Protein Family IF00240

Metagenome Isolate
164 Members
66 Samples
148 Scaffolds
314.93 Avg Length

🧬 Representative Sequence

ID
3300000062|IMNBL1DRAFT_c0007499|IMNBL1DRAFT_00074993
Length
318 aa
Sequence
MNVMTKIAKKLTDLIGNTPLLELVTFGQYHSLSARLIGKLEYFNPAGSVKDRVALAMIEDAESKGILKSGSVIIEPTSGNTGVGLAFVSVVKGYRIILTMPETMSIERRNLLKAFGAEVVLTNGADGMKGAIAKAENLHNEIPNSVILQQFENPANPAIHSKTAEEIWKDTNQHVDIFVAGVGTGGTISGVGKRLKELNPKVQIVAVEPADSPVLSGGIQGAHKIQGIGAGFVPKIFDSSVVDTIITVSNDEAIRTSRELTKTEGLLIGISSGAATYAAVNLAKLSENRDKNIVVMLPDTGERYLSTVLYSFDEYPL*

📊 Sample Types

Isolate 9.8%
Metagenome 90.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 33.3%
Unclassified 20.6%
Kalotermitidae 20.6%
Blattidae 6.3%
Termopsidae 4.8%
Rhinotermitidae 3.2%
Drosophilidae 3.2%
Passalidae 3.2%
Apidae 1.6%
Hodotermitidae 1.6%
Armadillidiidae 1.6%

🌳 Taxonomy

Archaea 1
Bacteria 157
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820654856 Unclassified Firmicutes Cu122P1bin2 Isolate Unclassified
2 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
3 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
4 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
5 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
6 2827179085 Paenibacillus alvei DSM 29 Isolate Apidae
7 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
8 2820339298 Unclassified Firmicutes Nt197P3bin68 Isolate Unclassified
9 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
10 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
11 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
12 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
13 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
14 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
15 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
16 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
17 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
18 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
19 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
20 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
21 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
22 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
23 2820229114 Unclassified Firmicutes Th196P4bin40 Isolate Unclassified
24 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
25 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
26 3300007130 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut Metagenome Drosophilidae
27 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
28 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
29 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
30 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
31 2920168565 Paludibacter sp. 221 Isolate Blattidae
32 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
33 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
34 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
35 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
36 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
37 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
38 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
39 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
40 2820584674 Unclassified Firmicutes Emb289P1bin98 Isolate Unclassified
