Protein Family IF00254

Metagenome Isolate
387 Members
298 Samples
148 Scaffolds
172.55 Avg Length

🧬 Representative Sequence

ID
3300000062|IMNBL1DRAFT_c0045679|IMNBL1DRAFT_00456792
Length
208 aa
Sequence
VRYLNEIYAFCCLKNTRKNDILLELSQIEGVEVMKKIEEYVRSIKDFPEEGIIFRDITSILEDADGLKLAVDLMQEKVENEEFDIVIGPESRGFIFGMPIAYNMHKAFVPIRKKGKLPCETVGIKYELEYGTAELELHRSAIKKGDKVVIIDDLMATGGTTEAMIQLIEGLGGIVVKIVFLIELKGLEGIKRLDGYQVESIISYEGK*

πŸ“Š Sample Types

Isolate 61.8%
Metagenome 38.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 23.8%
Apidae 15.9%
Blattidae 10.8%
Drosophilidae 9.0%
Termitidae 7.9%
Scarabaeidae 3.6%
Halictidae 3.2%
Tenebrionidae 2.9%
Elmidae 2.5%
Kalotermitidae 2.5%
Pyralidae 2.2%
Formicidae 2.2%
Rhinotermitidae 1.1%
Bombycidae 1.1%
Dytiscidae 1.1%
Passalidae 1.1%
Termopsidae 1.1%
Armadillidiidae 1.1%
Culicidae 0.7%
Noctuidae 0.7%
Stratiomyidae 0.4%
Gomphidae 0.4%
Nephropidae 0.4%
Ocypodidae 0.4%
Penaeidae 0.4%
Portunidae 0.4%
Calliphoridae 0.4%
Vespidae 0.4%
Sarcophagidae 0.4%
Hodotermitidae 0.4%
Libellulidae 0.4%
Eresidae 0.4%
Euphausiidae 0.4%
Hydrophilidae 0.4%
Curculionidae 0.4%

🌳 Taxonomy

Archaea 0
Bacteria 363
Eukaryota 0
Viruses 0
Unclassified 24

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2825804107 Enterococcus durans BDGP3 Isolate Drosophilidae
2 2850695442 Lactococcus allomyrinae 1JSPR-7 Isolate Scarabaeidae
3 2855361764 Lysinibacillus fusiformis Juneja Isolate Drosophilidae
4 2864909992 Bacillus velezensis S00166 Isolate Elmidae
5 2881902429 Companilactobacillus metriopterae JCM 31635 Isolate Unclassified
6 2905310146 Ligilactobacillus salivarius A3iob Isolate Apidae
7 2940292506 Lachnoclostridium sp. PH5-23 Isolate Blattidae
8 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
9 2958885890 Lactobacillus sp. ESL0234 Isolate Apidae
10 2961465228 Lactobacillus sp. ESL0233 Isolate Apidae
11 2595698199 Melissococcus plutonius 60 Isolate Apidae
12 2684622911 Lactobacillus kullabergensis Lb_186 Isolate Unclassified
13 2684622914 Lactobacillus helsinborgensis Lb_183 Isolate Unclassified
14 2758568507 Lactobacillus bombicola ESL0237 Isolate Unclassified
15 2758568508 Lactobacillus bombicola ESL0236 Isolate Unclassified
16 2758568512 Lactobacillus helsingborgensis ESL0262 Isolate Unclassified
17 8114537524 Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 Isolate
18 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
19 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
20 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
21 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
22 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
23 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
24 8001918023 Bombilactobacillus bombi XV6 Isolate Apidae
25 8002304686 Apilactobacillus kunkeei UASWS1867-NN5 Isolate Apidae
26 8007215774 Enterococcus sp. BWR-S5 Isolate Scarabaeidae
27 8007237282 Enterococcus sp. DIV0212c Isolate
28 8017458139 Lactobacillus johnsonii CRL1647 Isolate Apidae
29 8017489919 Lactobacillus brevis EF Isolate Unclassified
30 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
31 8018798118 Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 Isolate
32 8061039349 Bacillus thuringiensis sv. galleriae BGSC 4G4 Isolate Bombycidae
33 8066802609 Apilactobacillus timberlakei HV_09 Isolate Halictidae
34 2968368220 Lactobacillus bombicola OCC3 Isolate Apidae
35 2971062614 Lactobacillus bombicola BI-4G Isolate Apidae
36 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
37 3004719924 Lactobacillus sp. W8174 Isolate Apidae
38 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
39 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
40 2822450720 Bacillus toyonensis AFS052650 Isolate Scarabaeidae
41 2864782175 Bacillus toyonensis S00025 Isolate Elmidae
42 2873584433 Vagococcus coleopterorum HDW17A Isolate Dytiscidae
43 2878857142 Lactococcus lactis DmW198 Isolate Drosophilidae
44 2936628749 Apilactobacillus quenuiae HV_6 Isolate Halictidae
45 2940230426 Lachnospiraceae bacterium PH5-48 Isolate Blattidae
46 2940283334 Lachnospiraceae bacterium PF1-4 Isolate Blattidae
47 2940295490 Lachnospiraceae bacterium PH1-22 Isolate Blattidae
48 2940349480 Fusobacterium sp. PH5-44 Isolate Blattidae
49 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
50 2956930723 Bombilactobacillus bombi LV-8.1 Isolate Apidae
51 2964749277 Lactiplantibacillus plantarum FlyG20.1.4 Isolate Drosophilidae
52 2964775400 Lactiplantibacillus plantarum FlyG2.1.8 Isolate Unclassified
53 2595698194 Melissococcus plutonius 90.0 Isolate Apidae
54 2595698195 Melissococcus plutonius 119 Isolate Apidae
55 2645727721 Lactobacillus helsingborgensis Bma5 Isolate Unclassified
56 2728369362 Lactiplantibacillus plantarum DF Isolate Drosophilidae
57 2731957677 Alkalihalobacillus trypoxylicola NBRC 102646 Isolate Scarabaeidae
58 2758568505 Lactobacillus bombicola ESL0225 Isolate Unclassified
59 2758568514 Lactobacillus kullabergensis ESL0261 Isolate Unclassified
60 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
61 2791354930 Wohlfahrtiimonas larvae kbl006 Isolate Stratiomyidae
62 2820385248 Unclassified Firmicutes Nt197P1bin19 Isolate Unclassified
63 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
64 8007223943 Enterococcus sp. MSG2901 Isolate
65 8012112996 Staphylococcus muscae ATCC 49910 Isolate
66 8017536074 Lactobacillus sp. ESL0261 Isolate Apidae
67 8018750880 Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 Isolate
68 8018802046 Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 Isolate Gomphidae
69 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
70 8066795793 Apilactobacillus timberlakei HV_10 Isolate Halictidae
71 8066799369 Apilactobacillus timberlakei HV_02 Isolate Halictidae
72 2978778678 Bacillus cereus 25 Isolate Ocypodidae
73 2979949929 Lactobacillus sp. ESL0263 Isolate Apidae
74 2997944163 Streptococcus penaeicida CAIM 1838 Isolate Unclassified
