Protein Family IF00293
Metagenome
Isolate
133
Members
56
Samples
124
Scaffolds
269.77
Avg Length
Representative Sequence
- ID
- 3300000089|AustNasuHG_c1011548|AustNasuHG_10115484
- Length
- 309 aa
- Sequence
- MEVCRKSIFCKDPHAENAEIAKKEGLNNSLYYKMRVLILFLFFLSLVFPLAAQEEPGTVPLTVPLNRQGNAGIPPAPGTGIIPFIDLTVRNPQNAQEVAFSLQLLLLITVIGLAPSILILMTSFLRISIVLDFVKRALSLQQVPPNQVILGISLFLTFFIMWPTFDQVYQNSFRPLSQGTINVEQAYREAEGPLRLFMLKQMQSDSGRDNVRLFLAMRGLPRPQSPADVPTYVLIPAFILNELTVAFKIGILLFIPFIVIDMVVASALMSMGMIMLPPIMISMPFKLILFILVDGWGLLTYQLTRSFL*
Sample Types
Isolate
6.8%
Metagenome
93.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
43.6%
Kalotermitidae
23.6%
Unclassified
20.0%
Rhinotermitidae
5.5%
Termopsidae
5.5%
Hodotermitidae
1.8%
Taxonomy
Archaea
0
Bacteria
126
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 2 | 2781125653 | Treponema sp. Emb289P1bin107 | Isolate | Unclassified |
| 3 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 4 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 5 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 6 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 7 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 8 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 9 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 10 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 11 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 12 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 13 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 14 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 15 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 16 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 17 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 18 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 19 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 20 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 21 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 22 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 23 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 24 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 25 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 26 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 27 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 28 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 29 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 30 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 31 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 32 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 33 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 34 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 35 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 36 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 37 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 38 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 39 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 40 | 2819990093 | Unclassified Spirochaetes Cu122P1bin9 | Isolate | Unclassified |