41 2820719201 Unclassified Fibrobacteres Lab288P3bin119 Isolate Unclassified
42 2773857689 Unclassified Methanomassiliicoccaceae Nt197P3bin8 Isolate Unclassified
43 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
44 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
45 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
46 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
47 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
48 3300007149 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut Metagenome Drosophilidae
49 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
50 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
51 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
52 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
53 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
54 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
55 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
56 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
57 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
58 2820474468 Unclassified Firmicutes Lab288P1bin84 Isolate Unclassified
59 2820497731 Unclassified Firmicutes Lab288P1bin55 Isolate Unclassified
60 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
61 3004667792 Bacteroides sp. 519 Isolate Blattidae
62 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
63 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
64 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
65 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
66 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_151008 3300042659 Bacteria 3881
2 Ga0123353_10759176 3300010167 Bacteria 1348
3 Ga0123354_10140035 3300010882 Bacteria 2999
4 Ga0264413_101286 3300024493 Bacteria 17003
5 Ga0466690_003105 3300042590 Bacteria 52820
6 Ga0466711_441474 3300042615 Bacteria 2378
7 Ga0466726_081656 3300042619 Bacteria 25380
8 Ga0466703_270825 3300042636 Bacteria 10380
9 Ga0466725_350213 3300042654 Bacteria 33385
10 Ga0466706_065550 3300042599 Bacteria 22203
11 Ga0466706_288768 3300042599 Bacteria 1833
12 Ga0466700_047234 3300042600 Bacteria 31011
13 Ga0466713_053726 3300042602 Bacteria 131027
14 Ga0466713_109457 3300042602 Bacteria 80949
15 Ga0072941_1326357 3300005201 Bacteria 1663
16 Ga0466705_149433 3300042612 Bacteria 10726
17 Ga0123357_10112556 3300009784 Bacteria 3463
18 Ga0123355_10002122 3300009826 Bacteria 27995
19 Ga0466696_235308 3300042596 Bacteria 27401
20 Ga0466711_036443 3300042615 Unclassified 3226
21 Ga0466715_542902 3300042616 Bacteria 6030
22 Ga0466723_042738 3300042618 Bacteria 46355
23 Ga0466706_046183 3300042599 Bacteria 4319
24 Ga0466707_013194 3300042601 Bacteria 2547
25 Ga0466714_075627 3300042603 Bacteria 1482
26 Ga0466722_137996 3300042609 Bacteria 3002
27 Ga0104040_1001439 3300007149 Bacteria 2178
28 Ga0466705_028707 3300042612 Bacteria 6535
29 Ga0466733_195509 3300042659 Bacteria 83582
30 Ga0123354_10001938 3300010882 Bacteria 26389
31 Ga0466696_060862 3300042596 Bacteria 9085
32 Ga0466712_113475 3300042614 Bacteria 1067
33 Ga0466715_061300 3300042616 Bacteria 7608
34 Ga0466715_118812 3300042616 Bacteria 9918
35 Ga0466723_165155 3300042618 Bacteria 30063
36 Ga0466728_217653 3300042620 Bacteria 6503