75 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
76 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
77 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
78 2836667214 Paenibacillus larvae larvae B-3650 Isolate Apidae
79 2849099867 Paenibacillus larvae larvae ERIC_I Isolate Unclassified
80 2852337885 Paenibacillus protaetiae FW100M-2 Isolate Scarabaeidae
81 2864816158 Priestia aryabhattai S00060 Isolate Elmidae
82 2864981449 Sporosarcina sp. S00266 Isolate Elmidae
83 2896843662 Levilactobacillus brevis BDGP6 Isolate Drosophilidae
84 2940270707 Lachnoclostridium sp. PF1-13 Isolate Blattidae
85 2940380068 Paenibacillus sp. PastH-2 Isolate Blattidae
86 2940413413 Paenibacillus sp. PastH-3 Isolate Blattidae
87 2956928875 Bombilactobacillus apium DCY120 Isolate Apidae
88 2964739456 Lactiplantibacillus plantarum FlyG10.1.9 Isolate Drosophilidae
89 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
90 2585428141 Pilibacter termitis ATCC BAA-1030 Isolate Rhinotermitidae
91 2595698190 Melissococcus plutonius 21.1 Isolate Apidae
92 2627853628 Melissococcus plutonius 82 Isolate Apidae
93 2690315820 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
94 2758568504 Lactobacillus bombicola ESL0245 Isolate Unclassified
95 2758568515 Lactobacillus melliventris ESL0259 Isolate Unclassified
96 2758568561 Bombilactobacillus mellis ESL0292 Isolate Unclassified
97 2775507073 Enterococcus sp. CR-Ec1 Isolate Unclassified
98 8114555646 Enterococcus sp. DIV1094 Isolate
99 643886087 Bacillus thuringiensis sv. kurstaki T03a001 Isolate Pyralidae
100 643886090 Bacillus thuringiensis sv. pakistani t13001 Isolate Unclassified
101 8012939035 Enterococcus sp. UD-01 Isolate Tenebrionidae
102 8061100935 Bacillus thuringiensis sv. japonensis 62 Isolate
103 8064008355 Heyndrickxia oleronia Isolate Unclassified
104 8082023105 Niallia sp. Man26 Isolate Penaeidae
105 2969145278 Bacillus cereus 29 Isolate Portunidae
106 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
107 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
108 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
109 2850744690 Paenibacillus larvae larvae DSM 25430 Isolate Apidae
110 2864801025 Bacillus aerius S00042 Isolate Elmidae
111 2873632256 Weissella coleopterorum HDW19 Isolate Dytiscidae
112 2877522083 Apilactobacillus bombintestini BHWM-4 Isolate Apidae
113 2940233634 Lachnoclostridium sp. PF5-10 Isolate Blattidae
114 2940354458 Breznakia sp. PF1-11 Isolate Blattidae
115 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
116 2957623355 Lactiplantibacillus plantarum FlyG11.1.2 Isolate Drosophilidae
117 2636416028 Pelosinus propionicus DSM 13327 Isolate Unclassified
118 2684622912 Lactobacillus apis Lb_185 Isolate Unclassified
119 2684622913 Lactobacillus melliventris Lb_184 Isolate Unclassified
120 2758568506 Lactobacillus bombicola ESL0230 Isolate Unclassified
121 2758568513 Lactobacillus melliventris ESL0260 Isolate Unclassified
122 2758568558 Lactobacillus melliventris ESL0393 Isolate Unclassified
123 2799112220 Lactobacillus sp. ESL0411 Isolate Unclassified
124 2820236043 Unclassified Firmicutes Th196P3bin97 Isolate Unclassified
125 2814123166 Lactobacillus apis LMG 26964 Isolate Apidae
126 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
127 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
128 643886085 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
129 643886091 Bacillus thuringiensis sv. thuringiensis T01001 Isolate Pyralidae
130 8002299145 Vagococcus allomyrinae BWB3-3 Isolate Scarabaeidae
131 8012942269 Mammaliicoccus lentus UD i2 Isolate Tenebrionidae
132 8066797744 Apilactobacillus timberlakei HV_26 Isolate Halictidae
133 8077780672 Enterococcus sp. PLM3 Isolate Formicidae
134 2967802344 Lactiplantibacillus plantarum FlyG11.1.6 Isolate Drosophilidae
135 2977592972 Lactiplantibacillus plantarum FlyG7.1.6 Isolate Drosophilidae
136 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
137 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
138 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
139 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
140 3300026558 Army ant gut microbial communities from Labidus praedator, Monteverde, Costa Rica - colony MVLprae1 Metagenome Formicidae
141 2827179085 Paenibacillus alvei DSM 29 Isolate Apidae
142 2849104611 Paenibacillus larvae larvae Eric_IV Isolate Apidae
143 2851410423 Lactobacillus helsingborgensis ESL0183 Isolate Apidae
144 2852123468 Lysinibacillus sphaericus KCCM 35418 Isolate Unclassified
145 2852431164 Brevibacillus laterosporus BON707 Isolate Calliphoridae
146 2864985977 Staphylococcus hominis S00278 Isolate Elmidae
147 2881375749 Vagococcus entomophilus DSM 24756 Isolate Vespidae
148 2912849059 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
149 2937236879 Lactiplantibacillus plantarum MHO2.4 Isolate
150 2940218408 Enterococcus sp. PF1-24 Isolate Blattidae
151 2940241992 Fusobacterium sp. PH5-29 Isolate Blattidae
152 2940264388 Lachnospiraceae bacterium PFB1-17 Isolate Blattidae
153 2940267548 Lachnospiraceae bacterium PFB1-22 Isolate Blattidae
154 2940280053 Lachnospiraceae bacterium PF1-22 Isolate Blattidae
155 2940419646 Paenibacillus sp. PastF-4 Isolate Blattidae
156 2944625312 Dysgonomonas sp. PF1-3 Isolate Blattidae
157 2960772748 Lactiplantibacillus plantarum MHO2.9 Isolate
158 2963634138 Unclassified Bacilli bacterium PM5-3 Isolate Blattidae
159 2964765680 Lactiplantibacillus plantarum MHO2.5 Isolate
160 2209111004 Macrotermes natalensis queen gut microbiome Metagenome Termitidae
161 2517487021 Wohlfahrtiimonas chitiniclastica DSM 18708 Isolate Sarcophagidae
162 2576861670 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
163 2590828839 Clostridium sp. 1 Isolate Termitidae
164 2595698193 Melissococcus plutonius B5 Isolate Apidae
165 2595698196 Melissococcus plutonius 49.3 Isolate Apidae
166 2758568501 Lactobacillus bombicola ESL0228 Isolate Unclassified
