Protein Family IF00298

Metagenome Isolate
182 Members
51 Samples
177 Scaffolds
236.12 Avg Length

🧬 Representative Sequence

ID
3300000089|AustNasuHG_c1029995|AustNasuHG_10299952
Length
283 aa
Sequence
LPSLILYAVDAVVEIHCFILSDDNNLVTLAQCLYNNNMLGPIVNAAAILVFSLIGTFLIKGIPDRIEEILKKAVGLSVIYLGIRGTFDNERTLLLVMSMVIGALIGELIDIDKWMNRLGLWAEKKLGMQKDDAPAVHEGTAAKKSKHSFSKAFVSASILFCTGSMAIVGSMQSGLQGNHQTLFAKTILDGSMSLVFGASLGIGAAFSAVPVLLFEGAIALASTLIRDFLSPEIIREMSAVGSLIISAIGFNFLSIKEIKVANLIPAIFIPWVYLSLVGLISG*

📊 Sample Types

Isolate 2.8%
Metagenome 97.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 47.9%
Kalotermitidae 29.2%
Unclassified 14.6%
Rhinotermitidae 4.2%
Termopsidae 4.2%

🌳 Taxonomy

Archaea 0
Bacteria 167
Eukaryota 0
Viruses 0
Unclassified 15

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
2 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
6 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
7 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 2781125691 Treponema sp. Th196P3bin73 Isolate Unclassified
10 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
11 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
12 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
13 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
14 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
15 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
16 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
17 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
18 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
19 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
20 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
21 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
22 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
23 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
24 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
25 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
26 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
27 650716102 Treponema primitia ZAS-2 Isolate Unclassified
28 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
29 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
30 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
31 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
32 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
33 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
34 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
35 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
36 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
37 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
38 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
39 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
40 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
41 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
42 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
43 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
44 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
45 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
46 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
47 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
48 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
49 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
50 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
