Protein Family IF00251
Metagenome
Metatranscriptome
Isolate
132
Members
48
Samples
127
Scaffolds
52.63
Avg Length
Representative Sequence
- ID
- 3300000062|IMNBL1DRAFT_c0038442|IMNBL1DRAFT_00384422
- Length
- 55 aa
- Sequence
- MAKKAVATFSGGKGSSKNSVKCIRLVRSERSGAYAFKEEIVPTEQTKEFFADKK*
Sample Types
Isolate
3.8%
Metagenome
95.5%
MAG
0.0%
Metatranscriptome
0.8%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.3%
Kalotermitidae
30.4%
Unclassified
15.2%
Termopsidae
6.5%
Passalidae
4.3%
Rhinotermitidae
2.2%
Taxonomy
Archaea
0
Bacteria
115
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 2 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 3 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 4 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 5 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 6 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 7 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 8 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 9 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 10 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 11 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 12 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 13 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 14 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 15 | 2820750388 | Unclassified Bacteroidetes Nt197P3bin50 | Isolate | Unclassified |
| 16 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 17 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 18 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 19 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 20 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 21 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 22 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 23 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 24 | 2820767225 | Unclassified Bacteroidetes Lab288P3bin34 | Isolate | Unclassified |
| 25 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 26 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 27 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 28 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 29 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 30 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 31 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 32 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 33 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 34 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 35 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 36 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 37 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 38 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 39 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 40 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 41 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 