| 41 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 42 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 43 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 44 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 45 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 46 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 47 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 48 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 49 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 50 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 51 | 2820021908 | Unclassified Spirochaetes Lab288P4bin6 | Isolate | Unclassified |
| 52 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 53 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 54 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 55 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 56 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_098373 | 3300042656 | Bacteria | 1001 |
| 2 | Ga0466733_088128 | 3300042659 | Bacteria | 4621 |
| 3 | Ga0466707_283605 | 3300042601 | Bacteria | 4076 |
| 4 | Ga0466716_058970 | 3300042605 | Bacteria | 4256 |
| 5 | Ga0466719_004821 | 3300042606 | Bacteria | 22594 |
| 6 | Ga0466720_097759 | 3300042607 | Bacteria | 20759 |
| 7 | Ga0466722_006401 | 3300042609 | Bacteria | 2387 |
| 8 | Ga0466712_037164 | 3300042614 | Bacteria | 4446 |
| 9 | Ga0466712_091946 | 3300042614 | Bacteria | 86490 |
| 10 | Ga0466715_185691 | 3300042616 | Bacteria | 8464 |
| 11 | Ga0466695_182825 | 3300042595 | Bacteria | 1311 |
| 12 | Ga0466729_296131 | 3300042621 | Bacteria | 2888 |
| 13 | Ga0466704_496686 | 3300042643 | Bacteria | 5092 |
| 14 | Ga0466709_074309 | 3300042648 | Bacteria | 10183 |
| 15 | Ga0466709_350124 | 3300042648 | Bacteria | 1971 |
| 16 | JGI24698J34947_10018068 | 3300002449 | Bacteria | 3816 |
| 17 | JGI24698J34947_10018701 | 3300002449 | Bacteria | 3741 |
| 18 | JGI24695J34938_10056186 | 3300002450 | Bacteria | 1698 |
| 19 | JGI24702J35022_10003206 | 3300002462 | Bacteria | 9889 |
| 20 | Ga0466707_183476 | 3300042601 | Bacteria | 1236 |
| 21 | Ga0466719_454224 | 3300042606 | Bacteria | 22411 |
| 22 | Ga0466712_014770 | 3300042614 | Unclassified | 3092 |
| 23 | Ga0466711_216896 | 3300042615 | Bacteria | 77790 |
| 24 | Ga0466718_006826 | 3300042617 | Bacteria | 2699 |
| 25 | Ga0466726_006619 | 3300042619 | Bacteria | 2885 |
| 26 | Ga0466694_082719 | 3300042594 | Bacteria | 3983 |
| 27 | Ga0466699_128882 | 3300042597 | Bacteria | 9329 |
| 28 | Ga0466702_313252 | 3300042635 | Bacteria | 4018 |
| 29 | Ga0466704_029855 | 3300042643 | Bacteria | 11983 |
| 30 | JGI24698J34947_10023911 | 3300002449 | Bacteria | 3266 |
| 31 | Ga0072941_1000488 | 3300005201 | Bacteria | 14481 |
| 32 | Ga0072941_1010636 | 3300005201 | Bacteria | 16608 |
| 33 | Ga0466733_208830 | 3300042659 | Bacteria | 6118 |
| 34 | Ga0123353_10114947 | 3300010167 | Bacteria | 4332 |
| 35 | Ga0466720_071539 | 3300042607 | Bacteria | 31117 |