37 Ga0466730_061420 3300042625 Bacteria 5181
38 Ga0466703_305000 3300042636 Bacteria 5425
39 Ga0466704_285742 3300042643 Bacteria 10079
40 Ga0466709_133488 3300042648 Bacteria 69029
41 Ga0466709_281639 3300042648 Bacteria 14893
42 Ga0466706_002708 3300042599 Bacteria 9728
43 Ga0466707_130829 3300042601 Bacteria 9553
44 Ga0466713_086263 3300042602 Bacteria 5160
45 Ga0466714_158934 3300042603 Bacteria 2620
46 IMNBL1DRAFT_c0006878 3300000062 Bacteria 6106
47 Ga0466691_096683 3300042593 Bacteria 10540
48 Ga0466696_002390 3300042596 Bacteria 8040
49 Ga0466711_042164 3300042615 Bacteria 7771
50 Ga0466711_061554 3300042615 Bacteria 22853
51 Ga0466715_073321 3300042616 Bacteria 18269
52 Ga0466715_081089 3300042616 Bacteria 5896
53 Ga0466704_067267 3300042643 Bacteria 9780
54 Ga0466706_013618 3300042599 Bacteria 9134
55 Ga0466706_042492 3300042599 Bacteria 22506
56 Ga0466706_182722 3300042599 Bacteria 29146
57 Ga0466706_212852 3300042599 Bacteria 14828
58 Ga0466713_039218 3300042602 Bacteria 14247
59 Ga0466714_097870 3300042603 Bacteria 6473
60 Ga0466714_151135 3300042603 Bacteria 2581
61 JGI24699J35502_11133749 3300002509 Bacteria 14709
62 Ga0123357_10001408 3300009784 Bacteria 25449
63 Ga0466705_301512 3300042612 Bacteria 1252
64 Ga0466705_310521 3300042612 Bacteria 78321
65 Ga0466733_032546 3300042659 Unclassified 8070
66 Ga0123357_10007351 3300009784 Bacteria 13603
67 Ga0123357_10028333 3300009784 Bacteria 7579
68 Ga0123357_10099302 3300009784 Bacteria 3759
69 Ga0123355_10249122 3300009826 Bacteria 2504
70 Ga0123356_10000518 3300010049 Bacteria 42876
71 Ga0123353_10001341 3300010167 Bacteria 30191
72 Ga0466692_146086 3300042591 Bacteria 2399
73 Ga0466696_224181 3300042596 Bacteria 6173
74 Ga0466696_227064 3300042596 Bacteria 35618
75 Ga0466715_491855 3300042616 Bacteria 4906
76 Ga0466735_023041 3300042624 Bacteria 2207
77 Ga0466708_296454 3300042652 Bacteria 54366
78 Ga0466706_093924 3300042599 Bacteria 57491
79 Ga0466706_111719 3300042599 Bacteria 6663
80 Ga0466700_307908 3300042600 Bacteria 4471
81 Ga0466719_033013 3300042606 Bacteria 9653
82 JGI24699J35502_11133880 3300002509 Bacteria 17881
83 Ga0466705_255953 3300042612 Unclassified 1412
84 Ga0466733_088268 3300042659 Unclassified 4702
85 Ga0123357_10007413 3300009784 Bacteria 13554
86 Ga0123357_10411319 3300009784 Bacteria 1219
87 Ga0123355_10002398 3300009826 Bacteria 26488
88 Ga0123353_10266538 3300010167 Bacteria 2642
89 Ga0466690_165110 3300042590 Bacteria 20376
90 Ga0466696_160910 3300042596 Bacteria 12370
91 Ga0466711_226717 3300042615 Bacteria 7046
92 Ga0466711_484067 3300042615 Bacteria 2475
93 Ga0466726_390789 3300042619 Bacteria 4683
94 Ga0466702_012993 3300042635 Bacteria 1889
95 Ga0466704_149449 3300042643 Bacteria 9859
96 Ga0466727_114271 3300042655 Bacteria 3570
97 Ga0466706_028678 3300042599 Bacteria 3059
98 Ga0466706_028721 3300042599 Bacteria 5568
99 Ga0466706_121013 3300042599 Bacteria 9780
100 Ga0466707_272109 3300042601 Bacteria 19065
101 Ga0466719_327872 3300042606 Bacteria 1449
102 Ga0466698_293476 3300042610 Bacteria 1136
103 2227524645 2225789004 Bacteria 3271
104 IMNBL1DRAFT_c0007499 3300000062 Bacteria 5727
105 JGI24699J35502_11134210 3300002509 Bacteria 59774
106 JGI24696J40584_12950721 3300002834 Bacteria 2175