51 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 JGI24698J34947_10016178 3300002449 Bacteria 4051
2 JGI24698J34947_10034433 3300002449 Bacteria 2650
3 JGI24695J34938_10003494 3300002450 Bacteria 10924
4 Ga0072941_1062130 3300005201 Bacteria 4086
5 Ga0466700_061377 3300042600 Bacteria 2865
6 Ga0466707_301169 3300042601 Bacteria 2581
7 Ga0466719_431752 3300042606 Bacteria 3430
8 Ga0466705_434571 3300042612 Bacteria 3703
9 Ga0466715_236298 3300042616 Bacteria 9493
10 Ga0466718_087149 3300042617 Bacteria 122153
11 Ga0466690_326568 3300042590 Bacteria 10988
12 Ga0466691_048814 3300042593 Bacteria 10711
13 Ga0466699_011587 3300042597 Bacteria 6662
14 Ga0466699_172301 3300042597 Bacteria 1426
15 Ga0466708_035817 3300042652 Bacteria 2751
16 Ga0466705_164564 3300042612 Bacteria 12835
17 AustNasuHG_c1029995 3300000089 Bacteria 1577
18 Ga0068305_10037251 3300005083 Bacteria 9038
19 Ga0072941_1021733 3300005201 Bacteria 5593
20 Ga0466707_126033 3300042601 Bacteria 1160
21 Ga0466707_411877 3300042601 Unclassified 1510
22 Ga0466717_079641 3300042604 Bacteria 1526
23 Ga0466716_067187 3300042605 Bacteria 5258
24 Ga0466719_006586 3300042606 Bacteria 18894
25 Ga0466720_047994 3300042607 Bacteria 5761
26 Ga0123356_10054337 3300010049 Bacteria 3730
27 Ga0123353_11135960 3300010167 Bacteria 1033
28 Ga0466705_494028 3300042612 Unclassified 2679
29 Ga0466712_043197 3300042614 Bacteria 7077
30 Ga0466711_462493 3300042615 Bacteria 5739
31 Ga0466715_012042 3300042616 Bacteria 4403
32 Ga0466715_487027 3300042616 Bacteria 6626
33 Ga0466723_209011 3300042618 Bacteria 15064
34 Ga0466723_245234 3300042618 Bacteria 2591
35 Ga0466726_354863 3300042619 Bacteria 1525
36 Ga0264413_103165 3300024493 Bacteria 22797
37 Ga0466693_039321 3300042592 Bacteria 1053
38 Ga0466691_046731 3300042593 Bacteria 3208
39 Ga0466694_064514 3300042594 Bacteria 49364
40 Ga0466699_137948 3300042597 Bacteria 4250
41 Ga0466699_397624 3300042597 Bacteria 1153
42 Ga0466699_440015 3300042597 Bacteria 32912
43 Ga0466704_264488 3300042643 Bacteria 21463
44 Ga0466705_018959 3300042612 Bacteria 2201
45 JGI24698J34947_10046581 3300002449 Unclassified 2205
46 JGI24695J34938_10010628 3300002450 Bacteria 5023
47 Ga0072940_1013283 3300005200 Bacteria 6694
48 Ga0072941_1034401 3300005201 Bacteria 9527
49 Ga0074263_118027 3300005485 Unclassified 5435
50 Ga0466716_392815 3300042605 Bacteria 2030
51 Ga0466722_019023 3300042609 Bacteria 8953
52 Ga0123355_10304836 3300009826 Bacteria 2166
53 Ga0123356_10019916 3300010049 Bacteria 6354
54 Ga0466712_014001 3300042614 Bacteria 8844
55 Ga0466715_333263 3300042616 Bacteria 10713
56 Ga0466718_044594 3300042617 Bacteria 2862
57 Ga0466723_227778 3300042618 Bacteria 3376
58 Ga0466723_356247 3300042618 Bacteria 1407
59 Ga0264413_108763 3300024493 Bacteria 7383
60 Ga0466690_243270 3300042590 Bacteria 4626
61 Ga0466693_043420 3300042592 Bacteria 1443
62 Ga0466691_105156 3300042593 Bacteria 8838
63 Ga0466695_198312 3300042595 Bacteria 1397
64 Ga0466696_062086 3300042596 Unclassified 5662
65 Ga0466696_203580 3300042596 Bacteria 11030
66 Ga0466703_097633 3300042636 Bacteria 13588
67 Ga0466703_196062 3300042636 Bacteria 7222
68 Ga0466704_014013 3300042643 Bacteria 5895
69 Ga0466704_491039 3300042643 Bacteria 4321
70 Ga0466704_577719 3300042643 Bacteria 4423
71 Ga0466705_222780 3300042612 Bacteria 14007