42 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 43 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 44 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 45 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 46 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 47 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 48 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10582768 | 3300010049 | Bacteria | 1282 |
| 2 | Ga0123356_12880384 | 3300010049 | Bacteria | 602 |
| 3 | Ga0123353_10298053 | 3300010167 | Unclassified | 2463 |
| 4 | Ga0123353_13004219 | 3300010167 | Bacteria | 546 |
| 5 | Ga0123354_10386217 | 3300010882 | Bacteria | 1202 |
| 6 | Ga0123354_10728500 | 3300010882 | Unclassified | 685 |
| 7 | Ga0466714_019305 | 3300042603 | Bacteria | 1189 |
| 8 | Ga0466697_004363 | 3300042611 | Bacteria | 1315 |
| 9 | JGI24705J35276_12234799 | 3300002504 | Bacteria | 5861 |
| 10 | Ga0072941_1092253 | 3300005201 | Bacteria | 652 |
| 11 | Ga0466705_038837 | 3300042612 | Unclassified | 4461 |
| 12 | Ga0466732_229606 | 3300042656 | Bacteria | 1548 |
| 13 | Ga0466710_372661 | 3300042613 | Bacteria | 1392 |
| 14 | Ga0466710_401791 | 3300042613 | Bacteria | 3877 |
| 15 | Ga0466726_012461 | 3300042619 | Bacteria | 1414 |
| 16 | Ga0466726_261180 | 3300042619 | Bacteria | 1113 |
| 17 | Ga0123356_10294550 | 3300010049 | Bacteria | 1725 |
| 18 | Ga0123356_10337166 | 3300010049 | Bacteria | 1627 |
| 19 | Ga0123353_10126978 | 3300010167 | Bacteria | 4098 |
| 20 | Ga0123353_11517665 | 3300010167 | Bacteria | 852 |
| 21 | Ga0264413_163395 | 3300024493 | Bacteria | 1485 |
| 22 | Ga0466691_208098 | 3300042593 | Bacteria | 38396 |
| 23 | Ga0466719_375393 | 3300042606 | Bacteria | 3453 |
| 24 | JGI24696J40584_12754136 | 3300002834 | Bacteria | 798 |
| 25 | Ga0466735_111693 | 3300042624 | Bacteria | 5084 |
| 26 | Ga0466735_176125 | 3300042624 | Bacteria | 5525 |
| 27 | Ga0466709_065267 | 3300042648 | Unclassified | 3221 |
| 28 | Ga0466709_109549 | 3300042648 | Bacteria | 2364 |
| 29 | Ga0123356_10064245 | 3300010049 | Bacteria | 3431 |
| 30 | Ga0123353_10695624 | 3300010167 | Bacteria | 1428 |
| 31 | Ga0123353_12647787 | 3300010167 | Bacteria | 592 |
| 32 | Ga0123354_10347137 | 3300010882 | Unclassified | 1329 |
| 33 | Ga0123354_10563234 | 3300010882 | Unclassified | 853 |
| 34 | Ga0466690_017104 | 3300042590 | Bacteria | 4538 |
| 35 | Ga0466690_122253 | 3300042590 | Bacteria | 7359 |
| 36 | Ga0466690_241301 | 3300042590 | Bacteria | 5092 |
| 37 | Ga0466690_332558 | 3300042590 | Bacteria | 2177 |
| 38 | Ga0466701_000971 | 3300042598 | Unclassified | 1186 |
| 39 | Ga0466713_121457 | 3300042602 | Bacteria | 6959 |
| 40 | JGI24702J35022_10079067 | 3300002462 | Bacteria | 1780 |
| 41 | JGI24705J35276_12234366 | 3300002504 | Bacteria | 5456 |
| 42 | Ga0466733_011984 | 3300042659 | Bacteria | 4044 |
| 43 | Ga0466726_464593 | 3300042619 | Bacteria | 2255 |
