
| 83 | Ga0466722_044984 | 3300042609 | Bacteria | 1148 |
| 84 | Ga0466722_057028 | 3300042609 | Bacteria | 4739 |
| 85 | Ga0466722_088590 | 3300042609 | Bacteria | 1783 |
| 86 | Ga0466708_101561 | 3300042652 | Bacteria | 2673 |
| 87 | JGI24698J34947_10000369 | 3300002449 | Bacteria | 20214 |
| 88 | JGI24695J34938_10529869 | 3300002450 | Bacteria | 542 |
| 89 | JGI24702J35022_10714200 | 3300002462 | Bacteria | 623 |
| 90 | Ga0466705_046297 | 3300042612 | Bacteria | 5005 |
| 91 | Ga0466705_165327 | 3300042612 | Unclassified | 1534 |
| 92 | Ga0466694_007746 | 3300042594 | Unclassified | 1616 |
| 93 | Ga0466694_240902 | 3300042594 | Unclassified | 9935 |
| 94 | Ga0466694_407229 | 3300042594 | Bacteria | 4022 |
| 95 | Ga0123356_13035944 | 3300010049 | Bacteria | 586 |
| 96 | Ga0123356_13174852 | 3300010049 | Bacteria | 572 |
| 97 | Ga0123353_12014263 | 3300010167 | Bacteria | 707 |
| 98 | Ga0466726_301871 | 3300042619 | Bacteria | 1643 |
| 99 | Ga0466720_059390 | 3300042607 | Bacteria | 1619 |
| 100 | Ga0466703_065052 | 3300042636 | Bacteria | 3693 |
| 101 | Ga0466703_150190 | 3300042636 | Bacteria | 10197 |
| 102 | Ga0466709_352032 | 3300042648 | Bacteria | 3645 |
| 103 | Ga0466708_428641 | 3300042652 | Bacteria | 19004 |
| 104 | Ga0072941_1145932 | 3300005201 | Bacteria | 958 |
| 105 | Ga0265387_1018150 | 3300024582 | Bacteria | 1027 |
| 106 | Ga0466690_039915 | 3300042590 | Bacteria | 4150 |
| 107 | Ga0123353_12795352 | 3300010167 | Bacteria | 572 |
| 108 | Ga0466711_062641 | 3300042615 | Unclassified | 6806 |
| 109 | Ga0466718_064941 | 3300042617 | Bacteria | 2663 |
| 110 | Ga0466718_081394 | 3300042617 | Bacteria | 1435 |
| 111 | Ga0466723_327984 | 3300042618 | Bacteria | 1011 |
| 112 | Ga0466728_101683 | 3300042620 | Bacteria | 5354 |
| 113 | Ga0466728_204455 | 3300042620 | Bacteria | 7304 |
| 114 | Ga0466706_145276 | 3300042599 | Bacteria | 1357 |
| 115 | Ga0466707_269954 | 3300042601 | Bacteria | 1075 |
| 116 | Ga0466720_093673 | 3300042607 | Unclassified | 4055 |
| 117 | Ga0466698_513047 | 3300042610 | Bacteria | 1261 |
| 118 | Ga0466731_284050 | 3300042622 | Bacteria | 1814 |
| 119 | Ga0466731_404983 | 3300042622 | Bacteria | 1335 |
| 120 | Ga0466703_084579 | 3300042636 | Bacteria | 11762 |
| 121 | Ga0466709_033045 | 3300042648 | Bacteria | 2149 |
| 122 | Ga0466727_322809 | 3300042655 | Bacteria | 1092 |
| 123 | JGI24702J35022_10008821 | 3300002462 | Bacteria | 5690 |
| 124 | JGI24705J35276_11930496 | 3300002504 | Bacteria | 776 |
| 125 | Ga0466690_123381 | 3300042590 | Unclassified | 2649 |
| 126 | Ga0466690_280905 | 3300042590 | Bacteria | 2431 |
| 127 | Ga0466694_194182 | 3300042594 | Bacteria | 1037 |
| 128 | Ga0466694_290074 | 3300042594 | Bacteria | 3138 |
| 129 | Ga0466699_406795 | 3300042597 | Bacteria | 2679 |
| 130 | Ga0466718_059128 | 3300042617 | Bacteria | 5354 |
