Protein Family IF00243

Metagenome Isolate
253 Members
177 Samples
146 Scaffolds
382.96 Avg Length

🧬 Representative Sequence

ID
3300000062|IMNBL1DRAFT_c0009316|IMNBL1DRAFT_00093164
Length
451 aa
Sequence
MKIAVGLSGGVDSSVAALLLKEAGHDVIALFMQNWHDTTGTLYGDCPWEEDRAVAELVAKKLGIPFYFVDLSATYSQRVVDYMFEEYSRGRTPNPDVMCNREIKFEAFMKHALELGAEMVATGHYCRKEVVVGTDGREIYRILAGVDPGKDQSYFLCQLNQEQLSKALFPIGGLVKSEVRELAAKGGLPTANKKDSQGICFVGKVDLPVFLQQKLAVREGDVVEVFEEFYENHPMVHYVVTGYPEQSLGIKGETGRKSEMESELDAKVSRDSLGTDSCDNTNSYYGMDDGGYEKGDINDFLKNSSQPYKYSCESGRIVGKHRGAHFYTIGQRKGLNIGGHIEPLFIISLDIENNIIYVGEGEMHPGLYRKSLFINCADIHWIRRDLKMEQRETRDYLVRIRYRQPLQKARLFMRDEGLYIVFEEPQRGITPGQFAAWYDGEEMLGSGDIQ*

πŸ“Š Sample Types

Isolate 42.3%
Metagenome 57.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 19.5%
Elmidae 11.8%
Termitidae 11.2%
Kalotermitidae 7.1%
Formicidae 5.9%
Drosophilidae 5.3%
Culicidae 4.7%
Blattidae 3.6%
Apidae 3.0%
Tenebrionidae 3.0%
Cicadellidae 3.0%
Scarabaeidae 2.4%
Curculionidae 2.4%
Termopsidae 1.8%
Pediculidae 1.2%
Rhinotermitidae 1.2%
Cambaridae 1.2%
Armadillidiidae 1.2%
Passalidae 1.2%
Ixodidae 1.2%
Nephropidae 0.6%
Stratiomyidae 0.6%
Hodotermitidae 0.6%
Daphniidae 0.6%
Trigoniulidae 0.6%
Porcellionidae 0.6%
Noctuidae 0.6%
Cryptocercidae 0.6%
Blaberidae 0.6%
Penaeidae 0.6%
Cixiidae 0.6%
Euphausiidae 0.6%
Lamproblattidae 0.6%
Corydiidae 0.6%

🌳 Taxonomy

Archaea 0
Bacteria 237
Eukaryota 0
Viruses 0
Unclassified 16

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2841821538 Psychrobacter sp. YP14 Isolate Unclassified
2 2864843793 Acinetobacter johnsonii S00075 Isolate Elmidae
3 2864903489 Pseudomonas aeuginosa S00161 Isolate Elmidae
4 2864948220 Elizabethkingia anophelis S00205 Isolate Elmidae
5 2878857142 Lactococcus lactis DmW198 Isolate Drosophilidae
6 2731957677 Alkalihalobacillus trypoxylicola NBRC 102646 Isolate Scarabaeidae
7 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
8 2785510743 Apibacter sp. ESL0404 Isolate Apidae
9 2820518089 Unclassified Firmicutes Lab288P1bin27 Isolate Unclassified
10 2820741847 Unclassified Bacteroidetes Th196P3bin71 Isolate Unclassified
11 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
12 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
13 641522603 Acinetobacter baumannii SDF Isolate Pediculidae
14 8018750880 Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 Isolate
15 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
16 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
17 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
18 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
19 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
20 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
21 8114076984 Elizabethkingia anophelis R26 Isolate Culicidae
22 2852123468 Lysinibacillus sphaericus KCCM 35418 Isolate Unclassified
23 2864788197 Elizabethkingia anophelis S00027 Isolate Elmidae
24 2864822740 Chryseobacterium shigense S00064 Isolate Elmidae
25 2940218408 Enterococcus sp. PF1-24 Isolate Blattidae
26 2820416776 Unclassified Firmicutes Lab288P3bin9 Isolate Unclassified
27 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
28 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
29 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
30 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
31 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
32 646564518 Candidatus Sulcia muelleri DMIN (unscreened) Isolate Cicadellidae
33 8018754795 Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 Isolate
34 8021899934 Acinetobacter sp. AR2-3 Isolate Culicidae
35 8030337018 Tissierella sp. Yu-01 Isolate Stratiomyidae
36 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
37 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
38 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
39 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
40 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
41 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
42 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
43 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
44 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
45 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