72 JGI24695J34938_10113803 3300002450 Bacteria 1102
73 Ga0072941_1038594 3300005201 Bacteria 5808
74 Ga0466719_017705 3300042606 Bacteria 7328
75 Ga0466719_380003 3300042606 Unclassified 3834
76 Ga0466720_125380 3300042607 Bacteria 10259
77 Ga0466722_081427 3300042609 Bacteria 4221
78 Ga0466722_202646 3300042609 Bacteria 9905
79 Ga0466698_048912 3300042610 Bacteria 2203
80 Ga0123353_10147089 3300010167 Bacteria 3766
81 Ga0466723_195461 3300042618 Bacteria 56859
82 Ga0466723_228598 3300042618 Bacteria 1599
83 Ga0466728_385708 3300042620 Bacteria 3101
84 Ga0466699_139643 3300042597 Bacteria 7379
85 Ga0466699_245235 3300042597 Bacteria 12904
86 Ga0466699_291075 3300042597 Bacteria 6740
87 Ga0466731_340664 3300042622 Bacteria 2938
88 Ga0466704_011249 3300042643 Bacteria 50690
89 Ga0466704_475978 3300042643 Bacteria 49461
90 Ga0466709_329039 3300042648 Bacteria 1476
91 Ga0466708_023662 3300042652 Bacteria 18710
92 Ga0466708_123502 3300042652 Bacteria 2556
93 Ga0466705_088424 3300042612 Bacteria 1190
94 JGI24695J34938_10004175 3300002450 Bacteria 9613
95 Ga0074263_103712 3300005485 Unclassified 2180
96 Ga0466722_206021 3300042609 Bacteria 8434
97 Ga0123353_10327020 3300010167 Bacteria 2323
98 Ga0466726_137247 3300042619 Bacteria 9135
99 Ga0466692_081487 3300042591 Bacteria 1517
100 Ga0466693_127080 3300042592 Unclassified 1150
101 Ga0466691_120382 3300042593 Bacteria 7375
102 Ga0466699_302358 3300042597 Unclassified 1249
103 Ga0466699_376261 3300042597 Bacteria 4317
104 Ga0466735_131818 3300042624 Bacteria 1972
105 Ga0466702_179902 3300042635 Bacteria 71441
106 Ga0466708_078211 3300042652 Bacteria 46711
107 AustNasuHG_c1009073 3300000089 Bacteria 3506
108 FAAS_10004275 3300001880 Bacteria 1978
109 JGI24698J34947_10047027 3300002449 Bacteria 2192
110 Ga0072941_1133931 3300005201 Bacteria 1637
111 Ga0466716_447523 3300042605 Bacteria 3226
112 Ga0466722_067842 3300042609 Bacteria 4251
113 Ga0123357_10215814 3300009784 Bacteria 2142
114 Ga0123353_10493707 3300010167 Bacteria 1786
115 Ga0466711_190315 3300042615 Bacteria 2478
116 Ga0466715_082784 3300042616 Bacteria 6715
117 Ga0466715_565079 3300042616 Bacteria 3098
118 Ga0466718_044781 3300042617 Bacteria 1246
119 Ga0466718_162075 3300042617 Bacteria 47757
120 Ga0466723_047296 3300042618 Bacteria 5957
121 Ga0466723_146142 3300042618 Bacteria 10143
122 Ga0466726_134572 3300042619 Bacteria 5026
123 Ga0264413_102917 3300024493 Bacteria 13297
124 Ga0466699_090944 3300042597 Bacteria 2675
125 Ga0466699_313585 3300042597 Bacteria 1719
126 Ga0466703_075486 3300042636 Bacteria 14808
127 Ga0466704_285386 3300042643 Bacteria 59541
128 Ga0466704_410851 3300042643 Bacteria 5597
129 Ga0466705_191661 3300042612 Bacteria 3530
130 Ga0466732_082723 3300042656 Bacteria 5254
131 JGI24695J34938_10000309 3300002450 Bacteria 48089
132 JGI24705J35276_12176257 3300002504 Unclassified 1330
133 Ga0466707_182077 3300042601 Bacteria 3611
134 Ga0466719_223827 3300042606 Bacteria 1765
135 Ga0466719_399420 3300042606 Bacteria 1031
136 Ga0466722_084523 3300042609 Bacteria 6652
137 Ga0466698_363296 3300042610 Bacteria 21780
138 Ga0123355_10000558 3300009826 Bacteria 49958
139 Ga0123353_10484347 3300010167 Bacteria 1809
140 Ga0466705_404120 3300042612 Bacteria 15159
141 Ga0466712_200360 3300042614 Bacteria 13582
142 Ga0466715_179980 3300042616 Bacteria 8265