| 131 | Ga0466718_081111 | 3300042617 | Bacteria | 12231 |
| 132 | Ga0466728_151146 | 3300042620 | Bacteria | 4880 |
| 133 | Ga0466728_407461 | 3300042620 | Bacteria | 4552 |
| 134 | Ga0466728_443458 | 3300042620 | Archaea | 1915 |
| 135 | Ga0466719_507950 | 3300042606 | Bacteria | 2590 |
| 136 | Ga0466720_026916 | 3300042607 | Unclassified | 1512 |
| 137 | Ga0466731_088202 | 3300042622 | Unclassified | 1446 |
| 138 | Ga0466702_155551 | 3300042635 | Bacteria | 24097 |
| 139 | Ga0466703_171175 | 3300042636 | Bacteria | 4974 |
| 140 | Ga0466708_299407 | 3300042652 | Bacteria | 5117 |
| 141 | Ga0466727_123829 | 3300042655 | Bacteria | 2146 |
| 142 | JGI24698J34947_10101762 | 3300002449 | Bacteria | 1290 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042607 | Ga0466720_093673 | Ga0466720_093673_3783_4040 | 85 |
| 2 | 3300042612 | Ga0466705_046297 | Ga0466705_046297_1432_1710 | 92 |
| 3 | 3300042601 | Ga0466707_103022 | Ga0466707_103022_1028_1309 | 93 |
| 4 | 3300042616 | Ga0466715_429864 | Ga0466715_429864_161_442 | 93 |
| 5 | 3300042618 | Ga0466723_327984 | Ga0466723_327984_171_452 | 93 |
| 6 | 3300042620 | Ga0466728_407461 | Ga0466728_407461_2677_2958 | 93 |
| 7 | 3300042622 | Ga0466731_404983 | Ga0466731_404983_457_738 | 93 |
| 8 | 3300042636 | Ga0466703_150190 | Ga0466703_150190_6975_7256 | 93 |
| 9 | 3300042636 | Ga0466703_224971 | Ga0466703_224971_256_537 | 93 |
| 10 | 3300042643 | Ga0466704_091843 | Ga0466704_091843_3193_3474 | 93 |
| 11 | 3300042652 | Ga0466708_428641 | Ga0466708_428641_3157_3438 | 93 |
| 12 | 3300021235 | Ga0223674_1002735 | Ga0223674_10027352 | 94 |
| 13 | 3300021235 | Ga0223674_1014956 | Ga0223674_10149561 | 94 |
| 14 | 3300021239 | Ga0223677_1032876 | Ga0223677_10328761 | 94 |
| 15 | 3300024493 | Ga0264413_107980 | Ga0264413_1079802 | 94 |
| 16 | 3300024493 | Ga0264413_117112 | Ga0264413_1171128 | 94 |
| 17 | 3300024582 | Ga0265387_1018150 | Ga0265387_10181502 | 94 |
| 18 | 3300042590 | Ga0466690_123381 | Ga0466690_123381_1722_2006 | 94 |
| 19 | 3300042590 | Ga0466690_280905 | Ga0466690_280905_2002_2286 | 94 |
| 20 | 3300042591 | Ga0466692_027733 | Ga0466692_027733_41_325 | 94 |
| 21 | 3300042592 | Ga0466693_381167 | Ga0466693_381167_869_1153 | 94 |
| 22 | 3300042593 | Ga0466691_057326 | Ga0466691_057326_1797_2081 | 94 |
| 23 | 3300042593 | Ga0466691_175959 | Ga0466691_175959_189_473 | 94 |
| 24 | 3300042593 | Ga0466691_214983 | Ga0466691_214983_10126_10410 | 94 |
| 25 | 3300042594 | Ga0466694_040298 | Ga0466694_040298_4564_4848 | 94 |
| 26 | 3300042594 | Ga0466694_054705 | Ga0466694_054705_890_1174 | 94 |
| 27 | 3300042594 | Ga0466694_068107 | Ga0466694_068107_846_1130 | 94 |
| 28 | 3300042594 | Ga0466694_194182 | Ga0466694_194182_727_1011 | 94 |
| 29 | 3300042594 | Ga0466694_240902 | Ga0466694_240902_6893_7177 | 94 |
| 30 | 3300042594 | Ga0466694_290074 | Ga0466694_290074_753_1037 | 94 |