| 36 | Ga0466722_016582 | 3300042609 | Bacteria | 30884 |
| 37 | Ga0466723_012739 | 3300042618 | Bacteria | 44053 |
| 38 | Ga0466692_158234 | 3300042591 | Bacteria | 2895 |
| 39 | Ga0466694_301721 | 3300042594 | Unclassified | 1672 |
| 40 | Ga0466699_419758 | 3300042597 | Bacteria | 2231 |
| 41 | Ga0466703_058685 | 3300042636 | Bacteria | 36786 |
| 42 | JGI24698J34947_10051639 | 3300002449 | Bacteria | 2066 |
| 43 | Ga0123356_10397384 | 3300010049 | Bacteria | 1515 |
| 44 | Ga0466717_218554 | 3300042604 | Bacteria | 3713 |
| 45 | Ga0466722_080910 | 3300042609 | Bacteria | 18829 |
| 46 | Ga0466722_213020 | 3300042609 | Bacteria | 2782 |
| 47 | Ga0466715_617762 | 3300042616 | Bacteria | 34643 |
| 48 | Ga0466718_028137 | 3300042617 | Bacteria | 35350 |
| 49 | Ga0466726_021561 | 3300042619 | Bacteria | 1367 |
| 50 | Ga0466726_081561 | 3300042619 | Bacteria | 1666 |
| 51 | Ga0466691_109957 | 3300042593 | Bacteria | 4786 |
| 52 | Ga0466694_125142 | 3300042594 | Bacteria | 2013 |
| 53 | Ga0466694_125668 | 3300042594 | Bacteria | 6317 |
| 54 | Ga0466694_203909 | 3300042594 | Bacteria | 2000 |
| 55 | Ga0466696_460146 | 3300042596 | Bacteria | 25654 |
| 56 | Ga0466703_109331 | 3300042636 | Bacteria | 5327 |
| 57 | Ga0466703_143773 | 3300042636 | Bacteria | 24097 |
| 58 | AustNasuHG_c1011548 | 3300000089 | Bacteria | 3060 |
| 59 | Ga0123357_10115937 | 3300009784 | Bacteria | 3394 |
| 60 | Ga0466706_215847 | 3300042599 | Bacteria | 4887 |
| 61 | Ga0466700_370296 | 3300042600 | Bacteria | 8460 |
| 62 | Ga0466713_156965 | 3300042602 | Bacteria | 4261 |
| 63 | Ga0466719_304897 | 3300042606 | Bacteria | 3469 |
| 64 | Ga0466720_105409 | 3300042607 | Bacteria | 1544 |
| 65 | Ga0466722_064604 | 3300042609 | Bacteria | 35013 |
| 66 | Ga0466718_069483 | 3300042617 | Bacteria | 3048 |
| 67 | Ga0466690_159369 | 3300042590 | Bacteria | 2138 |
| 68 | Ga0466692_102409 | 3300042591 | Bacteria | 11330 |
| 69 | Ga0466692_154753 | 3300042591 | Bacteria | 2864 |
| 70 | Ga0466694_218419 | 3300042594 | Bacteria | 37971 |
| 71 | Ga0466699_078873 | 3300042597 | Bacteria | 22366 |
| 72 | Ga0466702_044213 | 3300042635 | Bacteria | 8801 |
| 73 | Ga0466703_183385 | 3300042636 | Bacteria | 9096 |
| 74 | AustNasuHG_c1012564 | 3300000089 | Bacteria | 2923 |
| 75 | Ga0466705_116715 | 3300042612 | Bacteria | 12168 |
| 76 | Ga0466705_124746 | 3300042612 | Bacteria | 12909 |
| 77 | Ga0466733_043896 | 3300042659 | Bacteria | 32052 |
| 78 | Ga0123353_10110956 | 3300010167 | Bacteria | 4418 |
| 79 | Ga0466719_495967 | 3300042606 | Bacteria | 34420 |
| 80 | Ga0466711_014659 | 3300042615 | Bacteria | 10661 |
| 81 | Ga0466711_324816 | 3300042615 | Bacteria | 3305 |
| 82 | Ga0466718_016105 | 3300042617 | Bacteria | 25771 |
| 83 | Ga0466726_063304 | 3300042619 | Bacteria | 1179 |
| 84 | Ga0466692_009512 | 3300042591 | Bacteria | 16295 |
| 85 | Ga0466692_157773 | 3300042591 | Bacteria | 1197 |
| 86 | Ga0466692_177861 | 3300042591 | Bacteria | 7062 |
| 87 | Ga0466696_230609 | 3300042596 | Bacteria | 3334 |
