Protein Family IF00293

Metagenome Isolate
133 Members
56 Samples
124 Scaffolds
269.77 Avg Length

🧬 Representative Sequence

ID
3300000089|AustNasuHG_c1011548|AustNasuHG_10115484
Length
309 aa
Sequence
MEVCRKSIFCKDPHAENAEIAKKEGLNNSLYYKMRVLILFLFFLSLVFPLAAQEEPGTVPLTVPLNRQGNAGIPPAPGTGIIPFIDLTVRNPQNAQEVAFSLQLLLLITVIGLAPSILILMTSFLRISIVLDFVKRALSLQQVPPNQVILGISLFLTFFIMWPTFDQVYQNSFRPLSQGTINVEQAYREAEGPLRLFMLKQMQSDSGRDNVRLFLAMRGLPRPQSPADVPTYVLIPAFILNELTVAFKIGILLFIPFIVIDMVVASALMSMGMIMLPPIMISMPFKLILFILVDGWGLLTYQLTRSFL*

📊 Sample Types

Isolate 6.8%
Metagenome 93.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 43.6%
Kalotermitidae 23.6%
Unclassified 20.0%
Rhinotermitidae 5.5%
Termopsidae 5.5%
Hodotermitidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 126
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2030936001 Nasutitermes corniger hindgut microbial communities from Florida, USA Metagenome Termitidae
2 2781125653 Treponema sp. Emb289P1bin107 Isolate Unclassified
3 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
4 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
5 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
6 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
7 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
8 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
9 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
10 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
11 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
12 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
13 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
14 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
15 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
16 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
17 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
18 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
19 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
20 2781125639 Treponema sp. Co191P1bin44 Isolate Unclassified
21 2781125652 Treponema sp. Cu122P5bin1 Isolate Unclassified
22 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
23 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
24 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
25 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
26 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
27 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
28 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
29 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
30 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
31 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
32 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
33 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
34 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
35 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
36 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
37 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
38 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
39 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
40 2819990093 Unclassified Spirochaetes Cu122P1bin9 Isolate Unclassified
41 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
42 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
43 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
44 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
45 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
46 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
47 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
48 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