| 31 | 3300042594 | Ga0466694_306182 | Ga0466694_306182_2535_2819 | 94 |
| 32 | 3300042594 | Ga0466694_338256 | Ga0466694_338256_481_765 | 94 |
| 33 | 3300042594 | Ga0466694_407229 | Ga0466694_407229_102_386 | 94 |
| 34 | 3300042594 | Ga0466694_409185 | Ga0466694_409185_2336_2620 | 94 |
| 35 | 3300042595 | Ga0466695_261664 | Ga0466695_261664_734_1018 | 94 |
| 36 | 3300042597 | Ga0466699_001046 | Ga0466699_001046_4326_4610 | 94 |
| 37 | 3300042597 | Ga0466699_003624 | Ga0466699_003624_3467_3751 | 94 |
| 38 | 3300042597 | Ga0466699_018631 | Ga0466699_018631_489_773 | 94 |
| 39 | 3300042597 | Ga0466699_129934 | Ga0466699_129934_2413_2697 | 94 |
| 40 | 3300042597 | Ga0466699_399799 | Ga0466699_399799_1885_2169 | 94 |
| 41 | 3300042597 | Ga0466699_406795 | Ga0466699_406795_677_961 | 94 |
| 42 | 3300042599 | Ga0466706_145276 | Ga0466706_145276_733_1017 | 94 |
| 43 | 3300042601 | Ga0466707_228432 | Ga0466707_228432_1898_2182 | 94 |
| 44 | 3300042601 | Ga0466707_269954 | Ga0466707_269954_117_401 | 94 |
| 45 | 3300042606 | Ga0466719_095789 | Ga0466719_095789_1541_1825 | 94 |
| 46 | 3300042606 | Ga0466719_423876 | Ga0466719_423876_6098_6382 | 94 |
| 47 | 3300042609 | Ga0466722_044984 | Ga0466722_044984_774_1058 | 94 |
| 48 | 3300042609 | Ga0466722_057028 | Ga0466722_057028_1616_1900 | 94 |
| 49 | 3300042610 | Ga0466698_127505 | Ga0466698_127505_16278_16562 | 94 |
| 50 | 3300042610 | Ga0466698_513047 | Ga0466698_513047_591_875 | 94 |
| 51 | 3300042612 | Ga0466705_038113 | Ga0466705_038113_1221_1505 | 94 |
| 52 | 3300042612 | Ga0466705_106377 | Ga0466705_106377_1129_1413 | 94 |
| 53 | 3300042612 | Ga0466705_156401 | Ga0466705_156401_571_855 | 94 |
| 54 | 3300042612 | Ga0466705_165327 | Ga0466705_165327_17_301 | 94 |
| 55 | 3300042612 | Ga0466705_179514 | Ga0466705_179514_2641_2925 | 94 |
| 56 | 3300042614 | Ga0466712_291170 | Ga0466712_291170_930_1214 | 94 |
| 57 | 3300042615 | Ga0466711_062641 | Ga0466711_062641_4438_4722 | 94 |
| 58 | 3300042615 | Ga0466711_208392 | Ga0466711_208392_7450_7734 | 94 |
| 59 | 3300042616 | Ga0466715_012544 | Ga0466715_012544_3642_3926 | 94 |
| 60 | 3300042616 | Ga0466715_084688 | Ga0466715_084688_2080_2364 | 94 |
| 61 | 3300042616 | Ga0466715_323110 | Ga0466715_323110_3303_3587 | 94 |
| 62 | 3300042616 | Ga0466715_327274 | Ga0466715_327274_7824_8108 | 94 |
| 63 | 3300042617 | Ga0466718_058358 | Ga0466718_058358_255_539 | 94 |
| 64 | 3300042617 | Ga0466718_059128 | Ga0466718_059128_1445_1729 | 94 |
| 65 | 3300042617 | Ga0466718_081111 | Ga0466718_081111_4091_4375 | 94 |
| 66 | 3300042617 | Ga0466718_081394 | Ga0466718_081394_718_1002 | 94 |
| 67 | 3300042617 | Ga0466718_088135 | Ga0466718_088135_265_549 | 94 |
| 68 | 3300042617 | Ga0466718_098039 | Ga0466718_098039_3140_3424 | 94 |
| 69 | 3300042617 | Ga0466718_160162 | Ga0466718_160162_1230_1514 | 94 |