| 88 | Ga0466703_093126 | 3300042636 | Bacteria | 24260 |
| 89 | Ga0072941_1000487 | 3300005201 | Bacteria | 54081 |
| 90 | Ga0072941_1021004 | 3300005201 | Bacteria | 2957 |
| 91 | Ga0123355_10101941 | 3300009826 | Unclassified | 4516 |
| 92 | Ga0123356_10002126 | 3300010049 | Bacteria | 21370 |
| 93 | Ga0123354_10038483 | 3300010882 | Unclassified | 7424 |
| 94 | Ga0466707_021907 | 3300042601 | Bacteria | 1648 |
| 95 | Ga0466707_359963 | 3300042601 | Bacteria | 3816 |
| 96 | Ga0466717_148050 | 3300042604 | Bacteria | 1665 |
| 97 | Ga0466698_033688 | 3300042610 | Bacteria | 1418 |
| 98 | Ga0466692_058225 | 3300042591 | Bacteria | 2002 |
| 99 | Ga0466692_060665 | 3300042591 | Bacteria | 37700 |
| 100 | Ga0466692_063068 | 3300042591 | Bacteria | 1648 |
| 101 | Ga0466693_041452 | 3300042592 | Bacteria | 38277 |
| 102 | Ga0466694_108617 | 3300042594 | Bacteria | 1166 |
| 103 | Ga0466696_208497 | 3300042596 | Bacteria | 3883 |
| 104 | Ga0466702_034593 | 3300042635 | Unclassified | 1623 |
| 105 | Ga0466703_330108 | 3300042636 | Bacteria | 33404 |
| 106 | Ga0466709_083805 | 3300042648 | Bacteria | 22572 |
| 107 | Ga0466709_199794 | 3300042648 | Bacteria | 1171 |
| 108 | Ga0466708_273325 | 3300042652 | Bacteria | 30455 |
| 109 | Ga0466727_239638 | 3300042655 | Bacteria | 9615 |
| 110 | Ga0072941_1002239 | 3300005201 | Bacteria | 9284 |
| 111 | Ga0466732_279914 | 3300042656 | Bacteria | 1060 |
| 112 | Ga0123353_10155849 | 3300010167 | Bacteria | 3641 |
| 113 | Ga0123353_10320628 | 3300010167 | Bacteria | 2352 |
| 114 | Ga0466722_140944 | 3300042609 | Bacteria | 4010 |
| 115 | Ga0466722_147546 | 3300042609 | Bacteria | 51675 |
| 116 | Ga0466712_125788 | 3300042614 | Bacteria | 3629 |
| 117 | Ga0466712_143974 | 3300042614 | Bacteria | 5623 |
| 118 | Ga0466718_023879 | 3300042617 | Bacteria | 2382 |
| 119 | Ga0466726_446864 | 3300042619 | Bacteria | 1145 |
| 120 | Ga0466699_409671 | 3300042597 | Bacteria | 2095 |
| 121 | Ga0466731_429295 | 3300042622 | Bacteria | 23384 |
| 122 | Ga0466735_077225 | 3300042624 | Bacteria | 1178 |
| 123 | Nasutiter_Contig04795 | 2030936001 | Unclassified | 2101 |
| 124 | JGI24698J34947_10014995 | 3300002449 | Unclassified | 4220 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042601 | Ga0466707_021907 | Ga0466707_021907_949_1629 | 214 |
| 2 | 3300010049 | Ga0123356_10002126 | Ga0123356_1000212612 | 227 |
| 3 | 3300042594 | Ga0466694_082719 | Ga0466694_082719_1591_2424 | 232 |
| 4 | 3300042594 | Ga0466694_301721 | Ga0466694_301721_11_787 | 233 |
| 5 | 3300042594 | Ga0466694_125668 | Ga0466694_125668_3330_4106 | 234 |
| 6 | 3300042594 | Ga0466694_203909 | Ga0466694_203909_81_944 | 248 |
| 7 | 3300042597 | Ga0466699_419758 | Ga0466699_419758_1328_2074 | 248 |
| 8 | 3300042601 | Ga0466707_283605 | Ga0466707_283605_42_869 | 248 |
| 9 | 3300042610 | Ga0466698_033688 | Ga0466698_033688_463_1269 | 250 |
| 10 | 3300042652 | Ga0466708_273325 | Ga0466708_273325_24825_25631 | 250 |
| 11 | 3300042614 | Ga0466712_091946 | Ga0466712_091946_14374_15210 | 251 |