| 44 | Ga0466728_335642 | 3300042620 | Bacteria | 20808 |
| 45 | Ga0466708_383240 | 3300042652 | Bacteria | 29214 |
| 46 | Ga0123356_10420613 | 3300010049 | Bacteria | 1478 |
| 47 | Ga0123356_10598939 | 3300010049 | Bacteria | 1267 |
| 48 | Ga0123356_11555851 | 3300010049 | Bacteria | 817 |
| 49 | Ga0123353_10149945 | 3300010167 | Bacteria | 3724 |
| 50 | Ga0123353_11119520 | 3300010167 | Bacteria | 1043 |
| 51 | Ga0466690_198735 | 3300042590 | Bacteria | 14984 |
| 52 | Ga0466690_221347 | 3300042590 | Unclassified | 4087 |
| 53 | Ga0466696_061866 | 3300042596 | Bacteria | 2705 |
| 54 | Ga0466699_174139 | 3300042597 | Bacteria | 1356 |
| 55 | Ga0466700_022334 | 3300042600 | Bacteria | 1003 |
| 56 | JGI24702J35022_10057192 | 3300002462 | Bacteria | 2082 |
| 57 | JGI24702J35022_10471046 | 3300002462 | Bacteria | 767 |
| 58 | Ga0466710_094179 | 3300042613 | Bacteria | 1028 |
| 59 | Ga0466723_175762 | 3300042618 | Unclassified | 1970 |
| 60 | Ga0466727_042687 | 3300042655 | Bacteria | 90775 |
| 61 | Ga0255786_1026738 | 3300022815 | Bacteria | 988 |
| 62 | Ga0466657_226542 | 3300042582 | Bacteria | 2021 |
| 63 | Ga0466696_072345 | 3300042596 | Bacteria | 8834 |
| 64 | Ga0466696_191423 | 3300042596 | Bacteria | 3187 |
| 65 | Ga0466697_032676 | 3300042611 | Bacteria | 1838 |
| 66 | JGI24705J35276_11949635 | 3300002504 | Bacteria | 794 |
| 67 | JGI24705J35276_12213700 | 3300002504 | Bacteria | 1934 |
| 68 | JGI24696J40584_12529272 | 3300002834 | Bacteria | 614 |
| 69 | Ga0466726_300616 | 3300042619 | Bacteria | 2863 |
| 70 | Ga0466729_285140 | 3300042621 | Bacteria | 9746 |
| 71 | Ga0466709_133520 | 3300042648 | Bacteria | 2901 |
| 72 | Ga0123355_10843099 | 3300009826 | Bacteria | 1011 |
| 73 | Ga0123356_10106498 | 3300010049 | Bacteria | 2700 |
| 74 | Ga0123356_10905857 | 3300010049 | Unclassified | 1053 |
| 75 | Ga0123356_12840425 | 3300010049 | Bacteria | 606 |
| 76 | Ga0123353_11513827 | 3300010167 | Bacteria | 854 |
| 77 | Ga0466696_088250 | 3300042596 | Bacteria | 14183 |
| 78 | Ga0466719_353451 | 3300042606 | Bacteria | 5925 |
| 79 | Ga0466719_372678 | 3300042606 | Bacteria | 2620 |
| 80 | 2227480167 | 2225789004 | Bacteria | 99470 |
| 81 | JGI24702J35022_10000328 | 3300002462 | Bacteria | 28022 |
| 82 | JGI24702J35022_10090557 | 3300002462 | Bacteria | 1664 |
| 83 | JGI24705J35276_12103069 | 3300002504 | Unclassified | 1023 |
| 84 | JGI24705J35276_12236276 | 3300002504 | Bacteria | 7763 |
| 85 | JGI24696J40584_12949954 | 3300002834 | Bacteria | 2112 |
| 86 | Ga0466733_084780 | 3300042659 | Bacteria | 1103 |
| 87 | Ga0466723_128705 | 3300042618 | Bacteria | 25504 |
| 88 | Ga0466728_322605 | 3300042620 | Bacteria | 2834 |
| 89 | Ga0466708_258399 | 3300042652 | Bacteria | 7324 |
| 90 | Ga0123356_10249996 | 3300010049 | Unclassified | 1850 |
| 91 | Ga0123356_11128778 | 3300010049 | Bacteria | 952 |
| 92 | Ga0123356_12341208 | 3300010049 | Bacteria | 668 |
| 93 | Ga0123353_10205431 | 3300010167 | Bacteria | 3095 |