| 70 | 3300042618 | Ga0466723_318631 | Ga0466723_318631_4574_4858 | 94 |
| 71 | 3300042618 | Ga0466723_369640 | Ga0466723_369640_1943_2227 | 94 |
| 72 | 3300042619 | Ga0466726_301871 | Ga0466726_301871_192_476 | 94 |
| 73 | 3300042619 | Ga0466726_338994 | Ga0466726_338994_1412_1696 | 94 |
| 74 | 3300042620 | Ga0466728_007949 | Ga0466728_007949_295_579 | 94 |
| 75 | 3300042620 | Ga0466728_101683 | Ga0466728_101683_2203_2487 | 94 |
| 76 | 3300042620 | Ga0466728_128392 | Ga0466728_128392_7244_7528 | 94 |
| 77 | 3300042620 | Ga0466728_151146 | Ga0466728_151146_1750_2034 | 94 |
| 78 | 3300042620 | Ga0466728_204455 | Ga0466728_204455_2776_3060 | 94 |
| 79 | 3300042620 | Ga0466728_443458 | Ga0466728_443458_1563_1847 | 94 |
| 80 | 3300042620 | Ga0466728_480781 | Ga0466728_480781_99_383 | 94 |
| 81 | 3300042622 | Ga0466731_080513 | Ga0466731_080513_35_319 | 94 |
| 82 | 3300042622 | Ga0466731_088202 | Ga0466731_088202_732_1016 | 94 |
| 83 | 3300042622 | Ga0466731_284050 | Ga0466731_284050_125_409 | 94 |
| 84 | 3300042625 | Ga0466730_089406 | Ga0466730_089406_620_904 | 94 |
| 85 | 3300042636 | Ga0466703_065052 | Ga0466703_065052_1462_1746 | 94 |
| 86 | 3300042636 | Ga0466703_084579 | Ga0466703_084579_9534_9818 | 94 |
| 87 | 3300042636 | Ga0466703_171175 | Ga0466703_171175_4006_4290 | 94 |
| 88 | 3300042636 | Ga0466703_218726 | Ga0466703_218726_869_1153 | 94 |
| 89 | 3300042643 | Ga0466704_092751 | Ga0466704_092751_96_380 | 94 |
| 90 | 3300042643 | Ga0466704_138518 | Ga0466704_138518_1439_1723 | 94 |
| 91 | 3300042643 | Ga0466704_216927 | Ga0466704_216927_4688_4972 | 94 |
| 92 | 3300042648 | Ga0466709_352032 | Ga0466709_352032_1550_1834 | 94 |
| 93 | 3300042652 | Ga0466708_025900 | Ga0466708_025900_3384_3668 | 94 |
| 94 | 3300042652 | Ga0466708_062334 | Ga0466708_062334_1832_2116 | 94 |
| 95 | 3300042652 | Ga0466708_101561 | Ga0466708_101561_1810_2094 | 94 |
| 96 | 3300042652 | Ga0466708_157107 | Ga0466708_157107_2209_2493 | 94 |
| 97 | 3300042655 | Ga0466727_322809 | Ga0466727_322809_644_928 | 94 |
| 98 | 3300042656 | Ga0466732_269773 | Ga0466732_269773_1436_1720 | 94 |
| 99 | 3300042656 | Ga0466732_359926 | Ga0466732_359926_861_1145 | 94 |
| 100 | iso_pr_bacteria | 2781125652 | 2781312062 | 94 |
| 101 | iso_pr_bacteria | 2781125666 | 2781342914 | 94 |
| 102 | iso_pr_bacteria | 2781125697 | 2781443120 | 94 |
| 103 | 3300002449 | JGI24698J34947_10101762 | JGI24698J34947_101017622 | 95 |
| 104 | 3300002450 | JGI24695J34938_10190223 | JGI24695J34938_101902232 | 95 |
| 105 | 3300002450 | JGI24695J34938_10529869 | JGI24695J34938_105298692 | 95 |
| 106 | 3300002462 | JGI24702J35022_10008821 | JGI24702J35022_100088218 | 95 |
| 107 | 3300002462 | JGI24702J35022_10012603 | JGI24702J35022_100126033 | 95 |
| 108 | 3300002462 | JGI24702J35022_10012754 | JGI24702J35022_100127544 | 95 |
| 109 | 3300002462 | JGI24702J35022_10039633 | JGI24702J35022_100396332 | 95 |