49 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
50 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
51 2820021908 Unclassified Spirochaetes Lab288P4bin6 Isolate Unclassified
52 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
53 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
54 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
55 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
56 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_098373 3300042656 Bacteria 1001
2 Ga0466733_088128 3300042659 Bacteria 4621
3 Ga0466707_283605 3300042601 Bacteria 4076
4 Ga0466716_058970 3300042605 Bacteria 4256
5 Ga0466719_004821 3300042606 Bacteria 22594
6 Ga0466720_097759 3300042607 Bacteria 20759
7 Ga0466722_006401 3300042609 Bacteria 2387
8 Ga0466712_037164 3300042614 Bacteria 4446
9 Ga0466712_091946 3300042614 Bacteria 86490
10 Ga0466715_185691 3300042616 Bacteria 8464
11 Ga0466695_182825 3300042595 Bacteria 1311
12 Ga0466729_296131 3300042621 Bacteria 2888
13 Ga0466704_496686 3300042643 Bacteria 5092
14 Ga0466709_074309 3300042648 Bacteria 10183
15 Ga0466709_350124 3300042648 Bacteria 1971
16 JGI24698J34947_10018068 3300002449 Bacteria 3816
17 JGI24698J34947_10018701 3300002449 Bacteria 3741
18 JGI24695J34938_10056186 3300002450 Bacteria 1698
19 JGI24702J35022_10003206 3300002462 Bacteria 9889
20 Ga0466707_183476 3300042601 Bacteria 1236
21 Ga0466719_454224 3300042606 Bacteria 22411
22 Ga0466712_014770 3300042614 Unclassified 3092
23 Ga0466711_216896 3300042615 Bacteria 77790
24 Ga0466718_006826 3300042617 Bacteria 2699
25 Ga0466726_006619 3300042619 Bacteria 2885
26 Ga0466694_082719 3300042594 Bacteria 3983
27 Ga0466699_128882 3300042597 Bacteria 9329
28 Ga0466702_313252 3300042635 Bacteria 4018
29 Ga0466704_029855 3300042643 Bacteria 11983
30 JGI24698J34947_10023911 3300002449 Bacteria 3266
31 Ga0072941_1000488 3300005201 Bacteria 14481
32 Ga0072941_1010636 3300005201 Bacteria 16608
33 Ga0466733_208830 3300042659 Bacteria 6118
34 Ga0123353_10114947 3300010167 Bacteria 4332
35 Ga0466720_071539 3300042607 Bacteria 31117
36 Ga0466722_016582 3300042609 Bacteria 30884
37 Ga0466723_012739 3300042618 Bacteria 44053
38 Ga0466692_158234 3300042591 Bacteria 2895
39 Ga0466694_301721 3300042594 Unclassified 1672
40 Ga0466699_419758 3300042597 Bacteria 2231
41 Ga0466703_058685 3300042636 Bacteria 36786
42 JGI24698J34947_10051639 3300002449 Bacteria 2066
43 Ga0123356_10397384 3300010049 Bacteria 1515
44 Ga0466717_218554 3300042604 Bacteria 3713
45 Ga0466722_080910 3300042609 Bacteria 18829
46 Ga0466722_213020 3300042609 Bacteria 2782
47 Ga0466715_617762 3300042616 Bacteria 34643
48 Ga0466718_028137 3300042617 Bacteria 35350
49 Ga0466726_021561 3300042619 Bacteria 1367
50 Ga0466726_081561 3300042619 Bacteria 1666
51 Ga0466691_109957 3300042593 Bacteria 4786
52 Ga0466694_125142 3300042594 Bacteria 2013
53 Ga0466694_125668 3300042594 Bacteria 6317
54 Ga0466694_203909 3300042594 Bacteria 2000
55 Ga0466696_460146 3300042596 Bacteria 25654
56 Ga0466703_109331 3300042636 Bacteria 5327
57 Ga0466703_143773 3300042636 Bacteria 24097
58 AustNasuHG_c1011548 3300000089 Bacteria 3060
59 Ga0123357_10115937 3300009784 Bacteria 3394
60 Ga0466706_215847 3300042599 Bacteria 4887
61 Ga0466700_370296 3300042600 Bacteria 8460
62 Ga0466713_156965 3300042602 Bacteria 4261
63 Ga0466719_304897 3300042606 Bacteria 3469
64 Ga0466720_105409 3300042607 Bacteria 1544
65 Ga0466722_064604 3300042609 Bacteria 35013
66 Ga0466718_069483 3300042617 Bacteria 3048
67 Ga0466690_159369 3300042590 Bacteria 2138
68 Ga0466692_102409 3300042591 Bacteria 11330
69 Ga0466692_154753 3300042591 Bacteria 2864