143 Ga0466715_605099 3300042616 Bacteria 3052
144 Ga0466723_091455 3300042618 Bacteria 5091
145 Ga0466726_212704 3300042619 Bacteria 14720
146 Ga0466726_217295 3300042619 Bacteria 1997
147 Ga0466690_149512 3300042590 Unclassified 2789
148 Ga0466690_248093 3300042590 Bacteria 2729
149 Ga0466692_177400 3300042591 Bacteria 2247
150 Ga0466691_107990 3300042593 Bacteria 10700
151 Ga0466691_162851 3300042593 Bacteria 20155
152 Ga0466694_043895 3300042594 Bacteria 10272
153 Ga0466694_052011 3300042594 Bacteria 5030
154 Ga0466694_070065 3300042594 Bacteria 1884
155 Ga0466699_399540 3300042597 Bacteria 9041
156 Ga0466704_145711 3300042643 Bacteria 2174
157 Ga0466704_262869 3300042643 Bacteria 2126
158 JGI24695J34938_10017702 3300002450 Bacteria 3580
159 Ga0466707_061184 3300042601 Unclassified 3441
160 Ga0466707_148334 3300042601 Unclassified 1558
161 Ga0466707_375971 3300042601 Bacteria 1885
162 Ga0466716_420165 3300042605 Bacteria 3861
163 Ga0466719_092645 3300042606 Bacteria 2319
164 Ga0466719_153419 3300042606 Bacteria 6557
165 Ga0466718_062067 3300042617 Unclassified 1201
166 Ga0264413_105112 3300024493 Bacteria 5546
167 Ga0264413_120521 3300024493 Bacteria 2540
168 Ga0264413_128052 3300024493 Bacteria 2075
169 Ga0466699_132682 3300042597 Bacteria 10933
170 Ga0466699_202269 3300042597 Bacteria 1658
171 Ga0466699_399605 3300042597 Bacteria 1620
172 Ga0466699_403371 3300042597 Bacteria 10189
173 Ga0466703_063951 3300042636 Unclassified 5233
174 Ga0466703_074286 3300042636 Bacteria 5805
175 Ga0466704_066572 3300042643 Bacteria 4982
176 Ga0466709_122280 3300042648 Bacteria 12917
177 Ga0466708_305483 3300042652 Bacteria 13849

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042612 Ga0466705_018959 Ga0466705_018959_660_1361 197
2 3300042592 Ga0466693_127080 Ga0466693_127080_408_1112 220
3 3300002450 JGI24695J34938_10003494 JGI24695J34938_1000349410 221
4 3300010049 Ga0123356_10019916 Ga0123356_100199165 221
5 3300042605 Ga0466716_392815 Ga0466716_392815_311_985 224
6 3300042605 Ga0466716_420165 Ga0466716_420165_2292_2966 224
7 3300042643 Ga0466704_262869 Ga0466704_262869_593_1270 225
8 3300042590 Ga0466690_243270 Ga0466690_243270_2887_3567 226
9 3300042593 Ga0466691_048814 Ga0466691_048814_1506_2186 226
10 3300042596 Ga0466696_203580 Ga0466696_203580_5069_5749 226
11 3300042606 Ga0466719_092645 Ga0466719_092645_706_1386 226
12 3300042606 Ga0466719_223827 Ga0466719_223827_96_776 226
13 3300042614 Ga0466712_043197 Ga0466712_043197_2039_2746 226
14 3300042618 Ga0466723_091455 Ga0466723_091455_437_1117 226
15 3300042643 Ga0466704_475978 Ga0466704_475978_46433_47113 226
16 3300002449 JGI24698J34947_10046581 JGI24698J34947_100465812 227
17 3300002449 JGI24698J34947_10047027 JGI24698J34947_100470272 227
18 3300042605 Ga0466716_447523 Ga0466716_447523_637_1320 227
19 3300042606 Ga0466719_380003 Ga0466719_380003_1410_2135 227
20 3300042606 Ga0466719_431752 Ga0466719_431752_1339_2022 227
21 3300042618 Ga0466723_209011 Ga0466723_209011_11587_12270 227
22 3300042619 Ga0466726_137247 Ga0466726_137247_1754_2437 227
23 3300042619 Ga0466726_354863 Ga0466726_354863_504_1187 227
24 3300042620 Ga0466728_385708 Ga0466728_385708_537_1220 227
25 3300042652 Ga0466708_078211 Ga0466708_078211_30380_31063 227
26 iso_pr_bacteria 650716102 650883498 227
27 3300005083 Ga0068305_10037251 Ga0068305_1003725110 228