| 12 | 3300042607 | Ga0466720_105409 | Ga0466720_105409_352_1209 | 252 |
| 13 | 3300010167 | Ga0123353_10155849 | Ga0123353_101558491 | 253 |
| 14 | 3300042594 | Ga0466694_218419 | Ga0466694_218419_16381_17205 | 253 |
| 15 | 3300042609 | Ga0466722_213020 | Ga0466722_213020_169_993 | 253 |
| 16 | 3300042609 | Ga0466722_006401 | Ga0466722_006401_702_1523 | 254 |
| 17 | 3300042617 | Ga0466718_006826 | Ga0466718_006826_775_1635 | 254 |
| 18 | 3300000089 | AustNasuHG_c1012564 | AustNasuHG_10125643 | 255 |
| 19 | 3300042601 | Ga0466707_183476 | Ga0466707_183476_70_840 | 256 |
| 20 | 3300042594 | Ga0466694_108617 | Ga0466694_108617_25_822 | 257 |
| 21 | 3300042615 | Ga0466711_216896 | Ga0466711_216896_46989_47807 | 257 |
| 22 | 3300042606 | Ga0466719_304897 | Ga0466719_304897_2623_3450 | 259 |
| 23 | 3300042606 | Ga0466719_454224 | Ga0466719_454224_7258_8082 | 259 |
| 24 | 3300042619 | Ga0466726_081561 | Ga0466726_081561_276_1154 | 259 |
| 25 | 3300042636 | Ga0466703_093126 | Ga0466703_093126_4135_4959 | 259 |
| 26 | 3300042609 | Ga0466722_064604 | Ga0466722_064604_10943_11770 | 260 |
| 27 | 3300042648 | Ga0466709_199794 | Ga0466709_199794_131_955 | 260 |
| 28 | 3300042591 | Ga0466692_060665 | Ga0466692_060665_8196_9035 | 261 |
| 29 | 3300042609 | Ga0466722_147546 | Ga0466722_147546_32844_33659 | 261 |
| 30 | 3300042615 | Ga0466711_324816 | Ga0466711_324816_557_1381 | 261 |
| 31 | iso_pr_bacteria | 2781125652 | 2781312276 | 261 |
| 32 | 3300042618 | Ga0466723_012739 | Ga0466723_012739_28162_28992 | 262 |
| 33 | 3300042624 | Ga0466735_077225 | Ga0466735_077225_66_893 | 262 |
| 34 | 3300042659 | Ga0466733_208830 | Ga0466733_208830_3363_4190 | 262 |
| 35 | 3300042590 | Ga0466690_159369 | Ga0466690_159369_1262_2089 | 263 |
| 36 | 3300042591 | Ga0466692_157773 | Ga0466692_157773_31_864 | 263 |
| 37 | 3300042616 | Ga0466715_185691 | Ga0466715_185691_2915_3733 | 263 |
| 38 | 3300042643 | Ga0466704_029855 | Ga0466704_029855_3221_4012 | 263 |
| 39 | 3300042659 | Ga0466733_088128 | Ga0466733_088128_3608_4462 | 263 |
| 40 | iso_pr_bacteria | 2820021908 | 2820022763 | 263 |
| 41 | 3300010167 | Ga0123353_10110956 | Ga0123353_101109563 | 264 |
| 42 | 3300010167 | Ga0123353_10114947 | Ga0123353_101149473 | 264 |
| 43 | 3300010882 | Ga0123354_10038483 | Ga0123354_100384837 | 264 |
| 44 | 3300042597 | Ga0466699_409671 | Ga0466699_409671_36_851 | 264 |
| 45 | 3300042615 | Ga0466711_014659 | Ga0466711_014659_6068_6892 | 264 |
| 46 | 3300042617 | Ga0466718_016105 | Ga0466718_016105_8534_9352 | 264 |
| 47 | iso_pr_bacteria | 2781125639 | 2781285619 | 264 |
| 48 | 3300042595 | Ga0466695_182825 | Ga0466695_182825_418_1236 | 265 |
| 49 | 3300042596 | Ga0466696_460146 | Ga0466696_460146_5112_5909 | 265 |
| 50 | 3300042597 | Ga0466699_078873 | Ga0466699_078873_17879_18694 | 265 |
| 51 | 3300042643 | Ga0466704_496686 | Ga0466704_496686_3785_4609 | 265 |
| 52 | 3300042591 | Ga0466692_058225 | Ga0466692_058225_216_1016 | 266 |
| 53 | 3300002449 | JGI24698J34947_10051639 | JGI24698J34947_100516392 | 267 |