70 Ga0466694_218419 3300042594 Bacteria 37971
71 Ga0466699_078873 3300042597 Bacteria 22366
72 Ga0466702_044213 3300042635 Bacteria 8801
73 Ga0466703_183385 3300042636 Bacteria 9096
74 AustNasuHG_c1012564 3300000089 Bacteria 2923
75 Ga0466705_116715 3300042612 Bacteria 12168
76 Ga0466705_124746 3300042612 Bacteria 12909
77 Ga0466733_043896 3300042659 Bacteria 32052
78 Ga0123353_10110956 3300010167 Bacteria 4418
79 Ga0466719_495967 3300042606 Bacteria 34420
80 Ga0466711_014659 3300042615 Bacteria 10661
81 Ga0466711_324816 3300042615 Bacteria 3305
82 Ga0466718_016105 3300042617 Bacteria 25771
83 Ga0466726_063304 3300042619 Bacteria 1179
84 Ga0466692_009512 3300042591 Bacteria 16295
85 Ga0466692_157773 3300042591 Bacteria 1197
86 Ga0466692_177861 3300042591 Bacteria 7062
87 Ga0466696_230609 3300042596 Bacteria 3334
88 Ga0466703_093126 3300042636 Bacteria 24260
89 Ga0072941_1000487 3300005201 Bacteria 54081
90 Ga0072941_1021004 3300005201 Bacteria 2957
91 Ga0123355_10101941 3300009826 Unclassified 4516
92 Ga0123356_10002126 3300010049 Bacteria 21370
93 Ga0123354_10038483 3300010882 Unclassified 7424
94 Ga0466707_021907 3300042601 Bacteria 1648
95 Ga0466707_359963 3300042601 Bacteria 3816
96 Ga0466717_148050 3300042604 Bacteria 1665
97 Ga0466698_033688 3300042610 Bacteria 1418
98 Ga0466692_058225 3300042591 Bacteria 2002
99 Ga0466692_060665 3300042591 Bacteria 37700
100 Ga0466692_063068 3300042591 Bacteria 1648
101 Ga0466693_041452 3300042592 Bacteria 38277
102 Ga0466694_108617 3300042594 Bacteria 1166
103 Ga0466696_208497 3300042596 Bacteria 3883
104 Ga0466702_034593 3300042635 Unclassified 1623
105 Ga0466703_330108 3300042636 Bacteria 33404
106 Ga0466709_083805 3300042648 Bacteria 22572
107 Ga0466709_199794 3300042648 Bacteria 1171
108 Ga0466708_273325 3300042652 Bacteria 30455
109 Ga0466727_239638 3300042655 Bacteria 9615
110 Ga0072941_1002239 3300005201 Bacteria 9284
111 Ga0466732_279914 3300042656 Bacteria 1060
112 Ga0123353_10155849 3300010167 Bacteria 3641
113 Ga0123353_10320628 3300010167 Bacteria 2352
114 Ga0466722_140944 3300042609 Bacteria 4010
115 Ga0466722_147546 3300042609 Bacteria 51675
116 Ga0466712_125788 3300042614 Bacteria 3629
117 Ga0466712_143974 3300042614 Bacteria 5623
118 Ga0466718_023879 3300042617 Bacteria 2382
119 Ga0466726_446864 3300042619 Bacteria 1145
120 Ga0466699_409671 3300042597 Bacteria 2095
121 Ga0466731_429295 3300042622 Bacteria 23384
122 Ga0466735_077225 3300042624 Bacteria 1178
123 Nasutiter_Contig04795 2030936001 Unclassified 2101
124 JGI24698J34947_10014995 3300002449 Unclassified 4220

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042601 Ga0466707_021907 Ga0466707_021907_949_1629 214
2 3300010049 Ga0123356_10002126 Ga0123356_1000212612 227
3 3300042594 Ga0466694_082719 Ga0466694_082719_1591_2424 232
4 3300042594 Ga0466694_301721 Ga0466694_301721_11_787 233
5 3300042594 Ga0466694_125668 Ga0466694_125668_3330_4106 234
6 3300042594 Ga0466694_203909 Ga0466694_203909_81_944 248
7 3300042597 Ga0466699_419758 Ga0466699_419758_1328_2074 248
8 3300042601 Ga0466707_283605 Ga0466707_283605_42_869 248
9 3300042610 Ga0466698_033688 Ga0466698_033688_463_1269 250
10 3300042652 Ga0466708_273325 Ga0466708_273325_24825_25631 250
11 3300042614 Ga0466712_091946 Ga0466712_091946_14374_15210 251
12 3300042607 Ga0466720_105409 Ga0466720_105409_352_1209 252
13 3300010167 Ga0123353_10155849 Ga0123353_101558491 253
14 3300042594 Ga0466694_218419 Ga0466694_218419_16381_17205 253
15 3300042609 Ga0466722_213020 Ga0466722_213020_169_993 253
16 3300042609 Ga0466722_006401 Ga0466722_006401_702_1523 254
17 3300042617 Ga0466718_006826 Ga0466718_006826_775_1635 254