167 2758568502 Lactobacillus bombicola ESL0247 Isolate Unclassified
168 2758568503 Lactobacillus bombicola ESL0246 Isolate Unclassified
169 2758568511 Lactobacillus apis ESL0263 Isolate Unclassified
170 2808606958 Lactobacillus sp. ESL0449 v2 Isolate Unclassified
171 2820306284 Unclassified Firmicutes Th196P1bin11 Isolate Unclassified
172 2820416776 Unclassified Firmicutes Lab288P3bin9 Isolate Unclassified
173 8114544644 Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 Isolate
174 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
175 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
176 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
177 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
178 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
179 8004832522 Lactobacillus sp. ESL0236 Isolate Apidae
180 8018754795 Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 Isolate
181 8038268975 Enterococcus mundtii EM01 Isolate Bombycidae
182 8066794103 Apilactobacillus timberlakei HV_25 Isolate Halictidae
183 2967825073 Lactiplantibacillus plantarum FlyG9.1.4 Isolate Drosophilidae
184 2970254690 Lactiplantibacillus plantarum FlyG9.2.5 Isolate Drosophilidae
185 2977596371 Lactiplantibacillus plantarum FlyG11.2.6 Isolate Drosophilidae
186 2977622177 Lactiplantibacillus plantarum FlyG20.2.6 Isolate Drosophilidae
187 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
188 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
189 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
190 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
191 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
192 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
193 2834951433 Brochothrix thermosphacta CD 337 Isolate Unclassified
194 2843246524 Lysinibacillus sphaericus DSM 28 Isolate Unclassified
195 2851412233 Bombilactobacillus bombi BI-2.5 Isolate Apidae
196 2864895409 Bacillus aerius S00152 Isolate Elmidae
197 2902668162 Lacticaseibacillus paracasei DmW_181 Isolate Drosophilidae
198 2916858470 Heyndrickxia oleronia Isolate Unclassified
199 2916873227 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
200 2940221333 Paenibacillus sp. PastF-3 Isolate Blattidae
201 2940425923 Paenibacillus sp. PastH-4 Isolate Blattidae
202 2963635624 Unclassified Bacilli bacterium PM5-9 Isolate Blattidae
203 2964778705 Lactiplantibacillus plantarum DietG20.2.2_EE Isolate Unclassified
204 2912324399 Lactobacillus apis ESL0185 Isolate Apidae
205 2558860143 Apilactobacillus kunkeei EFB6 Isolate Apidae
206 2563367190 Bacillus thuringiensis sv. aizawai Leapi01 Isolate Noctuidae
207 2595698197 Melissococcus plutonius H6 Isolate Apidae
208 2597490293 Lactiplantibacillus plantarum DmCS_001 Isolate Drosophilidae
209 2718218475 Lactiplantibacillus plantarum KP Isolate Drosophilidae
210 2791355481 Bacillus sp. ZY-1-1 Isolate Scarabaeidae
211 2820411483 Unclassified Firmicutes Lab288P4bin76 Isolate Unclassified
212 8114541043 Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 Isolate Libellulidae
213 650716050 Melissococcus plutonius ATCC 35311 Isolate Unclassified
214 8007211731 Enterococcus larvae BWM-S5 Isolate Scarabaeidae
215 8022725327 Bacillus sp. SN10 Isolate Eresidae
216 8022781829 Bacillus sp. VKPM B-3276 Isolate Culicidae
217 8066790652 Apilactobacillus timberlakei HV_28 Isolate Halictidae
218 8066792404 Apilactobacillus timberlakei HV_04 Isolate Halictidae
219 2970225615 Lactiplantibacillus plantarum FlyG8.1.1 Isolate Drosophilidae
220 2977628635 Lactiplantibacillus plantarum FlyG3.1.8 Isolate Drosophilidae
221 2977653127 Lactiplantibacillus plantarum FlyG10.1.5 Isolate Drosophilidae
222 2983866074 Paenibacillus polymyxa A18 Isolate Unclassified
223 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
224 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
225 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
226 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
227 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
228 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
229 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
230 2873593402 Erysipelothrix sp. HDW6A Isolate Dytiscidae
231 2873597894 Erysipelothrix sp. HDW6B Isolate Unclassified
232 2900804455 Listeria sp. PSOL-1 Marseille-P4284 Isolate Unclassified
233 2917496769 Staphylococcus muscae DSM 7068 Isolate Unclassified
234 2940261461 Enterococcus sp. PFB1-1 Isolate Blattidae
235 2940273867 Lachnoclostridium sp. PH1-16 Isolate Blattidae
236 2940289514 Lachnospiraceae bacterium PM6-15 Isolate Blattidae
237 2956926959 Bombilactobacillus bombi BI-1.1 Isolate Apidae
238 2882334426 Lactobacillus sp. 2-3 Isolate Unclassified
239 2537562000 Bacillus cereus HD73 Isolate Pyralidae
240 2551306396 Paenibacillus sp. ICGEB2008 Isolate Noctuidae
241 2574180310 Bacillus licheniformis CG-B52 Isolate Unclassified
242 2576861701 Paenibacillus sp. JCM 10914 Isolate Termitidae
243 2622736579 Desemzia incerta DSM 20581 Isolate Unclassified
244 2740892556 Enterococcus sp. JR029-101 Isolate Unclassified
245 2740892557 Staphylococcus sp. JDR108L-110-1 Isolate Unclassified
246 2758568509 Lactobacillus bombicola ESL0234 Isolate Unclassified
247 2758568510 Lactobacillus bombicola ESL0233 Isolate Unclassified
248 2758568557 Bombilactobacillus mellis ESL0394 Isolate Unclassified
249 2758568559 Bombilactobacillus mellis ESL0295 Isolate Unclassified
250 2770939318 Lactiplantibacillus plantarum plantarum LP2 Isolate Apidae
251 8112490586 Staphylococcus muscae CCM 4175 Isolate
252 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
253 8002519755 Planococcus sp. MSAK28401 Isolate Euphausiidae
254 8061045771 Bacillus thuringiensis sv. kurstaki BGSC 4D1 Isolate Bombycidae
255 8108568626 Enterococcus sp. DIV1094 Isolate
256 8108576847 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
257 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