46 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
47 8114537524 Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 Isolate
48 2850695442 Lactococcus allomyrinae 1JSPR-7 Isolate Scarabaeidae
49 2855361764 Lysinibacillus fusiformis Juneja Isolate Drosophilidae
50 2864831662 Chryseobacterium sediminis S00068 Isolate Elmidae
51 2864863795 Acinetobacter johnsonii S00116 Isolate Elmidae
52 2864909992 Bacillus velezensis S00166 Isolate Elmidae
53 2904728850 Flavobacterium sp. xlx-214 Isolate
54 2905310146 Ligilactobacillus salivarius A3iob Isolate Apidae
55 2811995047 Flavobacterium succinicans DD5b Isolate Daphniidae
56 2820367663 Unclassified Firmicutes Nt197P3bin105 Isolate Unclassified
57 2820477775 Unclassified Firmicutes Lab288P1bin79 Isolate Unclassified
58 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
59 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
60 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
61 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
62 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
63 646311912 Blattabacterium sp. BPLAN Isolate Blattidae
64 8011357093 Pseudomonas schmalbachii Milli4 Isolate Trigoniulidae
65 8020009074 Elizabethkingia anophelis MSU001 Isolate Culicidae
66 8073539042 Candidatus Rhabdochlamydia porcellionis 15C Isolate Porcellionidae
67 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
68 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
69 3003178663 Psychrobacter fulvigenes KC-40 Isolate Unclassified
70 3006156446 Acinetobacter baretiae B10A Isolate Apidae
71 3007473699 Pseudomonas sp. S30 Isolate Curculionidae
72 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
73 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
74 2820772500 Unclassified Bacteroidetes Lab288P1bin72 Isolate Unclassified
75 2864801025 Bacillus aerius S00042 Isolate Elmidae
76 2864926767 Pseudomonas nitritireducens S00179 Isolate Elmidae
77 2921902974 Chryseobacterium sp. cx-624 Isolate Cambaridae
78 2940239174 Ereboglobus sp. PH5-10 Isolate Blattidae
79 2958471994 Flavobacterium sp. xlx-221 Isolate Cambaridae
80 2531839311 Acinetobacter sp. HA Isolate Noctuidae
81 2562617066 Rickettsiella grylli AAQJ Isolate Armadillidiidae
82 2718217844 Candidatus Baumannia cicadellinicola B-GSS Isolate Cicadellidae
83 2820236043 Unclassified Firmicutes Th196P3bin97 Isolate Unclassified
84 2820471304 Unclassified Firmicutes Lab288P1bin89 Isolate Unclassified
85 2820740053 Unclassified Bacteroidetes Th196P3bin81 Isolate Unclassified
86 2511231112 Blattabacterium punctulatus Cpu Isolate Cryptocercidae
87 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
88 644736337 Candidatus Sulcia muelleri SMDSEM Isolate Unclassified
89 8002299145 Vagococcus allomyrinae BWB3-3 Isolate Scarabaeidae
90 3002005207 Blattabacterium cuenoti MELANOZsp Isolate Blattidae
91 3002007112 Blattabacterium cuenoti CYRTOsp Isolate Blaberidae
92 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
93 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
94 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
95 2833478085 Oceanospirillum multiglobuliferum ATCC 33336 Isolate Unclassified
96 2864816158 Priestia aryabhattai S00060 Isolate Elmidae
97 2864874997 Acinetobacter lwoffii S00127 Isolate Elmidae
98 2864981449 Sporosarcina sp. S00266 Isolate Elmidae
99 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
100 2529292732 Elizabethkingia anophelis R26 Isolate Culicidae
101 2718217749 Coxiella mudrowiae CRt Isolate Ixodidae
102 2718218185 Candidatus Sulcia muelleri NC Isolate Cicadellidae
103 8064008355 Heyndrickxia oleronia Isolate Unclassified
104 8082023105 Niallia sp. Man26 Isolate Penaeidae
105 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
106 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
107 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
108 2864840607 Acinetobacter johnsonii S00071 Isolate Elmidae
109 2940261461 Enterococcus sp. PFB1-1 Isolate Blattidae
110 2574180310 Bacillus licheniformis CG-B52 Isolate Unclassified
111 2617270844 Dyella sp. HyOG Isolate Cixiidae
112 2775506951 Candidatus Coxiella mudrowiae CRS-CAT Isolate Unclassified