18 3300000089 AustNasuHG_c1012564 AustNasuHG_10125643 255
19 3300042601 Ga0466707_183476 Ga0466707_183476_70_840 256
20 3300042594 Ga0466694_108617 Ga0466694_108617_25_822 257
21 3300042615 Ga0466711_216896 Ga0466711_216896_46989_47807 257
22 3300042606 Ga0466719_304897 Ga0466719_304897_2623_3450 259
23 3300042606 Ga0466719_454224 Ga0466719_454224_7258_8082 259
24 3300042619 Ga0466726_081561 Ga0466726_081561_276_1154 259
25 3300042636 Ga0466703_093126 Ga0466703_093126_4135_4959 259
26 3300042609 Ga0466722_064604 Ga0466722_064604_10943_11770 260
27 3300042648 Ga0466709_199794 Ga0466709_199794_131_955 260
28 3300042591 Ga0466692_060665 Ga0466692_060665_8196_9035 261
29 3300042609 Ga0466722_147546 Ga0466722_147546_32844_33659 261
30 3300042615 Ga0466711_324816 Ga0466711_324816_557_1381 261
31 iso_pr_bacteria 2781125652 2781312276 261
32 3300042618 Ga0466723_012739 Ga0466723_012739_28162_28992 262
33 3300042624 Ga0466735_077225 Ga0466735_077225_66_893 262
34 3300042659 Ga0466733_208830 Ga0466733_208830_3363_4190 262
35 3300042590 Ga0466690_159369 Ga0466690_159369_1262_2089 263
36 3300042591 Ga0466692_157773 Ga0466692_157773_31_864 263
37 3300042616 Ga0466715_185691 Ga0466715_185691_2915_3733 263
38 3300042643 Ga0466704_029855 Ga0466704_029855_3221_4012 263
39 3300042659 Ga0466733_088128 Ga0466733_088128_3608_4462 263
40 iso_pr_bacteria 2820021908 2820022763 263
41 3300010167 Ga0123353_10110956 Ga0123353_101109563 264
42 3300010167 Ga0123353_10114947 Ga0123353_101149473 264
43 3300010882 Ga0123354_10038483 Ga0123354_100384837 264
44 3300042597 Ga0466699_409671 Ga0466699_409671_36_851 264
45 3300042615 Ga0466711_014659 Ga0466711_014659_6068_6892 264
46 3300042617 Ga0466718_016105 Ga0466718_016105_8534_9352 264
47 iso_pr_bacteria 2781125639 2781285619 264
48 3300042595 Ga0466695_182825 Ga0466695_182825_418_1236 265
49 3300042596 Ga0466696_460146 Ga0466696_460146_5112_5909 265
50 3300042597 Ga0466699_078873 Ga0466699_078873_17879_18694 265
51 3300042643 Ga0466704_496686 Ga0466704_496686_3785_4609 265
52 3300042591 Ga0466692_058225 Ga0466692_058225_216_1016 266
53 3300002449 JGI24698J34947_10051639 JGI24698J34947_100516392 267
54 3300002462 JGI24702J35022_10003206 JGI24702J35022_100032064 267
55 3300042591 Ga0466692_009512 Ga0466692_009512_5410_6213 267
56 3300042655 Ga0466727_239638 Ga0466727_239638_2371_3225 267
57 iso_pr_bacteria 2819990093 2819992245 267
58 3300010049 Ga0123356_10397384 Ga0123356_103973842 268
59 3300002449 JGI24698J34947_10018701 JGI24698J34947_100187013 269
60 3300042614 Ga0466712_125788 Ga0466712_125788_2550_3380 269
61 3300042648 Ga0466709_350124 Ga0466709_350124_334_1170 269
62 3300042656 Ga0466732_098373 Ga0466732_098373_94_903 269
63 3300042656 Ga0466732_279914 Ga0466732_279914_221_1030 269
64 3300042621 Ga0466729_296131 Ga0466729_296131_1073_1906 270
65 3300042636 Ga0466703_109331 Ga0466703_109331_1128_2009 270
66 3300042600 Ga0466700_370296 Ga0466700_370296_3725_4543 272
67 3300042614 Ga0466712_037164 Ga0466712_037164_1311_2162 272
68 3300042617 Ga0466718_028137 Ga0466718_028137_13407_14225 272
69 3300042619 Ga0466726_021561 Ga0466726_021561_153_971 272
70 2030936001 Nasutiter_Contig04795 Nasutiterm_429980 273
71 3300042612 Ga0466705_124746 Ga0466705_124746_5483_6325 273
72 3300042619 Ga0466726_063304 Ga0466726_063304_110_931 273
73 3300042635 Ga0466702_313252 Ga0466702_313252_134_955 273
74 3300042648 Ga0466709_083805 Ga0466709_083805_10688_11509 273
75 3300009826 Ga0123355_10101941 Ga0123355_101019415 274
76 3300042606 Ga0466719_004821 Ga0466719_004821_10574_11398 274
77 3300005201 Ga0072941_1002239 Ga0072941_10022392 275