258 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
259 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
260 3300026559 Army ant gut microbial communities from Eciton burchelli, Santa Rosa, Costa Rica - colony SREbp2 Metagenome Formicidae
261 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
262 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
263 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
264 2822232166 Bacillus toyonensis AFS084242 Isolate Scarabaeidae
265 2873595552 Erysipelothrix sp. HDW6C Isolate Hydrophilidae
266 2877513988 Lactobacillus kullabergensis ESL0186 Isolate Apidae
267 2890957088 Psychrobacillus lasiicapitis NEAU-3TGS17 Isolate Formicidae
268 2923762712 Apilactobacillus micheneri Hlig3 Isolate Halictidae
269 2940277027 Lachnospiraceae bacterium PF1-21 Isolate Blattidae
270 2940373808 Fusobacterium sp. PH5-7 Isolate Blattidae
271 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
272 2961515617 Lactobacillus sp. ESL0259 Isolate Apidae
273 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
274 2523231078 Paenibacillus larvae larvae 4-309, DSM 25430 Isolate Apidae
275 2524614537 Lysinibacillus sphaericus OT4b.31 Isolate Unclassified
276 2595698198 Melissococcus plutonius L9 Isolate Apidae
277 2630968413 Bombilactobacillus mellifer Bin4 Isolate Unclassified
278 2675903377 Apilactobacillus kunkeei AR114 Isolate Unclassified
279 2751185832 Lysinibacillus sp. AR18-8 Isolate Unclassified
280 2758568560 Bombilactobacillus mellis ESL0294 Isolate Unclassified
281 2785510748 Lactobacillus sp. ESL0409 Isolate Apidae
282 2799112229 Lactobacillus sp. ESL0413 Isolate Unclassified
283 2799112230 Lactobacillus sp. ESL0416 Isolate Unclassified
284 8114549044 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
285 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
286 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
287 647533136 Enterococcus faecalis Fly1 Isolate Drosophilidae
288 8007220153 Enterococcus sp. BWB1-3 Isolate Scarabaeidae
289 8017440191 Lactobacillus bombicola L5-31 Isolate Apidae
290 8017462664 Lactobacillus melliventris ESL0184 Isolate Apidae
291 2970199020 Lactiplantibacillus plantarum FlyG8.1.2 Isolate Drosophilidae
292 2971438493 Paenibacillus apiarius NRRL B-23460 Isolate Apidae
293 2977635137 Lactiplantibacillus plantarum DietG20.1.2 Isolate Unclassified
294 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
295 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
296 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
297 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
298 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562378_0234 3300056814 Unclassified 130023
2 Ga0562374_0082 3300057007 Unclassified 284758
3 Ga0562374_1124 3300057007 Bacteria 34534
4 Ga0466706_245779 3300042599 Bacteria 3103
5 Ga0466707_274249 3300042601 Bacteria 61467
6 Ga0466707_353762 3300042601 Bacteria 3560
7 Ga0466715_357572 3300042616 Bacteria 181743
8 Ga0466715_589362 3300042616 Bacteria 11751
9 Ga0466726_099829 3300042619 Bacteria 117568
10 Ga0255576_1000001 3300026558 Bacteria 687723
11 Ga0255575_1000007 3300026559 Bacteria 308135
12 Ga0466727_057228 3300042655 Bacteria 28562
13 Ga0123357_10124412 3300009784 Bacteria 3235
14 Ga0123355_10515977 3300009826 Bacteria 1465
15 Ga0123356_11408360 3300010049 Bacteria 857
16 Ga0123353_10061193 3300010167 Bacteria 6037
17 IMNBL1DRAFT_c0026799 3300000062 Bacteria 2182
18 AustNasuHG_c1008064 3300000089 Bacteria 3733
19 HBC_ctgsDRAFT_1046711 3300000333 Unclassified 1055
20 JGI24703J35330_11747613 3300002501 Bacteria 7443
21 JGI24703J35330_11747864 3300002501 Bacteria 8708
22 Ga0562379_0009 3300056790 Bacteria 1927879
23 Ga0562379_0275 3300056790 Bacteria 132969
24 Ga0562379_0393 3300056790 Bacteria 98832
25 Ga0562378_0096 3300056814 Bacteria 246586
26 Ga0562378_1859 3300056814 Bacteria 20521
27 Ga0562375_3099 3300056856 Unclassified 16553
28 Ga0466700_301077 3300042600 Bacteria 28487
29 Ga0466707_412451 3300042601 Bacteria 3315
30 Ga0466713_052392 3300042602 Bacteria 216200
31 Ga0466714_118011 3300042603 Bacteria 1074
32 Ga0466722_067396 3300042609 Bacteria 1364
33 Ga0466715_199540 3300042616 Bacteria 144220
34 Ga0466715_428250 3300042616 Bacteria 21415
35 Ga0160445_102567 3300012847 Bacteria 4112
36 Ga0466709_147924 3300042648 Bacteria 39050
37 Ga0123355_10207381 3300009826 Bacteria 2848
38 Ga0123353_10026587 3300010167 Bacteria 8845
39 Ga0123353_10700972 3300010167 Bacteria 1421
40 2227512969 2225789004 Unclassified 3512
41 HBC_ctgsDRAFT_1005941 3300000333 Unclassified 2868
42 JGI24700J35501_10930144 3300002508 Bacteria 11696
43 Ga0530661_133097 3300056564 Unclassified 677
44 Ga0562379_0005 3300056790 Bacteria 2649770
45 Ga0562379_0397 3300056790 Bacteria 98115
46 Ga0562379_4066 3300056790 Bacteria 8211
47 Ga0562375_0096 3300056856 Bacteria 273717
48 Ga0562374_0034 3300057007 Bacteria 713140
49 Ga0466706_072386 3300042599 Unclassified 9353
50 Ga0466707_131389 3300042601 Bacteria 97048
51 Ga0466716_490221 3300042605 Bacteria 3523
52 Ga0466734_105387 3300042623 Bacteria 1166
53 Ga0466730_024004 3300042625 Unclassified 2416
54 Ga0466702_254670 3300042635 Bacteria 3052
55 Ga0466709_233970 3300042648 Bacteria 334556
56 Ga0160464_100506 3300012805 Bacteria 27578
57 2227035924 2225789003 Bacteria 19272
58 IMNBL1DRAFT_c0000038 3300000062 Bacteria 119602
59 IMNBL1DRAFT_c0000064 3300000062 Bacteria 97351
60 JGI24703J35330_11082659 3300002501 Bacteria 680
61 Ga0063521_1000516 3300003973 Unclassified 17436
62 Ga0562379_0044 3300056790 Bacteria 597058
63 Ga0562379_0792 3300056790 Bacteria 50943
64 Ga0562376_0988 3300056857 Unclassified 43547
65 Ga0466706_179425 3300042599 Bacteria 21667
66 Ga0466706_242298 3300042599 Bacteria 1755
67 Ga0466706_259031 3300042599 Unclassified 2238
68 Ga0466707_075174 3300042601 Bacteria 159565
69 Ga0466707_149263 3300042601 Bacteria 3412
70 Ga0466713_090642 3300042602 Bacteria 74862
71 Ga0160467_100118 3300012829 Bacteria 113293