107 Ga0072941_1211758 3300005201 Bacteria 2360
108 Ga0466705_016709 3300042612 Bacteria 4832
109 Ga0466732_421119 3300042656 Bacteria 54820
110 Ga0123357_10106248 3300009784 Bacteria 3599
111 Ga0123355_10000592 3300009826 Bacteria 48877
112 Ga0123355_10023936 3300009826 Bacteria 9808
113 Ga0123355_10313804 3300009826 Bacteria 2121
114 Ga0123353_10082090 3300010167 Bacteria 5184
115 Ga0123354_10036143 3300010882 Bacteria 7705
116 Ga0466657_046695 3300042582 Bacteria 2625
117 Ga0466690_035694 3300042590 Bacteria 4730
118 Ga0466696_018570 3300042596 Unclassified 3284
119 Ga0466712_090584 3300042614 Bacteria 1314
120 Ga0466726_380659 3300042619 Unclassified 4383
121 Ga0466708_287549 3300042652 Bacteria 5031
122 Ga0466700_193315 3300042600 Bacteria 8174
123 Ga0466714_061849 3300042603 Bacteria 4066
124 Ga0466714_117493 3300042603 Bacteria 34193
125 Ga0466722_076037 3300042609 Bacteria 11665
126 JGI24695J34938_10033345 3300002450 Bacteria 2369
127 Ga0104042_1000609 3300007130 Bacteria 2256
128 Ga0466705_145863 3300042612 Bacteria 10136
129 Ga0466733_129055 3300042659 Bacteria 17401
130 Ga0123356_10000522 3300010049 Bacteria 42650
131 Ga0123354_10000687 3300010882 Bacteria 36022
132 Ga0123354_10022331 3300010882 Bacteria 9977
133 Ga0160456_106049 3300012820 Bacteria 1430
134 Ga0160452_100084 3300012834 Bacteria 123536
135 Ga0466690_303437 3300042590 Bacteria 1675
136 Ga0466692_067935 3300042591 Bacteria 92005
137 Ga0466692_140391 3300042591 Bacteria 136970
138 Ga0466699_385250 3300042597 Bacteria 1535
139 Ga0466711_224338 3300042615 Bacteria 13307
140 Ga0466703_195295 3300042636 Bacteria 15480
141 Ga0466704_279867 3300042643 Bacteria 7231
142 Ga0466708_299612 3300042652 Bacteria 12375
143 Ga0466725_168201 3300042654 Bacteria 25218
144 Ga0466701_069735 3300042598 Bacteria 6655
145 Ga0466706_133469 3300042599 Bacteria 14669
146 Ga0466706_184382 3300042599 Bacteria 1709
147 Ga0466714_064217 3300042603 Bacteria 3177
148 JGI24702J35022_10128253 3300002462 Bacteria 1406

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042599 Ga0466706_184382 Ga0466706_184382_673_1572 299
2 3300042590 Ga0466690_165110 Ga0466690_165110_12260_13207 303
3 3300042616 Ga0466715_491855 Ga0466715_491855_2050_2997 304
4 iso_pr_bacteria 2820339298 2820340017 304
5 3300005201 Ga0072941_1326357 Ga0072941_13263572 307
6 3300042591 Ga0466692_146086 Ga0466692_146086_1050_1973 307
7 3300042600 Ga0466700_193315 Ga0466700_193315_840_1763 307
8 3300042652 Ga0466708_287549 Ga0466708_287549_3529_4452 307
9 iso_pr_bacteria 2820474468 2820474791 307
10 iso_pr_bacteria 2820584674 2820585413 307
11 3300042599 Ga0466706_028678 Ga0466706_028678_1873_2799 308
12 iso_pr_bacteria 2820497731 2820498269 308
13 3300042596 Ga0466696_235308 Ga0466696_235308_23483_24412 309
14 3300042612 Ga0466705_149433 Ga0466705_149433_2291_3220 309
15 3300042612 Ga0466705_301512 Ga0466705_301512_188_1117 309
16 3300042625 Ga0466730_061420 Ga0466730_061420_640_1569 309
17 3300009826 Ga0123355_10023936 Ga0123355_1002393610 310
18 3300042596 Ga0466696_060862 Ga0466696_060862_2301_3233 310
19 3300042599 Ga0466706_028721 Ga0466706_028721_2153_3085 310
20 3300042599 Ga0466706_093924 Ga0466706_093924_46059_46991 310
21 3300042612 Ga0466705_310521 Ga0466705_310521_9568_10500 310