78 3300042596 Ga0466696_208497 Ga0466696_208497_2301_3128 275
79 3300042616 Ga0466715_617762 Ga0466715_617762_22843_23670 275
80 3300042617 Ga0466718_023879 Ga0466718_023879_759_1610 275
81 3300042635 Ga0466702_044213 Ga0466702_044213_2093_2920 275
82 3300042636 Ga0466703_143773 Ga0466703_143773_11034_11861 275
83 3300042648 Ga0466709_074309 Ga0466709_074309_1145_1972 275
84 3300042659 Ga0466733_043896 Ga0466733_043896_6268_7095 275
85 3300002450 JGI24695J34938_10056186 JGI24695J34938_100561862 276
86 3300042591 Ga0466692_158234 Ga0466692_158234_1581_2411 276
87 3300042592 Ga0466693_041452 Ga0466693_041452_17991_18845 276
88 3300042596 Ga0466696_230609 Ga0466696_230609_562_1392 276
89 3300042605 Ga0466716_058970 Ga0466716_058970_1470_2300 276
90 3300042606 Ga0466719_495967 Ga0466719_495967_17663_18493 276
91 3300042609 Ga0466722_080910 Ga0466722_080910_15576_16406 276
92 3300042636 Ga0466703_330108 Ga0466703_330108_19470_20333 276
93 3300002449 JGI24698J34947_10014995 JGI24698J34947_100149955 277
94 3300002449 JGI24698J34947_10023911 JGI24698J34947_100239114 277
95 3300005201 Ga0072941_1021004 Ga0072941_10210043 277
96 3300042591 Ga0466692_063068 Ga0466692_063068_324_1157 277
97 3300042591 Ga0466692_154753 Ga0466692_154753_1650_2483 277
98 3300042604 Ga0466717_218554 Ga0466717_218554_1093_1926 277
99 3300042593 Ga0466691_109957 Ga0466691_109957_3377_4213 278
100 3300042619 Ga0466726_446864 Ga0466726_446864_159_995 278
101 3300042594 Ga0466694_125142 Ga0466694_125142_705_1544 279
102 3300042607 Ga0466720_071539 Ga0466720_071539_19259_20098 279
103 3300042607 Ga0466720_097759 Ga0466720_097759_6870_7709 279
104 3300042609 Ga0466722_140944 Ga0466722_140944_2095_2934 279
105 iso_pr_bacteria 2781125632 2781271758 279
106 iso_pr_bacteria 2819992462 2819993914 279
107 iso_pr_bacteria 2820020240 2820020832 279
108 3300042601 Ga0466707_359963 Ga0466707_359963_1732_2574 280
109 iso_pr_bacteria 2781125653 2781313813 280
110 3300042597 Ga0466699_128882 Ga0466699_128882_7762_8607 281
111 3300005201 Ga0072941_1000487 Ga0072941_100048726 282
112 3300005201 Ga0072941_1000488 Ga0072941_100048814 282
113 3300005201 Ga0072941_1010636 Ga0072941_101063617 282
114 3300042599 Ga0466706_215847 Ga0466706_215847_2304_3323 282
115 3300042614 Ga0466712_014770 Ga0466712_014770_296_1147 283
116 3300042614 Ga0466712_143974 Ga0466712_143974_4067_4918 283
117 3300002449 JGI24698J34947_10018068 JGI24698J34947_100180682 284
118 3300042609 Ga0466722_016582 Ga0466722_016582_27796_28650 284
119 3300042636 Ga0466703_058685 Ga0466703_058685_24110_24997 284
120 3300042604 Ga0466717_148050 Ga0466717_148050_459_1319 286
121 3300009784 Ga0123357_10115937 Ga0123357_101159374 287
122 3300042591 Ga0466692_177861 Ga0466692_177861_4819_5682 287
123 3300042619 Ga0466726_006619 Ga0466726_006619_776_1639 287
124 3300042636 Ga0466703_183385 Ga0466703_183385_7194_8057 287
125 3300042617 Ga0466718_069483 Ga0466718_069483_772_1662 289
126 3300042602 Ga0466713_156965 Ga0466713_156965_800_1672 290
127 3300042612 Ga0466705_116715 Ga0466705_116715_10227_11099 290
128 3300042635 Ga0466702_034593 Ga0466702_034593_340_1236 290
129 3300042622 Ga0466731_429295 Ga0466731_429295_1587_2483 298
130 iso_pr_bacteria 2781125629 2781264828 298
131 3300042591 Ga0466692_102409 Ga0466692_102409_3531_4436 301
132 3300010167 Ga0123353_10320628 Ga0123353_103206283 308
133 3300000089 AustNasuHG_c1011548 AustNasuHG_10115484 309

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00813 FliP FliP family 107 303 0.96

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.6 0.75 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.