72 Ga0466729_260309 3300042621 Bacteria 2428
73 Ga0466729_317027 3300042621 Unclassified 1865
74 Ga0466731_048861 3300042622 Bacteria 1549
75 Ga0123355_10776602 3300009826 Bacteria 1075
76 Ga0068305_10065862 3300005083 Bacteria 5770
77 Ga0072940_1019576 3300005200 Bacteria 1742
78 Ga0102734_1000145 3300007129 Bacteria 23085
79 Ga0530661_000104 3300056564 Bacteria 78023
80 Ga0562379_0078 3300056790 Bacteria 360595
81 Ga0562379_0988 3300056790 Bacteria 40082
82 Ga0562375_0013 3300056856 Bacteria 1229523
83 Ga0562375_2309 3300056856 Bacteria 21727
84 Ga0562374_0008 3300057007 Bacteria 1999653
85 Ga0466706_154742 3300042599 Bacteria 4199
86 Ga0466700_380303 3300042600 Bacteria 16625
87 Ga0466707_348719 3300042601 Bacteria 1676
88 Ga0466715_006667 3300042616 Bacteria 9568
89 Ga0466728_392215 3300042620 Bacteria 16026
90 Ga0160452_100277 3300012834 Bacteria 48531
91 Ga0466691_031800 3300042593 Bacteria 8623
92 Ga0123355_11231048 3300009826 Bacteria 760
93 Ga0123353_10878884 3300010167 Bacteria 1224
94 2211830525 2209111004 Bacteria 29340
95 2227247454 2225789004 Bacteria 31994
96 IMNBL1DRAFT_c0000020 3300000062 Bacteria 157199
97 IMNBL1DRAFT_c0027052 3300000062 Bacteria 2166
98 IMNBL1DRAFT_c0034775 3300000062 Unclassified 1787
99 Ga0074278_131433 3300005721 Unclassified 1119
100 Ga0530661_000001 3300056564 Bacteria 684835
101 Ga0466706_090237 3300042599 Bacteria 1057
102 Ga0466700_171056 3300042600 Bacteria 1701
103 Ga0466713_053428 3300042602 Bacteria 4860
104 Ga0466719_369831 3300042606 Bacteria 20033
105 Ga0160443_102554 3300012848 Unclassified 3899
106 Ga0466691_205177 3300042593 Bacteria 14637
107 Ga0466701_007980 3300042598 Bacteria 74772
108 Ga0466735_062691 3300042624 Bacteria 1066
109 Ga0466702_084551 3300042635 Bacteria 147089
110 Ga0123355_10242239 3300009826 Bacteria 2553
111 Ga0123354_10560571 3300010882 Bacteria 856
112 Ga0160466_101373 3300012809 Bacteria 6718
113 2227330771 2225789004 Bacteria 28942
114 IMNBL1DRAFT_c0061707 3300000062 Bacteria 1123
115 HBC_ctgsDRAFT_1048893 3300000333 Bacteria 1029
116 JGI24703J35330_11563134 3300002501 Bacteria 1259
117 CVPL010L_1000711 3300002932 Unclassified 8923
118 Ga0466732_349506 3300042656 Bacteria 1826
119 Ga0466733_070008 3300042659 Bacteria 50555
120 Ga0466706_009084 3300042599 Bacteria 5566
121 Ga0466706_182763 3300042599 Bacteria 15291
122 Ga0466713_072041 3300042602 Bacteria 94552
123 Ga0466709_044661 3300042648 Bacteria 1759
124 Ga0123353_10019469 3300010167 Unclassified 10087
125 Ga0160471_107834 3300012812 Bacteria 1273
126 IMNBL1DRAFT_c0058248 3300000062 Bacteria 1174
127 Ga0072940_1290108 3300005200 Bacteria 914
128 Ga0074278_102193 3300005721 Bacteria 17666
129 Ga0074278_105617 3300005721 Unclassified 1640
130 Ga0466733_073226 3300042659 Bacteria 1841
131 Ga0530661_001808 3300056564 Unclassified 9598
132 Ga0562379_0011 3300056790 Bacteria 1623141
133 Ga0562375_0742 3300056856 Unclassified 57376
134 Ga0562376_0005 3300056857 Bacteria 2173693
135 Ga0562376_0481 3300056857 Bacteria 72588
136 Ga0562374_3603 3300057007 Unclassified 7787
137 Ga0466722_264069 3300042609 Bacteria 2824
138 Ga0466710_228698 3300042613 Bacteria 1714
139 Ga0466715_041286 3300042616 Bacteria 1963
140 Ga0466735_011974 3300042624 Bacteria 1810
141 Ga0466703_256098 3300042636 Unclassified 11370
142 Ga0123357_10070416 3300009784 Bacteria 4645
143 2227364454 2225789004 Bacteria 1122
144 2227384418 2225789004 Bacteria 1095
145 IMNBL1DRAFT_c0000007 3300000062 Bacteria 246638
146 IMNBL1DRAFT_c0045679 3300000062 Bacteria 1428
147 HBC_ctgsDRAFT_1000122 3300000333 Bacteria 18957
148 HBC_ctgsDRAFT_1007123 3300000333 Unclassified 2630

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 2595698198 2596220634 166
2 2209111004 2211830525 2211865437 170
3 2225789004 2227364454 2227811993 170
4 2225789004 2227384418 2227829375 170
5 2225789004 2227512969 2228008898 170
6 3300026558 Ga0255576_1000001 Ga0255576_1000001209 170
7 3300026559 Ga0255575_1000007 Ga0255575_1000007123 170
8 3300042599 Ga0466706_072386 Ga0466706_072386_8721_9233 170
9 3300042599 Ga0466706_179425 Ga0466706_179425_122_634 170
10 3300042600 Ga0466700_301077 Ga0466700_301077_211_723 170
11 3300042600 Ga0466700_380303 Ga0466700_380303_5642_6154 170
12 3300042601 Ga0466707_075174 Ga0466707_075174_63124_63636 170
13 3300042601 Ga0466707_131389 Ga0466707_131389_78101_78613 170
14 3300042602 Ga0466713_072041 Ga0466713_072041_35369_35881 170
15 3300042605 Ga0466716_490221 Ga0466716_490221_1081_1593 170
16 3300042609 Ga0466722_264069 Ga0466722_264069_625_1137 170
17 3300042613 Ga0466710_228698 Ga0466710_228698_174_686 170
18 3300042616 Ga0466715_041286 Ga0466715_041286_103_615 170
19 3300042616 Ga0466715_199540 Ga0466715_199540_89533_90045 170
20 3300042616 Ga0466715_589362 Ga0466715_589362_8889_9401 170
21 3300042621 Ga0466729_260309 Ga0466729_260309_228_740 170
22 3300042621 Ga0466729_317027 Ga0466729_317027_949_1461 170
23 3300042625 Ga0466730_024004 Ga0466730_024004_288_800 170
24 3300042635 Ga0466702_254670 Ga0466702_254670_540_1052 170
25 3300042648 Ga0466709_044661 Ga0466709_044661_655_1167 170
26 3300042655 Ga0466727_057228 Ga0466727_057228_3876_4388 170
27 3300056564 Ga0530661_000104 Ga0530661_000104_17634_18146 170
28 3300056564 Ga0530661_001808 Ga0530661_001808_3565_4077 170
29 3300056790 Ga0562379_0005 Ga0562379_0005_2196738_2197250 170
30 3300056814 Ga0562378_0234 Ga0562378_0234_105869_106381 170
31 3300056856 Ga0562375_0013 Ga0562375_0013_506271_506783 170
32 3300056856 Ga0562375_0096 Ga0562375_0096_255408_255920 170
33 3300056856 Ga0562375_0742 Ga0562375_0742_12187_12699 170
34 3300056857 Ga0562376_0481 Ga0562376_0481_21811_22323 170
35 3300056857 Ga0562376_0988 Ga0562376_0988_32994_33506 170
36 3300057007 Ga0562374_0008 Ga0562374_0008_409077_409589 170
37 3300057007 Ga0562374_1124 Ga0562374_1124_30689_31201 170
38 3300057007 Ga0562374_3603 Ga0562374_3603_5028_5540 170