| 110 | 3300002462 | JGI24702J35022_10178905 | JGI24702J35022_101789052 | 95 |
| 111 | 3300002462 | JGI24702J35022_10714200 | JGI24702J35022_107142002 | 95 |
| 112 | 3300002504 | JGI24705J35276_11930496 | JGI24705J35276_119304961 | 95 |
| 113 | 3300002834 | JGI24696J40584_12873518 | JGI24696J40584_128735182 | 95 |
| 114 | 3300005201 | Ga0072941_1145932 | Ga0072941_11459322 | 95 |
| 115 | 3300009784 | Ga0123357_10109099 | Ga0123357_101090992 | 95 |
| 116 | 3300010049 | Ga0123356_10496339 | Ga0123356_104963392 | 95 |
| 117 | 3300010049 | Ga0123356_11150159 | Ga0123356_111501592 | 95 |
| 118 | 3300010049 | Ga0123356_12279429 | Ga0123356_122794292 | 95 |
| 119 | 3300010049 | Ga0123356_13035944 | Ga0123356_130359441 | 95 |
| 120 | 3300010049 | Ga0123356_13174852 | Ga0123356_131748521 | 95 |
| 121 | 3300010167 | Ga0123353_10049375 | Ga0123353_100493755 | 95 |
| 122 | 3300010167 | Ga0123353_10129411 | Ga0123353_101294116 | 95 |
| 123 | 3300010167 | Ga0123353_12014263 | Ga0123353_120142631 | 95 |
| 124 | 3300010167 | Ga0123353_12795352 | Ga0123353_127953521 | 95 |
| 125 | 3300010167 | Ga0123353_12845576 | Ga0123353_128455762 | 95 |
| 126 | 3300010882 | Ga0123354_10410429 | Ga0123354_104104292 | 95 |
| 127 | 3300042609 | Ga0466722_088590 | Ga0466722_088590_1388_1675 | 95 |
| 128 | 3300042635 | Ga0466702_155551 | Ga0466702_155551_11322_11609 | 95 |
| 129 | 3300042590 | Ga0466690_039915 | Ga0466690_039915_734_1024 | 96 |
| 130 | 3300042594 | Ga0466694_007746 | Ga0466694_007746_1289_1579 | 96 |
| 131 | 3300042606 | Ga0466719_507950 | Ga0466719_507950_1216_1506 | 96 |
| 132 | 3300042607 | Ga0466720_026916 | Ga0466720_026916_13_303 | 96 |
| 133 | 3300042607 | Ga0466720_059390 | Ga0466720_059390_292_582 | 96 |
| 134 | 3300042612 | Ga0466705_191898 | Ga0466705_191898_10025_10315 | 96 |
| 135 | 3300042615 | Ga0466711_452266 | Ga0466711_452266_278_568 | 96 |
| 136 | 3300042617 | Ga0466718_064941 | Ga0466718_064941_1676_1966 | 96 |
| 137 | 3300042648 | Ga0466709_033045 | Ga0466709_033045_712_1002 | 96 |
| 138 | 3300042648 | Ga0466709_164978 | Ga0466709_164978_8457_8747 | 96 |
| 139 | 3300042652 | Ga0466708_299407 | Ga0466708_299407_4281_4571 | 96 |
| 140 | 3300042655 | Ga0466727_123829 | Ga0466727_123829_1597_1887 | 96 |
| 141 | 3300002449 | JGI24698J34947_10000369 | JGI24698J34947_100003697 | 97 |
| 142 | 3300002834 | JGI24696J40584_12691766 | JGI24696J40584_126917661 | 97 |
| 143 | 3300042601 | Ga0466707_071981 | Ga0466707_071981_774_1091 | 100 |
| 144 | 3300042616 | Ga0466715_021318 | Ga0466715_021318_37968_38285 | 105 |
| 145 | 3300001880 | FAAS_10752774 | FAAS_107527742 | 110 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF04316 | FlgM | Anti-sigma-28 factor, FlgM | 31 | 90 | 0.81 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.26 | 0.76 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.