| 94 | Ga0123353_10956724 | 3300010167 | Bacteria | 1157 |
| 95 | Ga0123353_12436066 | 3300010167 | Bacteria | 625 |
| 96 | Ga0123354_10183473 | 3300010882 | Bacteria | 2377 |
| 97 | Ga0466690_396240 | 3300042590 | Bacteria | 1955 |
| 98 | Ga0466691_074082 | 3300042593 | Bacteria | 3728 |
| 99 | Ga0466700_423059 | 3300042600 | Bacteria | 1841 |
| 100 | Ga0466717_072467 | 3300042604 | Unclassified | 3248 |
| 101 | Ga0466716_089156 | 3300042605 | Bacteria | 20040 |
| 102 | IMNBL1DRAFT_c0038442 | 3300000062 | Bacteria | 1645 |
| 103 | Ga0466732_370398 | 3300042656 | Bacteria | 1381 |
| 104 | Ga0466712_057665 | 3300042614 | Bacteria | 1294 |
| 105 | Ga0466711_216976 | 3300042615 | Bacteria | 6568 |
| 106 | Ga0466715_224612 | 3300042616 | Bacteria | 7778 |
| 107 | Ga0466728_044907 | 3300042620 | Bacteria | 6450 |
| 108 | Ga0466735_124177 | 3300042624 | Bacteria | 1740 |
| 109 | Ga0466703_267412 | 3300042636 | Bacteria | 5394 |
| 110 | Ga0466704_032351 | 3300042643 | Unclassified | 6082 |
| 111 | Ga0466704_303528 | 3300042643 | Bacteria | 35303 |
| 112 | Ga0466727_025681 | 3300042655 | Bacteria | 6557 |
| 113 | Ga0123356_10907737 | 3300010049 | Unclassified | 1052 |
| 114 | Ga0123356_11571414 | 3300010049 | Bacteria | 813 |
| 115 | Ga0123356_12354728 | 3300010049 | Unclassified | 666 |
| 116 | Ga0123356_12675682 | 3300010049 | Bacteria | 625 |
| 117 | Ga0123353_10079098 | 3300010167 | Bacteria | 5286 |
| 118 | Ga0123353_10182844 | 3300010167 | Bacteria | 3317 |
| 119 | Ga0123353_10755901 | 3300010167 | Bacteria | 1352 |
| 120 | Ga0466696_294131 | 3300042596 | Bacteria | 14401 |
| 121 | Ga0466707_043994 | 3300042601 | Bacteria | 1926 |
| 122 | Ga0466716_103748 | 3300042605 | Bacteria | 1317 |
| 123 | Ga0466733_034360 | 3300042659 | Bacteria | 1285 |
| 124 | Ga0466715_008372 | 3300042616 | Bacteria | 4446 |
| 125 | Ga0466715_018721 | 3300042616 | Bacteria | 59480 |
| 126 | Ga0466715_087509 | 3300042616 | Bacteria | 4947 |
| 127 | Ga0466709_354699 | 3300042648 | Unclassified | 1800 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042602 | Ga0466713_121457 | Ga0466713_121457_4142_4294 | 50 |
| 2 | 3300042603 | Ga0466714_019305 | Ga0466714_019305_966_1118 | 50 |
| 3 | iso_pr_bacteria | 2820750388 | 2820750845 | 50 |
| 4 | 3300002462 | JGI24702J35022_10090557 | JGI24702J35022_100905572 | 51 |
| 5 | 3300002462 | JGI24702J35022_10471046 | JGI24702J35022_104710463 | 51 |
| 6 | 3300002834 | JGI24696J40584_12754136 | JGI24696J40584_127541362 | 51 |
| 7 | 3300010049 | Ga0123356_10337166 | Ga0123356_103371662 | 51 |
| 8 | 3300042590 | Ga0466690_198735 | Ga0466690_198735_10264_10419 | 51 |
| 9 | 3300042600 | Ga0466700_022334 | Ga0466700_022334_27_182 | 51 |
| 10 | 3300042606 | Ga0466719_372678 | Ga0466719_372678_598_753 | 51 |
| 11 | 3300042616 | Ga0466715_224612 | Ga0466715_224612_4665_4820 | 51 |
| 12 | 3300042624 | Ga0466735_111693 | Ga0466735_111693_3441_3596 | 51 |