113 2799112231 Apibacter sp. ESL0432 Isolate Unclassified
114 2820572885 Unclassified Firmicutes Emb289P3bin161 Isolate Unclassified
115 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
116 8002519755 Planococcus sp. MSAK28401 Isolate Euphausiidae
117 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
118 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
119 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
120 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
121 2990166910 Pseudomonas typographi CA3A Isolate Curculionidae
122 3002028123 Blattabacterium cuenoti LAMPROsp Isolate Lamproblattidae
123 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
124 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
125 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
126 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
127 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
128 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
129 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
130 2820781750 Unclassified Bacteroidetes Emb289P3bin89 Isolate Unclassified
131 2832298047 Apibacter sp. wkB309 Isolate Apidae
132 2838140227 Dyella sp. OAE510 Isolate Unclassified
133 2847090942 Elizabethkingia anophelis Ag1 Isolate Culicidae
134 2864882932 Chryseobacterium shingense S00136 Isolate Elmidae
135 2864891731 Chryseobacterium defluvii S00151 Isolate Elmidae
136 2890957088 Psychrobacillus lasiicapitis NEAU-3TGS17 Isolate Formicidae
137 2524614537 Lysinibacillus sphaericus OT4b.31 Isolate Unclassified
138 2582581321 Oceanospirillum multiglobuliferum ATCC 33336 Isolate Unclassified
139 2687453786 Chryseobacterium culicis DSM 23031 Isolate Unclassified
140 2751185832 Lysinibacillus sp. AR18-8 Isolate Unclassified
141 2772190788 Candidatus Riesia pediculischaeffi PTSK Isolate Pediculidae
142 2599185120 Candidatus Sulcia muelleri BGSS Isolate Cicadellidae
143 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
144 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
145 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
146 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
147 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
148 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
149 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
150 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
151 3300005307 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 1 gut Metagenome Drosophilidae
152 2820768849 Unclassified Bacteroidetes Lab288P3bin194 Isolate Unclassified
153 2820774381 Unclassified Bacteroidetes Lab288P1bin37 Isolate Unclassified
154 2843246524 Lysinibacillus sphaericus DSM 28 Isolate Unclassified
155 2864804954 Acinetobacter johnsonii S00050 Isolate Elmidae
156 2864895409 Bacillus aerius S00152 Isolate Elmidae
157 2864923010 Elizabethkingia anophelis S00177 Isolate Elmidae
158 2864973726 Acinetobacter schindleri S00243 Isolate Elmidae
159 2899132286 Myroides albus BIT-d1 Isolate Tenebrionidae
160 2916858470 Heyndrickxia oleronia Isolate Unclassified
161 2940377351 Ereboglobus sp. PH5-5 Isolate Blattidae
162 2791355481 Bacillus sp. ZY-1-1 Isolate Scarabaeidae
163 2820301196 Unclassified Firmicutes Th196P1bin8 Isolate Unclassified
164 2820748953 Unclassified Bacteroidetes Nt197P4bin17 Isolate Unclassified
165 641228484 Candidatus Sulcia muelleri GWSS Isolate Cicadellidae
166 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
167 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
168 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
169 3002032411 Blattabacterium cuenoti POLYPHAGsp Isolate Corydiidae
170 3002773460 Coxiella endosymbiont of Amblyomma nuttalli Craf2019 Isolate Ixodidae
171 3006190525 Acinetobacter sp. S54 Isolate Curculionidae
172 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
173 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
174 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
175 3300009460 Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov Metagenome
176 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
177 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466704_350613 3300042643 Bacteria 10232