28 3300042593 Ga0466691_105156 Ga0466691_105156_778_1464 228
29 3300042597 Ga0466699_313585 Ga0466699_313585_109_828 228
30 3300042601 Ga0466707_375971 Ga0466707_375971_248_934 228
31 3300042619 Ga0466726_212704 Ga0466726_212704_9356_10042 228
32 3300042636 Ga0466703_075486 Ga0466703_075486_13260_13946 228
33 3300042648 Ga0466709_122280 Ga0466709_122280_2073_2759 228
34 3300002449 JGI24698J34947_10016178 JGI24698J34947_100161782 229
35 3300042601 Ga0466707_061184 Ga0466707_061184_1820_2509 229
36 3300042601 Ga0466707_148334 Ga0466707_148334_400_1089 229
37 3300042601 Ga0466707_301169 Ga0466707_301169_471_1160 229
38 3300042601 Ga0466707_411877 Ga0466707_411877_776_1465 229
39 3300042609 Ga0466722_084523 Ga0466722_084523_3548_4237 229
40 iso_pr_bacteria 650716099 650878404 229
41 3300042590 Ga0466690_149512 Ga0466690_149512_97_789 230
42 3300042593 Ga0466691_046731 Ga0466691_046731_1230_1922 230
43 3300042593 Ga0466691_120382 Ga0466691_120382_5500_6192 230
44 3300042606 Ga0466719_006586 Ga0466719_006586_1574_2266 230
45 3300042612 Ga0466705_088424 Ga0466705_088424_266_958 230
46 3300042616 Ga0466715_012042 Ga0466715_012042_433_1125 230
47 3300042616 Ga0466715_333263 Ga0466715_333263_1527_2219 230
48 3300042618 Ga0466723_356247 Ga0466723_356247_336_1028 230
49 3300042643 Ga0466704_577719 Ga0466704_577719_354_1046 230
50 3300009826 Ga0123355_10304836 Ga0123355_103048363 231
51 3300042596 Ga0466696_062086 Ga0466696_062086_4409_5104 231
52 3300042597 Ga0466699_202269 Ga0466699_202269_109_828 231
53 3300042601 Ga0466707_182077 Ga0466707_182077_1873_2568 231
54 3300042652 Ga0466708_305483 Ga0466708_305483_12069_12764 231
55 3300024493 Ga0264413_103165 Ga0264413_10316517 232
56 3300024493 Ga0264413_120521 Ga0264413_1205212 232
57 3300042600 Ga0466700_061377 Ga0466700_061377_982_1680 232
58 3300042601 Ga0466707_126033 Ga0466707_126033_399_1097 232
59 3300042607 Ga0466720_047994 Ga0466720_047994_3561_4259 232
60 3300042615 Ga0466711_190315 Ga0466711_190315_251_949 232
61 3300042615 Ga0466711_462493 Ga0466711_462493_4820_5518 232
62 3300042619 Ga0466726_134572 Ga0466726_134572_1040_1738 232
63 3300042635 Ga0466702_179902 Ga0466702_179902_67811_68509 232
64 3300042636 Ga0466703_097633 Ga0466703_097633_7317_8015 232
65 3300042593 Ga0466691_107990 Ga0466691_107990_6461_7162 233
66 3300042595 Ga0466695_198312 Ga0466695_198312_573_1304 233
67 3300042604 Ga0466717_079641 Ga0466717_079641_546_1247 233
68 3300042609 Ga0466722_081427 Ga0466722_081427_199_900 233
69 3300042612 Ga0466705_191661 Ga0466705_191661_2605_3306 233
70 3300042617 Ga0466718_044594 Ga0466718_044594_1531_2232 233
71 3300042617 Ga0466718_044781 Ga0466718_044781_517_1218 233
72 3300042624 Ga0466735_131818 Ga0466735_131818_865_1566 233
73 3300042656 Ga0466732_082723 Ga0466732_082723_1490_2191 233
74 iso_pr_bacteria 2781125636 2781279561 233
75 iso_pr_bacteria 2781125655 2781316970 233
76 3300002450 JGI24695J34938_10000309 JGI24695J34938_1000030924 234
77 3300009826 Ga0123355_10000558 Ga0123355_100005583 234
78 3300024493 Ga0264413_128052 Ga0264413_1280521 234
79 3300042592 Ga0466693_043420 Ga0466693_043420_75_779 234
80 3300042597 Ga0466699_399605 Ga0466699_399605_52_756 234
81 3300042606 Ga0466719_017705 Ga0466719_017705_3693_4397 234
82 3300042610 Ga0466698_363296 Ga0466698_363296_19280_19984 234
83 3300042612 Ga0466705_222780 Ga0466705_222780_8973_9677 234