| 13 | 3300002504 | JGI24705J35276_12213700 | JGI24705J35276_122137002 | 52 |
| 14 | 3300002504 | JGI24705J35276_12234799 | JGI24705J35276_122347991 | 52 |
| 15 | 3300002504 | JGI24705J35276_12236276 | JGI24705J35276_122362767 | 52 |
| 16 | 3300002834 | JGI24696J40584_12529272 | JGI24696J40584_125292722 | 52 |
| 17 | 3300002834 | JGI24696J40584_12949954 | JGI24696J40584_129499545 | 52 |
| 18 | 3300009826 | Ga0123355_10843099 | Ga0123355_108430992 | 52 |
| 19 | 3300010049 | Ga0123356_10249996 | Ga0123356_102499962 | 52 |
| 20 | 3300010049 | Ga0123356_10294550 | Ga0123356_102945502 | 52 |
| 21 | 3300010049 | Ga0123356_10582768 | Ga0123356_105827682 | 52 |
| 22 | 3300010049 | Ga0123356_10905857 | Ga0123356_109058571 | 52 |
| 23 | 3300010049 | Ga0123356_10907737 | Ga0123356_109077372 | 52 |
| 24 | 3300010049 | Ga0123356_11128778 | Ga0123356_111287781 | 52 |
| 25 | 3300010049 | Ga0123356_11555851 | Ga0123356_115558512 | 52 |
| 26 | 3300010049 | Ga0123356_12341208 | Ga0123356_123412081 | 52 |
| 27 | 3300010049 | Ga0123356_12354728 | Ga0123356_123547282 | 52 |
| 28 | 3300010049 | Ga0123356_12675682 | Ga0123356_126756821 | 52 |
| 29 | 3300010049 | Ga0123356_12880384 | Ga0123356_128803842 | 52 |
| 30 | 3300010167 | Ga0123353_10079098 | Ga0123353_100790983 | 52 |
| 31 | 3300010167 | Ga0123353_10205431 | Ga0123353_102054312 | 52 |
| 32 | 3300010167 | Ga0123353_10298053 | Ga0123353_102980532 | 52 |
| 33 | 3300010167 | Ga0123353_10695624 | Ga0123353_106956243 | 52 |
| 34 | 3300010167 | Ga0123353_10755901 | Ga0123353_107559012 | 52 |
| 35 | 3300010167 | Ga0123353_10956724 | Ga0123353_109567243 | 52 |
| 36 | 3300010167 | Ga0123353_11513827 | Ga0123353_115138272 | 52 |
| 37 | 3300010167 | Ga0123353_11517665 | Ga0123353_115176652 | 52 |
| 38 | 3300010167 | Ga0123353_12436066 | Ga0123353_124360662 | 52 |
| 39 | 3300010167 | Ga0123353_12647787 | Ga0123353_126477872 | 52 |
| 40 | 3300010882 | Ga0123354_10183473 | Ga0123354_101834731 | 52 |
| 41 | 3300010882 | Ga0123354_10386217 | Ga0123354_103862172 | 52 |
| 42 | 3300010882 | Ga0123354_10728500 | Ga0123354_107285001 | 52 |
| 43 | 3300042582 | Ga0466657_226542 | Ga0466657_226542_1641_1799 | 52 |
| 44 | 3300042590 | Ga0466690_221347 | Ga0466690_221347_3005_3163 | 52 |
| 45 | 3300042596 | Ga0466696_072345 | Ga0466696_072345_5822_5980 | 52 |
| 46 | 3300042600 | Ga0466700_423059 | Ga0466700_423059_1207_1365 | 52 |
| 47 | 3300042601 | Ga0466707_043994 | Ga0466707_043994_133_291 | 52 |
| 48 | 3300042604 | Ga0466717_072467 | Ga0466717_072467_2197_2355 | 52 |
| 49 | 3300042611 | Ga0466697_004363 | Ga0466697_004363_128_286 | 52 |
| 50 | 3300042611 | Ga0466697_032676 | Ga0466697_032676_157_315 | 52 |
| 51 | 3300042613 | Ga0466710_094179 | Ga0466710_094179_14_172 | 52 |
| 52 | 3300042613 | Ga0466710_372661 | Ga0466710_372661_860_1018 | 52 |
| 53 | 3300042613 | Ga0466710_401791 | Ga0466710_401791_528_686 | 52 |