39 iso_pr_bacteria 2517487021 2517563328 170
40 iso_pr_bacteria 2523231078 2523495887 170
41 iso_pr_bacteria 2524614537 2524835275 170
42 iso_pr_bacteria 2537562000 2539434104 170
43 iso_pr_bacteria 2551306396 2552923179 170
44 iso_pr_bacteria 2563367190 2565786882 170
45 iso_pr_bacteria 2574180310 2576357751 170
46 iso_pr_bacteria 2585428141 2588053070 170
47 iso_pr_bacteria 2595698190 2596206054 170
48 iso_pr_bacteria 2595698193 2596211464 170
49 iso_pr_bacteria 2595698194 2596213186 170
50 iso_pr_bacteria 2595698195 2596215082 170
51 iso_pr_bacteria 2595698196 2596216967 170
52 iso_pr_bacteria 2595698197 2596218803 170
53 iso_pr_bacteria 2595698199 2596222446 170
54 iso_pr_bacteria 2622736579 2623392544 170
55 iso_pr_bacteria 2627853628 2628280764 170
56 iso_pr_bacteria 2630968413 2631703007 170
57 iso_pr_bacteria 2636416028 2638993928 170
58 iso_pr_bacteria 2740892556 2743947168 170
59 iso_pr_bacteria 2751185832 2753508497 170
60 iso_pr_bacteria 2758568557 2760422698 170
61 iso_pr_bacteria 2758568559 2760426163 170
62 iso_pr_bacteria 2758568560 2760427415 170
63 iso_pr_bacteria 2758568561 2760429266 170
64 iso_pr_bacteria 2767802234 2769331462 170
65 iso_pr_bacteria 2775507073 2777017442 170
66 iso_pr_bacteria 2791354930 2792023098 170
67 iso_pr_bacteria 2791355481 2794424785 170
68 iso_pr_bacteria 2808606958 2811757898 170
69 iso_pr_bacteria 2820385248 2820385867 170
70 iso_pr_bacteria 2820411483 2820411955 170
71 iso_pr_bacteria 2820416776 2820417209 170
72 iso_pr_bacteria 2822232166 2822232622 170
73 iso_pr_bacteria 2822450720 2822455599 170
74 iso_pr_bacteria 2825804107 2825806351 170
75 iso_pr_bacteria 2836667214 2836668014 170
76 iso_pr_bacteria 2843246524 2843248076 170
77 iso_pr_bacteria 2849099867 2849101381 170
78 iso_pr_bacteria 2849104611 2849107980 170
79 iso_pr_bacteria 2850744690 2850747536 170
80 iso_pr_bacteria 2851412233 2851412732 170
81 iso_pr_bacteria 2852123468 2852125743 170
82 iso_pr_bacteria 2852431164 2852433497 170
83 iso_pr_bacteria 2855361764 2855363613 170
84 iso_pr_bacteria 2864782175 2864784040 170
85 iso_pr_bacteria 2864801025 2864803426 170
86 iso_pr_bacteria 2864816158 2864819613 170
87 iso_pr_bacteria 2864895409 2864897808 170
88 iso_pr_bacteria 2864909992 2864912840 170
89 iso_pr_bacteria 2864981449 2864984565 170
90 iso_pr_bacteria 2873593402 2873594545 170
91 iso_pr_bacteria 2873595552 2873597330 170
92 iso_pr_bacteria 2873597894 2873599462 170
93 iso_pr_bacteria 2878857142 2878859019 170
94 iso_pr_bacteria 2881375749 2881376098 170
95 iso_pr_bacteria 2890957088 2890960362 170
96 iso_pr_bacteria 2912849059 2912853586 170
97 iso_pr_bacteria 2916858470 2916860741 170
98 iso_pr_bacteria 2916873227 2916879580 170
99 iso_pr_bacteria 2940218408 2940220919 170
100 iso_pr_bacteria 2940241992 2940243077 170
101 iso_pr_bacteria 2940261461 2940263955 170
102 iso_pr_bacteria 2940349480 2940350588 170
103 iso_pr_bacteria 2940373808 2940376836 170
104 iso_pr_bacteria 2956926959 2956928176 170
105 iso_pr_bacteria 2956928875 2956930601 170
106 iso_pr_bacteria 2956930723 2956931938 170
107 iso_pr_bacteria 2963634138 2963635213 170
108 iso_pr_bacteria 2963635624 2963636950 170
109 iso_pr_bacteria 2969145278 2969145732 170
110 iso_pr_bacteria 2971438493 2971439444 170
111 iso_pr_bacteria 2978778678 2978780122 170
112 iso_pr_bacteria 2983866074 2983871180 170
113 iso_pr_bacteria 643886085 644681776 170
114 iso_pr_bacteria 643886087 644669421 170
115 iso_pr_bacteria 643886090 644663362 170
116 iso_pr_bacteria 643886091 644650464 170
117 iso_pr_bacteria 647533136 647747889 170
118 iso_pr_bacteria 650716050 650845355 170
119 iso_pr_bacteria 8001918023 8001918935 170
120 iso_pr_bacteria 8002299145 8002303002 170
121 iso_pr_bacteria 8002519755 8002521367 170
122 iso_pr_bacteria 8007211731 8007213680 170
123 iso_pr_bacteria 8007215774 8007218838 170
124 iso_pr_bacteria 8007220153 8007223011 170
125 iso_pr_bacteria 8007223943 8007224251 170
126 iso_pr_bacteria 8007237282 8007240503 170
127 iso_pr_bacteria 8012939035 8012939339 170
128 iso_pr_bacteria 8018750880 8018751912 170
129 iso_pr_bacteria 8018754795 8018756456 170
130 iso_pr_bacteria 8018794549 8018796599 170
131 iso_pr_bacteria 8018798118 8018800220 170
132 iso_pr_bacteria 8018802046 8018805025 170
133 iso_pr_bacteria 8022725327 8022726978 170
134 iso_pr_bacteria 8022781829 8022783431 170
135 iso_pr_bacteria 8038268975 8038270863 170
136 iso_pr_bacteria 8043041867 8043042198 170
137 iso_pr_bacteria 8061039349 8061042398 170
138 iso_pr_bacteria 8061045771 8061047676 170
139 iso_pr_bacteria 8061100935 8061104963 170
140 iso_pr_bacteria 8064008355 8064010223 170
141 iso_pr_bacteria 8077780672 8077782151 170
142 iso_pr_bacteria 8082023105 8082026012 170
143 iso_pr_bacteria 8108568626 8108571208 170
144 iso_pr_bacteria 8108576847 8108577141 170
145 iso_pr_bacteria 8114537524 8114538119 170
146 iso_pr_bacteria 8114541043 8114541678 170
147 iso_pr_bacteria 8114544644 8114545099 170
148 iso_pr_bacteria 8114549044 8114549338 170
149 iso_pr_bacteria 8114555646 8114558228 170
150 2225789004 2227247454 2227689125 171
151 3300000062 IMNBL1DRAFT_c0000038 IMNBL1DRAFT_000003830 171
152 3300000062 IMNBL1DRAFT_c0026799 IMNBL1DRAFT_00267992 171
153 3300000062 IMNBL1DRAFT_c0034775 IMNBL1DRAFT_00347752 171
154 3300000062 IMNBL1DRAFT_c0058248 IMNBL1DRAFT_00582482 171
155 3300000333 HBC_ctgsDRAFT_1000122 HBC_ctgsDRAFT_100012214 171
156 3300000333 HBC_ctgsDRAFT_1048893 HBC_ctgsDRAFT_10488931 171
157 3300002501 JGI24703J35330_11563134 JGI24703J35330_115631342 171
158 3300002501 JGI24703J35330_11747613 JGI24703J35330_117476135 171
159 3300002932 CVPL010L_1000711 CVPL010L_10007114 171
160 3300003973 Ga0063521_1000516 Ga0063521_10005167 171
161 3300007129 Ga0102734_1000145 Ga0102734_100014510 171
162 3300009826 Ga0123355_10207381 Ga0123355_102073814 171
163 3300009826 Ga0123355_11231048 Ga0123355_112310481 171
164 3300010049 Ga0123356_11408360 Ga0123356_114083601 171