2 Ga0466701_015877 3300042598 Bacteria 22927
3 Ga0466713_050327 3300042602 Unclassified 100687
4 Ga0466714_102951 3300042603 Bacteria 4865
5 Ga0466721_083984 3300042608 Bacteria 20111
6 Ga0466723_092600 3300042618 Bacteria 7918
7 Ga0466729_005455 3300042621 Bacteria 9283
8 Ga0160435_1008284 3300012857 Bacteria 2244
9 Ga0123355_10037884 3300009826 Bacteria 7843
10 IMNBL1DRAFT_c0009316 3300000062 Bacteria 4860
11 JGI24702J35022_10008149 3300002462 Bacteria 5954
12 JGI24703J35330_11748832 3300002501 Bacteria 43139
13 Ga0103264_1000008 3300007188 Bacteria 140843
14 Ga0466730_071786 3300042625 Bacteria 741189
15 Ga0466702_218350 3300042635 Bacteria 3485
16 Ga0466724_29096 3300042649 Bacteria 63089
17 Ga0466708_123364 3300042652 Bacteria 4700
18 Ga0466708_352244 3300042652 Bacteria 8894
19 Ga0466725_093976 3300042654 Bacteria 35479
20 Ga0466706_006897 3300042599 Bacteria 5090
21 Ga0466722_125534 3300042609 Bacteria 5171
22 Ga0466729_089825 3300042621 Bacteria 1513
23 Ga0160448_104294 3300012854 Bacteria 3997
24 Ga0123355_10037959 3300009826 Bacteria 7832
25 Ga0123353_10210046 3300010167 Bacteria 3054
26 IMNBL1DRAFT_c0003675 3300000062 Bacteria 9672
27 Ga0466730_050917 3300042625 Unclassified 15813
28 Ga0466708_018399 3300042652 Bacteria 49081
29 Ga0466708_138438 3300042652 Bacteria 9602
30 Ga0466708_206183 3300042652 Bacteria 28300
31 Ga0466701_020904 3300042598 Bacteria 560833
32 Ga0466719_490225 3300042606 Bacteria 3999
33 Ga0466722_056908 3300042609 Bacteria 8006
34 Ga0160455_100769 3300012837 Bacteria 12835
35 Ga0466690_326615 3300042590 Bacteria 4228
36 Ga0466690_379973 3300042590 Bacteria 15164
37 Ga0466696_455470 3300042596 Bacteria 5396
38 Ga0123353_10000026 3300010167 Bacteria 168247
39 Ga0123353_10002615 3300010167 Bacteria 22403
40 HBC_ctgsDRAFT_1000014 3300000333 Bacteria 48411
41 JGI24705J35276_12236503 3300002504 Bacteria 8210
42 CVPL010W_10000918 3300002931 Bacteria 33396
43 Ga0072941_1027732 3300005201 Bacteria 10583
44 Ga0072941_1267833 3300005201 Bacteria 5542
45 Ga0104045_1019510 3300007085 Unclassified 3702
46 Ga0102737_1000066 3300007142 Bacteria 32096
47 Ga0104019_1002126 3300007150 Bacteria 20924
48 Ga0466732_318428 3300042656 Bacteria 4996
49 Ga0466733_210667 3300042659 Bacteria 15888
50 Ga0562379_0039 3300056790 Bacteria 641946
51 Ga0562376_0005 3300056857 Bacteria 2173693
52 Ga0466704_503952 3300042643 Unclassified 15385
53 Ga0466724_59158 3300042649 Bacteria 434991
54 Ga0466727_024060 3300042655 Unclassified 6096
55 Ga0466707_113879 3300042601 Bacteria 6982
56 Ga0466714_011286 3300042603 Bacteria 5135
57 Ga0466711_066483 3300042615 Bacteria 17172
58 Ga0466711_113058 3300042615 Bacteria 9358
59 Ga0466726_189556 3300042619 Bacteria 12193
60 Ga0466657_249385 3300042582 Bacteria 4755
61 Ga0466691_025331 3300042593 Bacteria 5017
62 Ga0123355_10138448 3300009826 Bacteria 3733
63 Ga0123356_10007396 3300010049 Unclassified 10956
64 IMNBL1DRAFT_c0006234 3300000062 Bacteria 6554
65 JGI24703J35330_11747874 3300002501 Bacteria 8764
66 Ga0063521_1003746 3300003973 Bacteria 3599
67 Ga0102736_1000185 3300007052 Bacteria 16115
68 Ga0103267_1000136 3300007190 Bacteria 33714
69 Ga0105005_1132576 3300007505 Bacteria 2086
70 Ga0466735_236365 3300042624 Bacteria 34484
71 Ga0466730_011896 3300042625 Unclassified 1094
72 Ga0466730_067124 3300042625 Bacteria 117554
73 Ga0466724_03451 3300042649 Bacteria 343609
74 Ga0466707_284106 3300042601 Bacteria 54420
75 Ga0466719_047288 3300042606 Bacteria 7845
76 Ga0466705_447695 3300042612 Bacteria 15480
77 Ga0466723_270766 3300042618 Bacteria 18832
78 Ga0466728_324049 3300042620 Bacteria 45950
79 Ga0466729_147055 3300042621 Bacteria 2201
80 Ga0160453_100268 3300012814 Bacteria 49445
81 Ga0123355_10476985 3300009826 Bacteria 1554
82 2227495762 2225789004 Bacteria 3937
83 IMNBL1DRAFT_c0012115 3300000062 Bacteria 3968
84 Meta3P_1001089 3300002464 Unclassified 25674
85 JGI24700J35501_10930934 3300002508 Bacteria 66586
86 Ga0103265_1000006 3300007068 Bacteria 82165
87 Ga0103267_1000987 3300007190 Bacteria 7132
88 Ga0466705_046890 3300042612 Bacteria 10925
89 Ga0562379_0005 3300056790 Bacteria 2649770
90 Ga0562374_0006 3300057007 Bacteria 2178283