22 3300042615 Ga0466711_224338 Ga0466711_224338_1668_2600 310
23 3300042616 Ga0466715_073321 Ga0466715_073321_16422_17354 310
24 iso_pr_bacteria 2820229114 2820230642 310
25 iso_pr_bacteria 2827179085 2827180062 310
26 3300002462 JGI24702J35022_10128253 JGI24702J35022_101282532 311
27 3300024493 Ga0264413_101286 Ga0264413_1012867 311
28 3300042598 Ga0466701_069735 Ga0466701_069735_547_1482 311
29 3300042614 Ga0466712_113475 Ga0466712_113475_11_946 311
30 3300002450 JGI24695J34938_10033345 JGI24695J34938_100333453 312
31 3300009826 Ga0123355_10002122 Ga0123355_1000212214 312
32 3300009826 Ga0123355_10002398 Ga0123355_1000239831 312
33 3300009826 Ga0123355_10249122 Ga0123355_102491221 312
34 3300009826 Ga0123355_10313804 Ga0123355_103138042 312
35 3300012820 Ga0160456_106049 Ga0160456_1060491 312
36 3300042590 Ga0466690_003105 Ga0466690_003105_8946_9884 312
37 3300042612 Ga0466705_016709 Ga0466705_016709_3765_4703 312
38 3300042615 Ga0466711_036443 Ga0466711_036443_379_1317 312
39 3300042615 Ga0466711_226717 Ga0466711_226717_2109_3047 312
40 3300042615 Ga0466711_441474 Ga0466711_441474_1185_2123 312
41 3300042615 Ga0466711_484067 Ga0466711_484067_646_1584 312
42 3300042620 Ga0466728_217653 Ga0466728_217653_4089_5027 312
43 3300042635 Ga0466702_012993 Ga0466702_012993_46_984 312
44 3300042643 Ga0466704_279867 Ga0466704_279867_438_1376 312
45 3300042656 Ga0466732_421119 Ga0466732_421119_17955_18893 312
46 3300009826 Ga0123355_10000592 Ga0123355_1000059210 313
47 3300012834 Ga0160452_100084 Ga0160452_10008484 313
48 3300042601 Ga0466707_130829 Ga0466707_130829_8139_9080 313
49 3300042606 Ga0466719_033013 Ga0466719_033013_105_1046 313
50 3300042636 Ga0466703_305000 Ga0466703_305000_4140_5081 313
51 3300042648 Ga0466709_281639 Ga0466709_281639_3311_4252 313
52 3300042654 Ga0466725_350213 Ga0466725_350213_29794_30735 313
53 iso_pr_bacteria 2820654856 2820655983 313
54 3300042593 Ga0466691_096683 Ga0466691_096683_6765_7709 314
55 3300042600 Ga0466700_047234 Ga0466700_047234_21390_22334 314
56 3300042615 Ga0466711_061554 Ga0466711_061554_9540_10484 314
57 2225789004 2227524645 2228031454 315
58 3300010882 Ga0123354_10001938 Ga0123354_1000193811 315
59 3300042591 Ga0466692_140391 Ga0466692_140391_49716_50663 315
60 3300042596 Ga0466696_002390 Ga0466696_002390_2164_3111 315
61 3300042596 Ga0466696_018570 Ga0466696_018570_1468_2415 315
62 3300042596 Ga0466696_160910 Ga0466696_160910_4092_5039 315
63 3300042596 Ga0466696_224181 Ga0466696_224181_3926_4873 315
64 3300042596 Ga0466696_227064 Ga0466696_227064_20663_21610 315
65 3300042597 Ga0466699_385250 Ga0466699_385250_45_992 315
66 3300042599 Ga0466706_002708 Ga0466706_002708_4904_5851 315
67 3300042599 Ga0466706_013618 Ga0466706_013618_5507_6454 315
68 3300042599 Ga0466706_042492 Ga0466706_042492_17647_18594 315
69 3300042599 Ga0466706_046183 Ga0466706_046183_916_1863 315
70 3300042599 Ga0466706_065550 Ga0466706_065550_8743_9690 315
71 3300042599 Ga0466706_111719 Ga0466706_111719_1249_2196 315
72 3300042599 Ga0466706_121013 Ga0466706_121013_1639_2586 315
73 3300042599 Ga0466706_133469 Ga0466706_133469_1235_2182 315
74 3300042599 Ga0466706_182722 Ga0466706_182722_26576_27523 315
75 3300042599 Ga0466706_212852 Ga0466706_212852_1372_2319 315