| 54 | 3300042615 | Ga0466711_216976 | Ga0466711_216976_4683_4841 | 52 |
| 55 | 3300042616 | Ga0466715_008372 | Ga0466715_008372_423_581 | 52 |
| 56 | 3300042616 | Ga0466715_018721 | Ga0466715_018721_39954_40112 | 52 |
| 57 | 3300042619 | Ga0466726_464593 | Ga0466726_464593_266_424 | 52 |
| 58 | 3300042620 | Ga0466728_322605 | Ga0466728_322605_1821_1979 | 52 |
| 59 | 3300042621 | Ga0466729_285140 | Ga0466729_285140_1831_1989 | 52 |
| 60 | 3300042624 | Ga0466735_176125 | Ga0466735_176125_5319_5477 | 52 |
| 61 | 3300042643 | Ga0466704_032351 | Ga0466704_032351_4039_4197 | 52 |
| 62 | 3300042648 | Ga0466709_065267 | Ga0466709_065267_1465_1623 | 52 |
| 63 | 3300042648 | Ga0466709_109549 | Ga0466709_109549_538_696 | 52 |
| 64 | 3300042648 | Ga0466709_133520 | Ga0466709_133520_1465_1623 | 52 |
| 65 | 3300042652 | Ga0466708_383240 | Ga0466708_383240_3723_3881 | 52 |
| 66 | 3300042655 | Ga0466727_042687 | Ga0466727_042687_47701_47859 | 52 |
| 67 | 3300042656 | Ga0466732_229606 | Ga0466732_229606_34_192 | 52 |
| 68 | 3300042656 | Ga0466732_370398 | Ga0466732_370398_891_1049 | 52 |
| 69 | 3300042659 | Ga0466733_011984 | Ga0466733_011984_2804_2962 | 52 |
| 70 | 3300042659 | Ga0466733_034360 | Ga0466733_034360_672_830 | 52 |
| 71 | 3300002462 | JGI24702J35022_10000328 | JGI24702J35022_1000032814 | 53 |
| 72 | 3300002462 | JGI24702J35022_10079067 | JGI24702J35022_100790674 | 53 |
| 73 | 3300002504 | JGI24705J35276_11949635 | JGI24705J35276_119496353 | 53 |
| 74 | 3300002504 | JGI24705J35276_12103069 | JGI24705J35276_121030691 | 53 |
| 75 | 3300010049 | Ga0123356_10064245 | Ga0123356_100642454 | 53 |
| 76 | 3300010049 | Ga0123356_10106498 | Ga0123356_101064984 | 53 |
| 77 | 3300010049 | Ga0123356_10420613 | Ga0123356_104206132 | 53 |
| 78 | 3300010167 | Ga0123353_10126978 | Ga0123353_101269782 | 53 |
| 79 | 3300010167 | Ga0123353_10182844 | Ga0123353_101828442 | 53 |
| 80 | 3300010167 | Ga0123353_11119520 | Ga0123353_111195202 | 53 |
| 81 | 3300010167 | Ga0123353_13004219 | Ga0123353_130042192 | 53 |
| 82 | 3300010882 | Ga0123354_10347137 | Ga0123354_103471372 | 53 |
| 83 | 3300022815 | Ga0255786_1026738 | Ga0255786_10267383 | 53 |
| 84 | 3300024493 | Ga0264413_163395 | Ga0264413_1633952 | 53 |
| 85 | 3300042590 | Ga0466690_017104 | Ga0466690_017104_2261_2422 | 53 |
| 86 | 3300042590 | Ga0466690_241301 | Ga0466690_241301_2127_2288 | 53 |
| 87 | 3300042590 | Ga0466690_332558 | Ga0466690_332558_774_935 | 53 |
| 88 | 3300042593 | Ga0466691_208098 | Ga0466691_208098_24583_24744 | 53 |
| 89 | 3300042596 | Ga0466696_061866 | Ga0466696_061866_1777_1938 | 53 |
| 90 | 3300042596 | Ga0466696_191423 | Ga0466696_191423_1752_1913 | 53 |
| 91 | 3300042597 | Ga0466699_174139 | Ga0466699_174139_495_656 | 53 |
| 92 | 3300042598 | Ga0466701_000971 | Ga0466701_000971_646_807 | 53 |
| 93 | 3300042605 | Ga0466716_089156 | Ga0466716_089156_11525_11686 | 53 |
| 94 | 3300042606 | Ga0466719_353451 | Ga0466719_353451_4999_5160 | 53 |