91 Ga0466735_092551 3300042624 Bacteria 5246
92 Ga0466703_165189 3300042636 Bacteria 7217
93 Ga0466724_16100 3300042649 Unclassified 5335
94 Ga0466707_369273 3300042601 Bacteria 5554
95 Ga0466711_503166 3300042615 Bacteria 8946
96 Ga0466723_101296 3300042618 Bacteria 56220
97 Ga0466726_063319 3300042619 Bacteria 3800
98 Ga0466726_190142 3300042619 Bacteria 1447
99 Ga0466726_449131 3300042619 Bacteria 1430
100 Ga0466691_031566 3300042593 Bacteria 18938
101 Ga0123354_10013623 3300010882 Bacteria 12627
102 2227358546 2225789004 Bacteria 129386
103 IMNBL1DRAFT_c0000291 3300000062 Unclassified 43209
104 CVPL010L_1000435 3300002932 Unclassified 16090
105 Ga0072941_1140860 3300005201 Bacteria 2418
106 Ga0072941_1467671 3300005201 Bacteria 1608
107 Ga0103265_1002177 3300007068 Bacteria 4257
108 Ga0102734_1000018 3300007129 Bacteria 153503
109 Ga0104019_1003614 3300007150 Unclassified 3631
110 Ga0104050_1001439 3300007153 Bacteria 6525
111 Ga0466733_026832 3300042659 Bacteria 4125
112 Ga0562375_3147 3300056856 Bacteria 16352
113 Ga0466724_46924 3300042649 Bacteria 25048
114 Ga0466727_326225 3300042655 Bacteria 66208
115 Ga0466701_028458 3300042598 Bacteria 116962
116 Ga0466706_089736 3300042599 Unclassified 2605
117 Ga0466715_042327 3300042616 Bacteria 18793
118 Ga0466715_389792 3300042616 Bacteria 16335
119 Ga0466723_365544 3300042618 Bacteria 7696
120 Ga0466726_191400 3300042619 Bacteria 1838
121 Ga0466696_368802 3300042596 Bacteria 221772
122 Ga0123355_10016456 3300009826 Bacteria 11654
123 Ga0123355_10173205 3300009826 Bacteria 3220
124 Ga0123356_10021606 3300010049 Bacteria 6074
125 Ga0160464_100171 3300012805 Bacteria 69359
126 2227463537 2225789004 Bacteria 25071
127 JGI24703J35330_11748764 3300002501 Bacteria 32461
128 JGI24700J35501_10787860 3300002508 Bacteria 1491
129 Ga0074308_1115205 3300005307 Bacteria 1446
130 Ga0103261_1000035 3300007083 Bacteria 82381
131 Ga0104048_1004371 3300007143 Unclassified 8103
132 Ga0104019_1003763 3300007150 Unclassified 4533
133 Ga0104050_1029253 3300007153 Unclassified 4187
134 Ga0127649_100183 3300009460 Bacteria 42483
135 Ga0466705_052637 3300042612 Bacteria 5678
136 Ga0466733_023265 3300042659 Bacteria 18184
137 Ga0466735_104941 3300042624 Bacteria 3660
138 Ga0466730_058632 3300042625 Bacteria 2114
139 Ga0466703_191566 3300042636 Bacteria 3030
140 Ga0466701_062333 3300042598 Bacteria 75358
141 Ga0466710_186254 3300042613 Bacteria 1772
142 Ga0466728_023238 3300042620 Bacteria 7234
143 Ga0466728_248724 3300042620 Bacteria 10593
144 Ga0466690_104073 3300042590 Bacteria 10792
145 Ga0123355_10044345 3300009826 Bacteria 7239
146 2227635737 2225789004 Bacteria 11180

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042625 Ga0466730_011896 Ga0466730_011896_10_1029 339
2 3300042608 Ga0466721_083984 Ga0466721_083984_17566_18669 353
3 3300042599 Ga0466706_089736 Ga0466706_089736_360_1436 358
4 3300005201 Ga0072941_1467671 Ga0072941_14676712 361
5 3300009826 Ga0123355_10138448 Ga0123355_101384482 361
6 3300010167 Ga0123353_10210046 Ga0123353_102100462 361
7 3300042593 Ga0466691_031566 Ga0466691_031566_5621_6706 361
8 3300042620 Ga0466728_248724 Ga0466728_248724_8067_9152 361
9 iso_pr_bacteria 2562617066 2562864735 361
10 iso_pr_bacteria 2718218185 2720433996 361
11 iso_pr_bacteria 2772190788 2773011736 362
12 iso_pr_bacteria 8073539042 8073539352 362
13 3300042601 Ga0466707_284106 Ga0466707_284106_28762_29853 363
14 3300042612 Ga0466705_046890 Ga0466705_046890_1092_2258 363
15 iso_pr_bacteria 3002773460 3002773918 363
16 iso_pr_bacteria 2820572885 2820572971 364
17 3300010049 Ga0123356_10007396 Ga0123356_1000739610 365
18 3300042643 Ga0466704_503952 Ga0466704_503952_9696_10793 365
19 3300056790 Ga0562379_0005 Ga0562379_0005_213272_214393 365
20 3300056790 Ga0562379_0039 Ga0562379_0039_91762_92883 365
21 iso_pr_bacteria 2731957677 2732688501 365
22 iso_pr_bacteria 2940239174 2940239522 365
23 iso_pr_bacteria 2940377351 2940379445 365
24 iso_pr_bacteria 2718217844 2719023014 366
25 3300042599 Ga0466706_006897 Ga0466706_006897_334_1437 367
26 3300012837 Ga0160455_100769 Ga0160455_1007697 369
27 iso_pr_bacteria 2617270844 2617734488 369
28 iso_pr_bacteria 2718217749 2718706808 369