165 3300010167 Ga0123353_10019469 Ga0123353_100194698 171
166 3300010167 Ga0123353_10026587 Ga0123353_100265875 171
167 3300010167 Ga0123353_10061193 Ga0123353_100611935 171
168 3300010167 Ga0123353_10700972 Ga0123353_107009722 171
169 3300010167 Ga0123353_10878884 Ga0123353_108788842 171
170 3300010882 Ga0123354_10560571 Ga0123354_105605712 171
171 3300012805 Ga0160464_100506 Ga0160464_10050626 171
172 3300012809 Ga0160466_101373 Ga0160466_1013732 171
173 3300012812 Ga0160471_107834 Ga0160471_1078342 171
174 3300042600 Ga0466700_171056 Ga0466700_171056_426_941 171
175 3300042603 Ga0466714_118011 Ga0466714_118011_353_913 171
176 3300042656 Ga0466732_349506 Ga0466732_349506_510_1025 171
177 iso_pr_bacteria 2576861701 2579267734 171
178 iso_pr_bacteria 2731957677 2732687890 171
179 iso_pr_bacteria 2940354458 2940354942 171
180 3300000062 IMNBL1DRAFT_c0000064 IMNBL1DRAFT_000006468 172
181 3300005200 Ga0072940_1290108 Ga0072940_12901082 172
182 3300009826 Ga0123355_10515977 Ga0123355_105159772 172
183 3300009826 Ga0123355_10776602 Ga0123355_107766022 172
184 3300012834 Ga0160452_100277 Ga0160452_10027719 172
185 3300042593 Ga0466691_031800 Ga0466691_031800_5991_6509 172
186 3300042593 Ga0466691_205177 Ga0466691_205177_7400_7918 172
187 3300042598 Ga0466701_007980 Ga0466701_007980_21731_22249 172
188 3300042599 Ga0466706_090237 Ga0466706_090237_287_805 172
189 3300042599 Ga0466706_242298 Ga0466706_242298_1166_1684 172
190 3300042616 Ga0466715_357572 Ga0466715_357572_96068_96586 172
191 3300042635 Ga0466702_084551 Ga0466702_084551_116165_116683 172
192 3300042636 Ga0466703_256098 Ga0466703_256098_4187_4705 172
193 3300056564 Ga0530661_133097 Ga0530661_133097_39_557 172
194 3300056790 Ga0562379_0009 Ga0562379_0009_1136358_1136876 172
195 3300056790 Ga0562379_0011 Ga0562379_0011_69385_69903 172
196 3300056790 Ga0562379_0275 Ga0562379_0275_18685_19203 172
197 3300056790 Ga0562379_0792 Ga0562379_0792_7215_7733 172
198 3300056790 Ga0562379_0988 Ga0562379_0988_19738_20256 172
199 3300056790 Ga0562379_4066 Ga0562379_4066_3809_4327 172
200 3300056814 Ga0562378_0096 Ga0562378_0096_150918_151436 172
201 3300056856 Ga0562375_3099 Ga0562375_3099_10260_10778 172
202 3300056857 Ga0562376_0005 Ga0562376_0005_1986848_1987366 172
203 3300057007 Ga0562374_0082 Ga0562374_0082_241987_242505 172
204 iso_pr_bacteria 2558860143 2559001326 172
205 iso_pr_bacteria 2576861670 2579164826 172
206 iso_pr_bacteria 2590828839 2593252514 172
207 iso_pr_bacteria 2597490293 2598962806 172
208 iso_pr_bacteria 2675903377 2677723585 172
209 iso_pr_bacteria 2690315820 2691202543 172
210 iso_pr_bacteria 2718218475 2721608310 172
211 iso_pr_bacteria 2728369362 2730151184 172
212 iso_pr_bacteria 2740892557 2743951319 172
213 iso_pr_bacteria 2770939318 2771021079 172
214 iso_pr_bacteria 2820306284 2820307646 172
215 iso_pr_bacteria 2827179085 2827182738 172
216 iso_pr_bacteria 2864985977 2864986097 172
217 iso_pr_bacteria 2877522083 2877522667 172
218 iso_pr_bacteria 2881902429 2881903212 172
219 iso_pr_bacteria 2896843662 2896843813 172
220 iso_pr_bacteria 2905310146 2905311704 172
221 iso_pr_bacteria 2917496769 2917497416 172
222 iso_pr_bacteria 2923762712 2923763524 172
223 iso_pr_bacteria 2936628749 2936629144 172
224 iso_pr_bacteria 2937236879 2937239529 172
225 iso_pr_bacteria 2940221333 2940227603 172
226 iso_pr_bacteria 2940380068 2940384181 172
227 iso_pr_bacteria 2940386776 2940390929 172
228 iso_pr_bacteria 2940393498 2940398484 172
229 iso_pr_bacteria 2940400224 2940405233 172
230 iso_pr_bacteria 2940406939 2940411767 172
231 iso_pr_bacteria 2940413413 2940419281 172
232 iso_pr_bacteria 2940419646 2940425584 172
233 iso_pr_bacteria 2940425923 2940431814 172
234 iso_pr_bacteria 2957623355 2957624710 172
235 iso_pr_bacteria 2960772748 2960775167 172
236 iso_pr_bacteria 2964739456 2964740497 172
237 iso_pr_bacteria 2964749277 2964750348 172
238 iso_pr_bacteria 2964765680 2964766135 172
239 iso_pr_bacteria 2964775400 2964776015 172
240 iso_pr_bacteria 2964778705 2964779746 172
241 iso_pr_bacteria 2967802344 2967803790 172
242 iso_pr_bacteria 2967825073 2967826190 172
243 iso_pr_bacteria 2970199020 2970200372 172
244 iso_pr_bacteria 2970225615 2970226839 172
245 iso_pr_bacteria 2970254690 2970256508 172
246 iso_pr_bacteria 2977592972 2977594072 172
247 iso_pr_bacteria 2977596371 2977597396 172
248 iso_pr_bacteria 2977622177 2977623740 172
249 iso_pr_bacteria 2977628635 2977629464 172
250 iso_pr_bacteria 2977635137 2977636334 172
251 iso_pr_bacteria 2977653127 2977654246 172
252 iso_pr_bacteria 2997944163 2997945195 172
253 iso_pr_bacteria 8002304686 8002305820 172
254 iso_pr_bacteria 8012112996 8012113356 172
255 iso_pr_bacteria 8012942269 8012942291 172
256 iso_pr_bacteria 8017489919 8017491169 172
257 iso_pr_bacteria 8066790652 8066791104 172
258 iso_pr_bacteria 8066792404 8066792892 172
259 iso_pr_bacteria 8066794103 8066795233 172
260 iso_pr_bacteria 8066795793 8066795887 172
261 iso_pr_bacteria 8066797744 8066798239 172
262 iso_pr_bacteria 8066799369 8066799838 172
263 iso_pr_bacteria 8066802609 8066802685 172
264 iso_pr_bacteria 8112490586 8112491804 172
265 3300002508 JGI24700J35501_10930144 JGI24700J35501_1093014410 173
266 3300005083 Ga0068305_10065862 Ga0068305_100658625 173
267 3300042599 Ga0466706_154742 Ga0466706_154742_649_1170 173
268 3300042601 Ga0466707_274249 Ga0466707_274249_30470_30991 173
269 3300042601 Ga0466707_412451 Ga0466707_412451_1854_2375 173
270 3300042623 Ga0466734_105387 Ga0466734_105387_298_819 173
271 3300042624 Ga0466735_062691 Ga0466735_062691_477_998 173
272 3300042659 Ga0466733_070008 Ga0466733_070008_36782_37303 173
273 iso_pr_bacteria 2834951433 2834953246 173
274 iso_pr_bacteria 2852337885 2852338120 173
275 iso_pr_bacteria 2900804455 2900805179 173
276 iso_pr_bacteria 2940264388 2940265444 173
277 iso_pr_bacteria 2940267548 2940268604 173
278 iso_pr_bacteria 2940270707 2940271941 173
279 iso_pr_bacteria 2940273867 2940274930 173