| 95 | 3300042606 | Ga0466719_375393 | Ga0466719_375393_1735_1896 | 53 |
| 96 | 3300042612 | Ga0466705_038837 | Ga0466705_038837_3254_3415 | 53 |
| 97 | 3300042614 | Ga0466712_057665 | Ga0466712_057665_454_615 | 53 |
| 98 | 3300042619 | Ga0466726_012461 | Ga0466726_012461_708_869 | 53 |
| 99 | 3300042619 | Ga0466726_300616 | Ga0466726_300616_463_624 | 53 |
| 100 | 3300042620 | Ga0466728_335642 | Ga0466728_335642_1192_1353 | 53 |
| 101 | 3300042643 | Ga0466704_303528 | Ga0466704_303528_27439_27600 | 53 |
| 102 | 3300042648 | Ga0466709_354699 | Ga0466709_354699_1514_1675 | 53 |
| 103 | 3300042655 | Ga0466727_025681 | Ga0466727_025681_6236_6397 | 53 |
| 104 | 3300042659 | Ga0466733_084780 | Ga0466733_084780_215_376 | 53 |
| 105 | iso_pr_bacteria | 2820740053 | 2820741110 | 53 |
| 106 | iso_pr_bacteria | 2820748953 | 2820749439 | 53 |
| 107 | iso_pr_bacteria | 2820767225 | 2820768422 | 53 |
| 108 | iso_pr_bacteria | 2820772500 | 2820773783 | 53 |
| 109 | 2225789004 | 2227480167 | 2227937589 | 54 |
| 110 | 3300002462 | JGI24702J35022_10057192 | JGI24702J35022_100571922 | 54 |
| 111 | 3300002504 | JGI24705J35276_12234366 | JGI24705J35276_122343668 | 54 |
| 112 | 3300010049 | Ga0123356_10598939 | Ga0123356_105989393 | 54 |
| 113 | 3300010049 | Ga0123356_11571414 | Ga0123356_115714142 | 54 |
| 114 | 3300010167 | Ga0123353_10149945 | Ga0123353_101499453 | 54 |
| 115 | 3300010882 | Ga0123354_10563234 | Ga0123354_105632341 | 54 |
| 116 | 3300042590 | Ga0466690_122253 | Ga0466690_122253_2439_2603 | 54 |
| 117 | 3300042590 | Ga0466690_396240 | Ga0466690_396240_1723_1887 | 54 |
| 118 | 3300042593 | Ga0466691_074082 | Ga0466691_074082_2460_2624 | 54 |
| 119 | 3300042596 | Ga0466696_088250 | Ga0466696_088250_9519_9683 | 54 |
| 120 | 3300042596 | Ga0466696_294131 | Ga0466696_294131_4576_4740 | 54 |
| 121 | 3300042605 | Ga0466716_103748 | Ga0466716_103748_1090_1254 | 54 |
| 122 | 3300042616 | Ga0466715_087509 | Ga0466715_087509_3782_3946 | 54 |
| 123 | 3300042618 | Ga0466723_128705 | Ga0466723_128705_9365_9529 | 54 |
| 124 | 3300042618 | Ga0466723_175762 | Ga0466723_175762_497_661 | 54 |
| 125 | 3300042619 | Ga0466726_261180 | Ga0466726_261180_864_1028 | 54 |
| 126 | 3300042620 | Ga0466728_044907 | Ga0466728_044907_4718_4882 | 54 |
| 127 | 3300042624 | Ga0466735_124177 | Ga0466735_124177_539_703 | 54 |
| 128 | 3300042636 | Ga0466703_267412 | Ga0466703_267412_1418_1582 | 54 |
| 129 | 3300042652 | Ga0466708_258399 | Ga0466708_258399_1314_1478 | 54 |
| 130 | 3300000062 | IMNBL1DRAFT_c0038442 | IMNBL1DRAFT_00384422 | 55 |
| 131 | 3300005201 | Ga0072941_1092253 | Ga0072941_10922533 | 55 |
| 132 | 3300010049 | Ga0123356_12840425 | Ga0123356_128404252 | 64 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF14128 | DUF4295 | Domain of unknown function (DUF4295) | 2 | 50 | 0.98 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.49 | 0.84 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.