29 iso_pr_bacteria 2775506951 2776479939 369
30 iso_pr_bacteria 8030337018 8030339018 369
31 iso_pr_bacteria 2820367663 2820367859 370
32 iso_pr_bacteria 2864816158 2864819629 370
33 iso_pr_bacteria 2890957088 2890959964 370
34 3300012814 Ga0160453_100268 Ga0160453_10026816 371
35 3300042606 Ga0466719_047288 Ga0466719_047288_4368_5483 371
36 3300042620 Ga0466728_023238 Ga0466728_023238_4178_5344 371
37 3300042624 Ga0466735_104941 Ga0466735_104941_1941_3056 371
38 3300042624 Ga0466735_236365 Ga0466735_236365_9517_10632 371
39 iso_pr_bacteria 2767802234 2769331440 371
40 iso_pr_bacteria 2791355481 2794424772 371
41 iso_pr_bacteria 2864909992 2864912826 371
42 iso_pr_bacteria 2916858470 2916860476 371
43 iso_pr_bacteria 8064008355 8064010241 371
44 iso_pr_bacteria 8082023105 8082025992 371
45 3300042613 Ga0466710_186254 Ga0466710_186254_441_1637 372
46 iso_pr_bacteria 2574180310 2576357740 372
47 iso_pr_bacteria 2582581321 2585351865 372
48 iso_pr_bacteria 2833478085 2833479122 372
49 iso_pr_bacteria 2864801025 2864803439 372
50 iso_pr_bacteria 2864895409 2864897821 372
51 iso_pr_bacteria 8002519755 8002521380 372
52 iso_pr_bacteria 8018750880 8018753499 372
53 iso_pr_bacteria 8018754795 8018755730 372
54 iso_pr_bacteria 8043041867 8043042211 372
55 3300042616 Ga0466715_389792 Ga0466715_389792_7110_8231 373
56 3300056856 Ga0562375_3147 Ga0562375_3147_1968_3089 373
57 3300056857 Ga0562376_0005 Ga0562376_0005_686431_687552 373
58 3300057007 Ga0562374_0006 Ga0562374_0006_1562558_1563679 373
59 iso_pr_bacteria 2820236043 2820238172 373
60 iso_pr_bacteria 2850695442 2850696623 373
61 iso_pr_bacteria 2864981449 2864984550 373
62 iso_pr_bacteria 2940218408 2940220964 373
63 iso_pr_bacteria 2940261461 2940264011 373
64 3300002931 CVPL010W_10000918 CVPL010W_1000091823 374
65 3300005201 Ga0072941_1027732 Ga0072941_10277321 374
66 3300007068 Ga0103265_1002177 Ga0103265_10021776 374
67 3300007083 Ga0103261_1000035 Ga0103261_100003571 374
68 3300007142 Ga0102737_1000066 Ga0102737_100006618 374
69 3300009826 Ga0123355_10476985 Ga0123355_104769851 374
70 3300042659 Ga0466733_023265 Ga0466733_023265_16227_17351 374
71 3300042659 Ga0466733_026832 Ga0466733_026832_2603_3727 374
72 iso_pr_bacteria 2524614537 2524835239 374
73 iso_pr_bacteria 2751185832 2753508469 374
74 iso_pr_bacteria 2820301196 2820303288 374
75 iso_pr_bacteria 2820416776 2820416829 374
76 iso_pr_bacteria 2820471304 2820471676 374
77 iso_pr_bacteria 2820518089 2820518896 374
78 iso_pr_bacteria 2843246524 2843248106 374
79 iso_pr_bacteria 2852123468 2852125712 374
80 iso_pr_bacteria 2855361764 2855363580 374
81 iso_pr_bacteria 3007473699 3007473903 374
82 iso_pr_bacteria 8114537524 8114540726 374
83 3300002501 JGI24703J35330_11748764 JGI24703J35330_1174876413 375
84 3300002508 JGI24700J35501_10787860 JGI24700J35501_107878602 375
85 3300002508 JGI24700J35501_10930934 JGI24700J35501_109309348 375
86 3300007153 Ga0104050_1029253 Ga0104050_10292532 375
87 3300009826 Ga0123355_10037884 Ga0123355_100378843 375
88 3300009826 Ga0123355_10037959 Ga0123355_100379592 375
89 3300009826 Ga0123355_10173205 Ga0123355_101732054 375
90 iso_pr_bacteria 2838140227 2838143111 375
91 iso_pr_bacteria 2864903489 2864903634 375
92 iso_pr_bacteria 2905310146 2905311375 375
93 iso_pr_bacteria 8002299145 8002299272 375
94 3300002501 JGI24703J35330_11748832 JGI24703J35330_1174883239 376
95 3300010167 Ga0123353_10000026 Ga0123353_10000026100 376
96 iso_pr_bacteria 2820477775 2820478638 376
97 iso_pr_bacteria 2864926767 2864933233 376
98 iso_pr_bacteria 3006156446 3006157472 376
99 2225789004 2227635737 2228222579 377
100 3300009826 Ga0123355_10044345 Ga0123355_100443455 377
101 3300012805 Ga0160464_100171 Ga0160464_10017126 377
102 3300042598 Ga0466701_062333 Ga0466701_062333_7613_8800 377
103 3300042625 Ga0466730_050917 Ga0466730_050917_1872_3005 377
104 3300042649 Ga0466724_46924 Ga0466724_46924_22172_23305 377
105 iso_pr_bacteria 2531839311 2533040337 377
106 iso_pr_bacteria 2864804954 2864806402 377
107 iso_pr_bacteria 2864840607 2864843184 377
108 iso_pr_bacteria 2864843793 2864846659 377
109 iso_pr_bacteria 2864863795 2864866247 377
110 iso_pr_bacteria 2864973726 2864976460 377