280 2225789003 2227035924 2227396503 174
281 2225789004 2227330771 2227778223 174
282 3300002501 JGI24703J35330_11082659 JGI24703J35330_110826592 174
283 3300009826 Ga0123355_10242239 Ga0123355_102422392 174
284 3300042599 Ga0466706_009084 Ga0466706_009084_37_561 174
285 3300042599 Ga0466706_245779 Ga0466706_245779_478_1002 174
286 3300042599 Ga0466706_259031 Ga0466706_259031_998_1522 174
287 3300042601 Ga0466707_353762 Ga0466707_353762_2274_2798 174
288 3300042602 Ga0466713_053428 Ga0466713_053428_2689_3213 174
289 3300042602 Ga0466713_090642 Ga0466713_090642_45090_45614 174
290 3300042609 Ga0466722_067396 Ga0466722_067396_92_616 174
291 3300042616 Ga0466715_428250 Ga0466715_428250_4900_5424 174
292 3300042659 Ga0466733_073226 Ga0466733_073226_993_1517 174
293 3300056856 Ga0562375_2309 Ga0562375_2309_4623_5147 174
294 iso_pr_bacteria 2873584433 2873585461 174
295 iso_pr_bacteria 2940230426 2940230970 174
296 iso_pr_bacteria 2940233634 2940234175 174
297 iso_pr_bacteria 2940277027 2940279502 174
298 iso_pr_bacteria 2940280053 2940282832 174
299 iso_pr_bacteria 2940283334 2940284229 174
300 iso_pr_bacteria 2940289514 2940291896 174
301 iso_pr_bacteria 2940292506 2940294920 174
302 iso_pr_bacteria 2940295490 2940297894 174
303 iso_pr_bacteria 2944625312 2944627873 174
304 3300000062 IMNBL1DRAFT_c0000007 IMNBL1DRAFT_000000793 175
305 3300000062 IMNBL1DRAFT_c0000020 IMNBL1DRAFT_0000020104 175
306 3300000062 IMNBL1DRAFT_c0027052 IMNBL1DRAFT_00270523 175
307 3300000062 IMNBL1DRAFT_c0061707 IMNBL1DRAFT_00617071 175
308 3300000089 AustNasuHG_c1008064 AustNasuHG_10080642 175
309 3300002501 JGI24703J35330_11747864 JGI24703J35330_117478643 175
310 3300009784 Ga0123357_10070416 Ga0123357_100704164 175
311 3300009784 Ga0123357_10124412 Ga0123357_101244122 175
312 3300042599 Ga0466706_182763 Ga0466706_182763_8140_8667 175
313 3300042601 Ga0466707_348719 Ga0466707_348719_634_1161 175
314 3300042606 Ga0466719_369831 Ga0466719_369831_333_860 175
315 3300042619 Ga0466726_099829 Ga0466726_099829_92288_92815 175
316 iso_pr_bacteria 2645727721 2646684502 175
317 iso_pr_bacteria 2684622911 2686073845 175
318 iso_pr_bacteria 2684622912 2686075557 175
319 iso_pr_bacteria 2684622913 2686077415 175
320 iso_pr_bacteria 2684622914 2686079272 175
321 iso_pr_bacteria 2758568501 2760245432 175
322 iso_pr_bacteria 2758568502 2760247052 175
323 iso_pr_bacteria 2758568503 2760248714 175
324 iso_pr_bacteria 2758568504 2760250376 175
325 iso_pr_bacteria 2758568505 2760252012 175
326 iso_pr_bacteria 2758568506 2760253748 175
327 iso_pr_bacteria 2758568507 2760255286 175
328 iso_pr_bacteria 2758568508 2760256985 175
329 iso_pr_bacteria 2758568509 2760258685 175
330 iso_pr_bacteria 2758568510 2760260452 175
331 iso_pr_bacteria 2758568511 2760262193 175
332 iso_pr_bacteria 2758568512 2760263950 175
333 iso_pr_bacteria 2758568513 2760265787 175
334 iso_pr_bacteria 2758568514 2760267790 175
335 iso_pr_bacteria 2758568515 2760269627 175
336 iso_pr_bacteria 2758568558 2760424693 175
337 iso_pr_bacteria 2785510748 2785747390 175
338 iso_pr_bacteria 2799112220 2799191581 175
339 iso_pr_bacteria 2799112229 2799230481 175
340 iso_pr_bacteria 2799112230 2799231660 175
341 iso_pr_bacteria 2814123166 2815022506 175
342 iso_pr_bacteria 2851410423 2851411451 175
343 iso_pr_bacteria 2873632256 2873633522 175
344 iso_pr_bacteria 2877513988 2877515107 175
345 iso_pr_bacteria 2882334426 2882334684 175
346 iso_pr_bacteria 2902668162 2902669253 175
347 iso_pr_bacteria 2912324399 2912325301 175
348 iso_pr_bacteria 2958885890 2958886752 175
349 iso_pr_bacteria 2961465228 2961466153 175
350 iso_pr_bacteria 2961515617 2961516595 175
351 iso_pr_bacteria 2968368220 2968368370 175
352 iso_pr_bacteria 2971062614 2971063219 175
353 iso_pr_bacteria 2979949929 2979950939 175
354 iso_pr_bacteria 3004719924 3004720218 175
355 iso_pr_bacteria 8004832522 8004833378 175
356 iso_pr_bacteria 8017440191 8017440560 175
357 iso_pr_bacteria 8017458139 8017459618 175
358 iso_pr_bacteria 8017462664 8017463850 175
359 iso_pr_bacteria 8017536074 8017537257 175
360 3300000333 HBC_ctgsDRAFT_1005941 HBC_ctgsDRAFT_10059411 176
361 3300000333 HBC_ctgsDRAFT_1046711 HBC_ctgsDRAFT_10467112 176
362 3300005721 Ga0074278_102193 Ga0074278_1021935 176
363 3300005721 Ga0074278_105617 Ga0074278_1056171 176
364 3300005721 Ga0074278_131433 Ga0074278_1314332 176
365 3300012848 Ga0160443_102554 Ga0160443_1025544 176
366 3300012847 Ga0160445_102567 Ga0160445_1025673 177
367 3300042602 Ga0466713_052392 Ga0466713_052392_25247_25780 177
368 3300042616 Ga0466715_006667 Ga0466715_006667_4935_5471 178
369 3300056790 Ga0562379_0078 Ga0562379_0078_265415_265954 179
370 3300056790 Ga0562379_0393 Ga0562379_0393_83498_84037 179
371 3300056790 Ga0562379_0397 Ga0562379_0397_14561_15100 179
372 3300057007 Ga0562374_0034 Ga0562374_0034_472997_473539 180
373 3300056790 Ga0562379_0044 Ga0562379_0044_510226_510771 181
374 3300056814 Ga0562378_1859 Ga0562378_1859_10495_11040 181
375 3300042622 Ga0466731_048861 Ga0466731_048861_330_878 182
376 3300042624 Ga0466735_011974 Ga0466735_011974_313_861 182
377 3300056564 Ga0530661_000001 Ga0530661_000001_137619_138167 182
378 3300042648 Ga0466709_233970 Ga0466709_233970_244287_244844 185
379 iso_pr_bacteria 2820236043 2820238082 185
380 iso_pr_bacteria 2850695442 2850695558 185
381 3300000333 HBC_ctgsDRAFT_1007123 HBC_ctgsDRAFT_10071232 186
382 3300042620 Ga0466728_392215 Ga0466728_392215_9329_9889 186
383 3300042648 Ga0466709_147924 Ga0466709_147924_32715_33281 188
384 3300042601 Ga0466707_149263 Ga0466707_149263_1482_2054 190
385 3300012829 Ga0160467_100118 Ga0160467_10011897 200
386 3300005200 Ga0072940_1019576 Ga0072940_10195762 203
387 3300000062 IMNBL1DRAFT_c0045679 IMNBL1DRAFT_00456792 208

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00156 Pribosyltran Phosphoribosyl transferase domain 60 194 0.81

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.