84 3300042612 Ga0466705_434571 Ga0466705_434571_1894_2598 234
85 3300042636 Ga0466703_063951 Ga0466703_063951_4188_4892 234
86 3300042643 Ga0466704_011249 Ga0466704_011249_43383_44087 234
87 3300042643 Ga0466704_410851 Ga0466704_410851_2658_3362 234
88 3300002504 JGI24705J35276_12176257 JGI24705J35276_121762572 235
89 3300005200 Ga0072940_1013283 Ga0072940_10132834 235
90 3300005201 Ga0072941_1133931 Ga0072941_11339312 235
91 3300010167 Ga0123353_10484347 Ga0123353_104843472 235
92 3300024493 Ga0264413_102917 Ga0264413_10291710 235
93 3300024493 Ga0264413_108763 Ga0264413_1087638 235
94 3300042590 Ga0466690_248093 Ga0466690_248093_1245_1952 235
95 3300042594 Ga0466694_043895 Ga0466694_043895_7277_7984 235
96 3300042594 Ga0466694_052011 Ga0466694_052011_726_1433 235
97 3300042594 Ga0466694_064514 Ga0466694_064514_14744_15451 235
98 3300042594 Ga0466694_070065 Ga0466694_070065_475_1182 235
99 3300042597 Ga0466699_132682 Ga0466699_132682_9408_10115 235
100 3300042597 Ga0466699_302358 Ga0466699_302358_63_770 235
101 3300042606 Ga0466719_399420 Ga0466719_399420_190_897 235
102 3300042607 Ga0466720_125380 Ga0466720_125380_7086_7793 235
103 3300042610 Ga0466698_048912 Ga0466698_048912_914_1645 235
104 3300042612 Ga0466705_164564 Ga0466705_164564_9851_10558 235
105 3300042614 Ga0466712_200360 Ga0466712_200360_5731_6438 235
106 3300042616 Ga0466715_236298 Ga0466715_236298_4077_4784 235
107 3300042618 Ga0466723_146142 Ga0466723_146142_1061_1768 235
108 3300042622 Ga0466731_340664 Ga0466731_340664_722_1453 235
109 3300042652 Ga0466708_035817 Ga0466708_035817_1765_2499 235
110 iso_pr_bacteria 2781125691 2781429882 235
111 3300000089 AustNasuHG_c1009073 AustNasuHG_10090732 236
112 3300001880 FAAS_10004275 FAAS_100042752 236
113 3300002450 JGI24695J34938_10017702 JGI24695J34938_100177022 236
114 3300005201 Ga0072941_1021733 Ga0072941_10217332 236
115 3300005201 Ga0072941_1034401 Ga0072941_10344012 236
116 3300005201 Ga0072941_1062130 Ga0072941_10621301 236
117 3300005485 Ga0074263_103712 Ga0074263_1037122 236
118 3300005485 Ga0074263_118027 Ga0074263_1180274 236
119 3300010049 Ga0123356_10054337 Ga0123356_100543373 236
120 3300010167 Ga0123353_10493707 Ga0123353_104937072 236
121 3300024493 Ga0264413_105112 Ga0264413_1051124 236
122 3300042593 Ga0466691_162851 Ga0466691_162851_335_1045 236
123 3300042597 Ga0466699_291075 Ga0466699_291075_4114_4824 236
124 3300042609 Ga0466722_206021 Ga0466722_206021_3492_4202 236
125 3300042612 Ga0466705_494028 Ga0466705_494028_1261_1971 236
126 3300009784 Ga0123357_10215814 Ga0123357_102158142 237
127 3300010167 Ga0123353_10147089 Ga0123353_101470892 237
128 3300042592 Ga0466693_039321 Ga0466693_039321_295_1008 237
129 3300042609 Ga0466722_067842 Ga0466722_067842_3441_4154 237
130 3300042643 Ga0466704_066572 Ga0466704_066572_2855_3568 237
131 3300042643 Ga0466704_145711 Ga0466704_145711_478_1191 237
132 3300010167 Ga0123353_10327020 Ga0123353_103270202 238
133 3300042618 Ga0466723_047296 Ga0466723_047296_4581_5426 238
134 3300042636 Ga0466703_196062 Ga0466703_196062_5393_6166 238
135 3300042643 Ga0466704_264488 Ga0466704_264488_17316_18032 238
136 3300042597 Ga0466699_011587 Ga0466699_011587_4930_5649 239
137 3300042597 Ga0466699_090944 Ga0466699_090944_1783_2502 239
138 3300042597 Ga0466699_137948 Ga0466699_137948_28_747 239
139 3300042597 Ga0466699_139643 Ga0466699_139643_5678_6397 239