111 iso_pr_bacteria 2990166910 2990169208 377
112 iso_pr_bacteria 3006190525 3006192175 377
113 iso_pr_bacteria 641522603 641583613 377
114 3300000062 IMNBL1DRAFT_c0000291 IMNBL1DRAFT_000029121 378
115 3300002501 JGI24703J35330_11747874 JGI24703J35330_117478741 378
116 3300007150 Ga0104019_1002126 Ga0104019_10021269 378
117 3300042636 Ga0466703_191566 Ga0466703_191566_629_1795 378
118 3300012857 Ga0160435_1008284 Ga0160435_10082842 379
119 3300042625 Ga0466730_058632 Ga0466730_058632_328_1467 379
120 iso_pr_bacteria 2864874997 2864875643 379
121 iso_pr_bacteria 8011357093 8011358252 379
122 iso_pr_bacteria 8021899934 8021902427 379
123 3300005201 Ga0072941_1267833 Ga0072941_12678334 380
124 3300007150 Ga0104019_1003614 Ga0104019_10036143 380
125 3300007190 Ga0103267_1000136 Ga0103267_100013623 380
126 3300042618 Ga0466723_101296 Ga0466723_101296_41348_42490 380
127 3300042618 Ga0466723_365544 Ga0466723_365544_5300_6481 380
128 iso_pr_bacteria 2599185120 2599224912 380
129 iso_pr_bacteria 641228484 641331642 380
130 iso_pr_bacteria 646564518 646708195 380
131 3300042606 Ga0466719_490225 Ga0466719_490225_467_1630 381
132 3300042624 Ga0466735_092551 Ga0466735_092551_2400_3599 381
133 3300009826 Ga0123355_10016456 Ga0123355_100164568 382
134 3300042612 Ga0466705_052637 Ga0466705_052637_4246_5424 382
135 3300007505 Ga0105005_1132576 Ga0105005_11325762 383
136 3300012854 Ga0160448_104294 Ga0160448_1042945 383
137 3300042598 Ga0466701_020904 Ga0466701_020904_464973_466124 383
138 3300042625 Ga0466730_067124 Ga0466730_067124_57814_58965 383
139 3300042649 Ga0466724_16100 Ga0466724_16100_3213_4364 383
140 2225789004 2227358546 2227803950 384
141 3300042602 Ga0466713_050327 Ga0466713_050327_88565_89719 384
142 iso_pr_bacteria 2878857142 2878858803 384
143 3300002932 CVPL010L_1000435 CVPL010L_10004353 385
144 3300003973 Ga0063521_1003746 Ga0063521_10037463 385
145 3300042609 Ga0466722_125534 Ga0466722_125534_460_1617 385
146 3300009460 Ga0127649_100183 Ga0127649_10018323 386
147 3300042619 Ga0466726_190142 Ga0466726_190142_254_1414 386
148 3300042621 Ga0466729_089825 Ga0466729_089825_308_1471 387
149 3300042635 Ga0466702_218350 Ga0466702_218350_715_1878 387
150 3300042655 Ga0466727_326225 Ga0466727_326225_9974_11137 387
151 iso_pr_bacteria 2820768849 2820769883 387
152 iso_pr_bacteria 2820774381 2820774927 387
153 3300042590 Ga0466690_104073 Ga0466690_104073_7762_8928 388
154 3300042593 Ga0466691_025331 Ga0466691_025331_290_1456 388
155 3300042618 Ga0466723_270766 Ga0466723_270766_15792_16958 388
156 3300042652 Ga0466708_206183 Ga0466708_206183_15103_16269 388
157 3300042652 Ga0466708_352244 Ga0466708_352244_4621_5787 388
158 3300042596 Ga0466696_368802 Ga0466696_368802_100571_101740 389
159 3300042601 Ga0466707_369273 Ga0466707_369273_2342_3511 389
160 3300042619 Ga0466726_449131 Ga0466726_449131_183_1352 389
161 3300042636 Ga0466703_165189 Ga0466703_165189_1406_2575 389
162 3300000062 IMNBL1DRAFT_c0012115 IMNBL1DRAFT_00121152 390
163 3300042590 Ga0466690_326615 Ga0466690_326615_565_1737 390
164 3300042590 Ga0466690_379973 Ga0466690_379973_7568_8740 390
165 3300042603 Ga0466714_011286 Ga0466714_011286_3926_5098 390
166 3300042603 Ga0466714_102951 Ga0466714_102951_486_1658 390
167 3300042609 Ga0466722_056908 Ga0466722_056908_1713_2885 390
168 3300042612 Ga0466705_447695 Ga0466705_447695_4364_5536 390
169 3300042615 Ga0466711_503166 Ga0466711_503166_7762_8934 390
170 3300042616 Ga0466715_042327 Ga0466715_042327_4776_5948 390
171 2225789004 2227495762 2227972904 391
172 3300042618 Ga0466723_092600 Ga0466723_092600_6711_7886 391
173 3300042620 Ga0466728_324049 Ga0466728_324049_146_1321 391
174 3300042621 Ga0466729_005455 Ga0466729_005455_4541_5716 391
175 3300042621 Ga0466729_147055 Ga0466729_147055_352_1527 391
176 3300042652 Ga0466708_123364 Ga0466708_123364_3502_4677 391
177 3300042655 Ga0466727_024060 Ga0466727_024060_28_1203 391
178 3300042656 Ga0466732_318428 Ga0466732_318428_1513_2688 391
179 iso_pr_bacteria 2811995047 2812945732 391
180 3300000062 IMNBL1DRAFT_c0006234 IMNBL1DRAFT_00062346 392
181 3300042619 Ga0466726_063319 Ga0466726_063319_551_1729 392
182 3300042619 Ga0466726_189556 Ga0466726_189556_3882_5060 392