| 54 | 3300002462 | JGI24702J35022_10003206 | JGI24702J35022_100032064 | 267 |
| 55 | 3300042591 | Ga0466692_009512 | Ga0466692_009512_5410_6213 | 267 |
| 56 | 3300042655 | Ga0466727_239638 | Ga0466727_239638_2371_3225 | 267 |
| 57 | iso_pr_bacteria | 2819990093 | 2819992245 | 267 |
| 58 | 3300010049 | Ga0123356_10397384 | Ga0123356_103973842 | 268 |
| 59 | 3300002449 | JGI24698J34947_10018701 | JGI24698J34947_100187013 | 269 |
| 60 | 3300042614 | Ga0466712_125788 | Ga0466712_125788_2550_3380 | 269 |
| 61 | 3300042648 | Ga0466709_350124 | Ga0466709_350124_334_1170 | 269 |
| 62 | 3300042656 | Ga0466732_098373 | Ga0466732_098373_94_903 | 269 |
| 63 | 3300042656 | Ga0466732_279914 | Ga0466732_279914_221_1030 | 269 |
| 64 | 3300042621 | Ga0466729_296131 | Ga0466729_296131_1073_1906 | 270 |
| 65 | 3300042636 | Ga0466703_109331 | Ga0466703_109331_1128_2009 | 270 |
| 66 | 3300042600 | Ga0466700_370296 | Ga0466700_370296_3725_4543 | 272 |
| 67 | 3300042614 | Ga0466712_037164 | Ga0466712_037164_1311_2162 | 272 |
| 68 | 3300042617 | Ga0466718_028137 | Ga0466718_028137_13407_14225 | 272 |
| 69 | 3300042619 | Ga0466726_021561 | Ga0466726_021561_153_971 | 272 |
| 70 | 2030936001 | Nasutiter_Contig04795 | Nasutiterm_429980 | 273 |
| 71 | 3300042612 | Ga0466705_124746 | Ga0466705_124746_5483_6325 | 273 |
| 72 | 3300042619 | Ga0466726_063304 | Ga0466726_063304_110_931 | 273 |
| 73 | 3300042635 | Ga0466702_313252 | Ga0466702_313252_134_955 | 273 |
| 74 | 3300042648 | Ga0466709_083805 | Ga0466709_083805_10688_11509 | 273 |
| 75 | 3300009826 | Ga0123355_10101941 | Ga0123355_101019415 | 274 |
| 76 | 3300042606 | Ga0466719_004821 | Ga0466719_004821_10574_11398 | 274 |
| 77 | 3300005201 | Ga0072941_1002239 | Ga0072941_10022392 | 275 |
| 78 | 3300042596 | Ga0466696_208497 | Ga0466696_208497_2301_3128 | 275 |
| 79 | 3300042616 | Ga0466715_617762 | Ga0466715_617762_22843_23670 | 275 |
| 80 | 3300042617 | Ga0466718_023879 | Ga0466718_023879_759_1610 | 275 |
| 81 | 3300042635 | Ga0466702_044213 | Ga0466702_044213_2093_2920 | 275 |
| 82 | 3300042636 | Ga0466703_143773 | Ga0466703_143773_11034_11861 | 275 |
| 83 | 3300042648 | Ga0466709_074309 | Ga0466709_074309_1145_1972 | 275 |
| 84 | 3300042659 | Ga0466733_043896 | Ga0466733_043896_6268_7095 | 275 |
| 85 | 3300002450 | JGI24695J34938_10056186 | JGI24695J34938_100561862 | 276 |
| 86 | 3300042591 | Ga0466692_158234 | Ga0466692_158234_1581_2411 | 276 |
| 87 | 3300042592 | Ga0466693_041452 | Ga0466693_041452_17991_18845 | 276 |
| 88 | 3300042596 | Ga0466696_230609 | Ga0466696_230609_562_1392 | 276 |
| 89 | 3300042605 | Ga0466716_058970 | Ga0466716_058970_1470_2300 | 276 |
| 90 | 3300042606 | Ga0466719_495967 | Ga0466719_495967_17663_18493 | 276 |
| 91 | 3300042609 | Ga0466722_080910 | Ga0466722_080910_15576_16406 | 276 |
| 92 | 3300042636 | Ga0466703_330108 | Ga0466703_330108_19470_20333 | 276 |
| 93 | 3300002449 | JGI24698J34947_10014995 | JGI24698J34947_100149955 | 277 |
| 94 | 3300002449 | JGI24698J34947_10023911 | JGI24698J34947_100239114 | 277 |