140 3300042648 Ga0466709_329039 Ga0466709_329039_608_1366 239
141 3300002450 JGI24695J34938_10010628 JGI24695J34938_100106283 240
142 3300042609 Ga0466722_202646 Ga0466722_202646_7016_7738 240
143 3300042616 Ga0466715_605099 Ga0466715_605099_549_1325 240
144 3300042618 Ga0466723_228598 Ga0466723_228598_594_1316 240
145 3300042636 Ga0466703_074286 Ga0466703_074286_1124_1846 240
146 3300005201 Ga0072941_1038594 Ga0072941_10385942 241
147 3300042606 Ga0466719_153419 Ga0466719_153419_263_991 242
148 3300042616 Ga0466715_565079 Ga0466715_565079_178_909 243
149 3300042618 Ga0466723_195461 Ga0466723_195461_8457_9188 243
150 3300002450 JGI24695J34938_10113803 JGI24695J34938_101138032 244
151 3300010167 Ga0123353_11135960 Ga0123353_111359602 244
152 3300042612 Ga0466705_404120 Ga0466705_404120_8750_9529 244
153 3300042643 Ga0466704_491039 Ga0466704_491039_3248_3982 244
154 3300042618 Ga0466723_227778 Ga0466723_227778_2479_3216 245
155 3300002449 JGI24698J34947_10034433 JGI24698J34947_100344333 246
156 3300042617 Ga0466718_062067 Ga0466718_062067_310_1050 246
157 3300042617 Ga0466718_087149 Ga0466718_087149_28544_29284 246
158 3300042617 Ga0466718_162075 Ga0466718_162075_35577_36317 246
159 3300042643 Ga0466704_285386 Ga0466704_285386_50652_51392 246
160 3300042609 Ga0466722_019023 Ga0466722_019023_6614_7357 247
161 3300042591 Ga0466692_177400 Ga0466692_177400_402_1148 248
162 3300042597 Ga0466699_172301 Ga0466699_172301_558_1304 248
163 3300042597 Ga0466699_440015 Ga0466699_440015_16969_17715 248
164 3300042590 Ga0466690_326568 Ga0466690_326568_2253_3044 249
165 3300042605 Ga0466716_067187 Ga0466716_067187_2656_3405 249
166 3300042618 Ga0466723_245234 Ga0466723_245234_1556_2308 250
167 3300042591 Ga0466692_081487 Ga0466692_081487_331_1089 252
168 3300042616 Ga0466715_487027 Ga0466715_487027_2240_3076 252
169 3300042597 Ga0466699_376261 Ga0466699_376261_2119_2880 253
170 3300042616 Ga0466715_179980 Ga0466715_179980_6369_7130 253
171 3300042652 Ga0466708_123502 Ga0466708_123502_53_814 253
172 3300042597 Ga0466699_245235 Ga0466699_245235_904_1668 254
173 3300042619 Ga0466726_217295 Ga0466726_217295_251_1018 255
174 3300002450 JGI24695J34938_10004175 JGI24695J34938_100041754 258
175 3300042614 Ga0466712_014001 Ga0466712_014001_6225_7001 258
176 3300042652 Ga0466708_023662 Ga0466708_023662_14638_15414 258
177 3300042597 Ga0466699_397624 Ga0466699_397624_163_942 259
178 3300042597 Ga0466699_399540 Ga0466699_399540_3956_4735 259
179 3300042597 Ga0466699_403371 Ga0466699_403371_5643_6425 260
180 3300042616 Ga0466715_082784 Ga0466715_082784_479_1279 266
181 3300042643 Ga0466704_014013 Ga0466704_014013_4713_5540 275
182 3300000089 AustNasuHG_c1029995 AustNasuHG_10299952 283

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF04474 DUF554 Protein of unknown function (DUF554) 39 273 0.98

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
7z6m-assembly1.cif.gz_A-2 Crystal structure of Zn2+-transporter BbZIP in a cadmium bound state 0.519 37 276
IDDescriptionScoreStartEndGO Terms
AF-F5YGW2-F1-model_v4 Transport protein 0.979 39 279
AF-A0A1F8U484-F1-model_v4 Uncharacterized/unreviewed 0.9573 37 276
AF-H9ULV4-F1-model_v4 Uncharacterized/unreviewed 0.9524 40 279 GO:0034220

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.67 0.73 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.