183 iso_pr_bacteria 2511231112 2511677706 393
184 3300010882 Ga0123354_10013623 Ga0123354_100136237 394
185 3300042615 Ga0466711_113058 Ga0466711_113058_4240_5424 394
186 3300042619 Ga0466726_191400 Ga0466726_191400_339_1523 394
187 3300042649 Ga0466724_59158 Ga0466724_59158_3535_4719 394
188 iso_pr_bacteria 2529292732 2529759089 394
189 iso_pr_bacteria 2785510743 2785735382 394
190 iso_pr_bacteria 2799112231 2799233304 394
191 iso_pr_bacteria 2820748953 2820749737 394
192 iso_pr_bacteria 2820772500 2820774132 394
193 iso_pr_bacteria 2820781750 2820782920 394
194 iso_pr_bacteria 2832298047 2832298153 394
195 iso_pr_bacteria 2847090942 2847093276 394
196 iso_pr_bacteria 2864788197 2864791283 394
197 iso_pr_bacteria 2864923010 2864926097 394
198 iso_pr_bacteria 2864948220 2864951305 394
199 iso_pr_bacteria 646311912 646377305 394
200 iso_pr_bacteria 8020009074 8020010072 394
201 iso_pr_bacteria 8114076984 8114079035 394
202 3300000333 HBC_ctgsDRAFT_1000014 HBC_ctgsDRAFT_10000148 395
203 3300002462 JGI24702J35022_10008149 JGI24702J35022_100081494 395
204 3300002464 Meta3P_1001089 Meta3P_10010892 395
205 3300002504 JGI24705J35276_12236503 JGI24705J35276_122365036 395
206 3300005201 Ga0072941_1140860 Ga0072941_11408603 395
207 3300007052 Ga0102736_1000185 Ga0102736_100018510 395
208 3300007068 Ga0103265_1000006 Ga0103265_100000643 395
209 3300007129 Ga0102734_1000018 Ga0102734_100001828 395
210 3300007188 Ga0103264_1000008 Ga0103264_10000089 395
211 3300007190 Ga0103267_1000987 Ga0103267_10009878 395
212 3300010049 Ga0123356_10021606 Ga0123356_100216063 395
213 3300042582 Ga0466657_249385 Ga0466657_249385_2770_3957 395
214 3300042601 Ga0466707_113879 Ga0466707_113879_278_1510 395
215 3300042625 Ga0466730_071786 Ga0466730_071786_203936_205123 395
216 3300042649 Ga0466724_03451 Ga0466724_03451_316876_318063 395
217 3300042654 Ga0466725_093976 Ga0466725_093976_30231_31418 395
218 iso_pr_bacteria 2687453786 2690172913 395
219 iso_pr_bacteria 2864822740 2864825152 395
220 iso_pr_bacteria 2864831662 2864835222 395
221 iso_pr_bacteria 2864882932 2864885343 395
222 iso_pr_bacteria 2864891731 2864893934 395
223 iso_pr_bacteria 2921902974 2921904632 395
224 3300005307 Ga0074308_1115205 Ga0074308_11152051 396
225 3300007085 Ga0104045_1019510 Ga0104045_10195101 396
226 3300007153 Ga0104050_1001439 Ga0104050_10014396 396
227 3300042652 Ga0466708_018399 Ga0466708_018399_30362_31552 396
228 iso_pr_bacteria 3002005207 3002005289 396
229 iso_pr_bacteria 3002028123 3002028207 396
230 3300010167 Ga0123353_10002615 Ga0123353_100026151 397
231 3300042652 Ga0466708_138438 Ga0466708_138438_6768_7961 397
232 iso_pr_bacteria 2904728850 2904731462 397
233 iso_pr_bacteria 2958471994 2958474612 397
234 iso_pr_bacteria 2841821538 2841822517 398
235 3300042615 Ga0466711_066483 Ga0466711_066483_571_1770 399
236 iso_pr_bacteria 3003178663 3003180335 400
237 3300042596 Ga0466696_455470 Ga0466696_455470_2205_3410 401
238 3300042659 Ga0466733_210667 Ga0466733_210667_9247_10452 401
239 iso_pr_bacteria 2820741847 2820743009 402
240 3300042598 Ga0466701_015877 Ga0466701_015877_3181_4392 403
241 3300042643 Ga0466704_350613 Ga0466704_350613_8466_9677 403
242 3300042649 Ga0466724_29096 Ga0466724_29096_25534_26745 403
243 2225789004 2227463537 2227899255 404
244 3300042598 Ga0466701_028458 Ga0466701_028458_33103_34317 404
245 3300007143 Ga0104048_1004371 Ga0104048_10043714 405
246 3300007150 Ga0104019_1003763 Ga0104019_10037632 405
247 iso_pr_bacteria 2899132286 2899134997 405
248 iso_pr_bacteria 3002007112 3002007194 406
249 iso_pr_bacteria 3002032411 3002032490 412
250 iso_pr_bacteria 2820740053 2820740917 418
251 3300000062 IMNBL1DRAFT_c0003675 IMNBL1DRAFT_00036756 437
252 3300000062 IMNBL1DRAFT_c0009316 IMNBL1DRAFT_00093164 451
253 iso_pr_bacteria 644736337 644950976 470

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03054 tRNA_Me_trans tRNA methyl transferase HUP domain 1 204 0.98
PF20258 tRNA_Me_trans_C Aminomethyltransferase beta-barrel domain 376 449 0.94
PF20259 tRNA_Me_trans_M tRNA methyl transferase PRC-barrel domain 310 360 0.91
PF02540 NAD_synthase NAD synthase 2 125 0.66

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.