| 95 | 3300005201 | Ga0072941_1021004 | Ga0072941_10210043 | 277 |
| 96 | 3300042591 | Ga0466692_063068 | Ga0466692_063068_324_1157 | 277 |
| 97 | 3300042591 | Ga0466692_154753 | Ga0466692_154753_1650_2483 | 277 |
| 98 | 3300042604 | Ga0466717_218554 | Ga0466717_218554_1093_1926 | 277 |
| 99 | 3300042593 | Ga0466691_109957 | Ga0466691_109957_3377_4213 | 278 |
| 100 | 3300042619 | Ga0466726_446864 | Ga0466726_446864_159_995 | 278 |
| 101 | 3300042594 | Ga0466694_125142 | Ga0466694_125142_705_1544 | 279 |
| 102 | 3300042607 | Ga0466720_071539 | Ga0466720_071539_19259_20098 | 279 |
| 103 | 3300042607 | Ga0466720_097759 | Ga0466720_097759_6870_7709 | 279 |
| 104 | 3300042609 | Ga0466722_140944 | Ga0466722_140944_2095_2934 | 279 |
| 105 | iso_pr_bacteria | 2781125632 | 2781271758 | 279 |
| 106 | iso_pr_bacteria | 2819992462 | 2819993914 | 279 |
| 107 | iso_pr_bacteria | 2820020240 | 2820020832 | 279 |
| 108 | 3300042601 | Ga0466707_359963 | Ga0466707_359963_1732_2574 | 280 |
| 109 | iso_pr_bacteria | 2781125653 | 2781313813 | 280 |
| 110 | 3300042597 | Ga0466699_128882 | Ga0466699_128882_7762_8607 | 281 |
| 111 | 3300005201 | Ga0072941_1000487 | Ga0072941_100048726 | 282 |
| 112 | 3300005201 | Ga0072941_1000488 | Ga0072941_100048814 | 282 |
| 113 | 3300005201 | Ga0072941_1010636 | Ga0072941_101063617 | 282 |
| 114 | 3300042599 | Ga0466706_215847 | Ga0466706_215847_2304_3323 | 282 |
| 115 | 3300042614 | Ga0466712_014770 | Ga0466712_014770_296_1147 | 283 |
| 116 | 3300042614 | Ga0466712_143974 | Ga0466712_143974_4067_4918 | 283 |
| 117 | 3300002449 | JGI24698J34947_10018068 | JGI24698J34947_100180682 | 284 |
| 118 | 3300042609 | Ga0466722_016582 | Ga0466722_016582_27796_28650 | 284 |
| 119 | 3300042636 | Ga0466703_058685 | Ga0466703_058685_24110_24997 | 284 |
| 120 | 3300042604 | Ga0466717_148050 | Ga0466717_148050_459_1319 | 286 |
| 121 | 3300009784 | Ga0123357_10115937 | Ga0123357_101159374 | 287 |
| 122 | 3300042591 | Ga0466692_177861 | Ga0466692_177861_4819_5682 | 287 |
| 123 | 3300042619 | Ga0466726_006619 | Ga0466726_006619_776_1639 | 287 |
| 124 | 3300042636 | Ga0466703_183385 | Ga0466703_183385_7194_8057 | 287 |
| 125 | 3300042617 | Ga0466718_069483 | Ga0466718_069483_772_1662 | 289 |
| 126 | 3300042602 | Ga0466713_156965 | Ga0466713_156965_800_1672 | 290 |
| 127 | 3300042612 | Ga0466705_116715 | Ga0466705_116715_10227_11099 | 290 |
| 128 | 3300042635 | Ga0466702_034593 | Ga0466702_034593_340_1236 | 290 |
| 129 | 3300042622 | Ga0466731_429295 | Ga0466731_429295_1587_2483 | 298 |
| 130 | iso_pr_bacteria | 2781125629 | 2781264828 | 298 |
| 131 | 3300042591 | Ga0466692_102409 | Ga0466692_102409_3531_4436 | 301 |
| 132 | 3300010167 | Ga0123353_10320628 | Ga0123353_103206283 | 308 |
| 133 | 3300000089 | AustNasuHG_c1011548 | AustNasuHG_10115484 | 309 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00813 | FliP | FliP family | 107 | 303 | 0.96 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.6 | 0.75 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.