76 3300042599 Ga0466706_288768 Ga0466706_288768_479_1426 315
77 3300042600 Ga0466700_307908 Ga0466700_307908_1722_2669 315
78 3300042601 Ga0466707_272109 Ga0466707_272109_6617_7564 315
79 3300042602 Ga0466713_039218 Ga0466713_039218_7233_8180 315
80 3300042602 Ga0466713_053726 Ga0466713_053726_35755_36702 315
81 3300042602 Ga0466713_086263 Ga0466713_086263_1016_1963 315
82 3300042602 Ga0466713_109457 Ga0466713_109457_8707_9654 315
83 3300042603 Ga0466714_097870 Ga0466714_097870_2024_2971 315
84 3300042603 Ga0466714_117493 Ga0466714_117493_21372_22319 315
85 3300042603 Ga0466714_151135 Ga0466714_151135_872_1819 315
86 3300042606 Ga0466719_327872 Ga0466719_327872_102_1049 315
87 3300042609 Ga0466722_076037 Ga0466722_076037_2354_3301 315
88 3300042610 Ga0466698_293476 Ga0466698_293476_129_1076 315
89 3300042612 Ga0466705_028707 Ga0466705_028707_4164_5111 315
90 3300042612 Ga0466705_145863 Ga0466705_145863_7613_8560 315
91 3300042612 Ga0466705_255953 Ga0466705_255953_127_1074 315
92 3300042614 Ga0466712_090584 Ga0466712_090584_84_1031 315
93 3300042616 Ga0466715_542902 Ga0466715_542902_1533_2480 315
94 3300042618 Ga0466723_042738 Ga0466723_042738_10189_11136 315
95 3300042618 Ga0466723_165155 Ga0466723_165155_27977_28924 315
96 3300042619 Ga0466726_380659 Ga0466726_380659_218_1165 315
97 3300042619 Ga0466726_390789 Ga0466726_390789_2112_3059 315
98 3300042624 Ga0466735_023041 Ga0466735_023041_853_1800 315
99 3300042636 Ga0466703_195295 Ga0466703_195295_1633_2580 315
100 3300042636 Ga0466703_270825 Ga0466703_270825_3106_4053 315
101 3300042643 Ga0466704_067267 Ga0466704_067267_7467_8414 315
102 3300042643 Ga0466704_149449 Ga0466704_149449_7235_8182 315
103 3300042643 Ga0466704_285742 Ga0466704_285742_4567_5514 315
104 3300042648 Ga0466709_133488 Ga0466709_133488_59993_60940 315
105 3300042652 Ga0466708_299612 Ga0466708_299612_2892_3839 315
106 3300042659 Ga0466733_032546 Ga0466733_032546_6461_7408 315
107 3300042659 Ga0466733_088268 Ga0466733_088268_1151_2098 315
108 3300042659 Ga0466733_129055 Ga0466733_129055_3718_4665 315
109 3300042659 Ga0466733_195509 Ga0466733_195509_8096_9043 315
110 iso_pr_bacteria 2820719201 2820719897 315
111 iso_pr_bacteria 2820757377 2820757819 315
112 iso_pr_bacteria 2820759988 2820761080 315
113 iso_pr_bacteria 2820778767 2820779821 315
114 iso_pr_bacteria 2910949487 2910951950 315
115 iso_pr_bacteria 2920168565 2920168827 315
116 iso_pr_bacteria 2940202316 2940204199 315
117 iso_pr_bacteria 3004667792 3004671341 315
118 3300000062 IMNBL1DRAFT_c0006878 IMNBL1DRAFT_00068782 316
119 3300002509 JGI24699J35502_11133749 JGI24699J35502_1113374910 316
120 3300002509 JGI24699J35502_11133880 JGI24699J35502_111338809 316
121 3300002509 JGI24699J35502_11134210 JGI24699J35502_1113421010 316
122 3300002834 JGI24696J40584_12950721 JGI24696J40584_129507212 316
123 3300005201 Ga0072941_1211758 Ga0072941_12117582 316
124 3300007130 Ga0104042_1000609 Ga0104042_10006092 316
125 3300007149 Ga0104040_1001439 Ga0104040_10014391 316
126 3300009784 Ga0123357_10001408 Ga0123357_1000140814 316
127 3300009784 Ga0123357_10007351 Ga0123357_100073513 316
128 3300009784 Ga0123357_10007413 Ga0123357_100074135 316
129 3300009784 Ga0123357_10028333 Ga0123357_100283332 316
130 3300009784 Ga0123357_10099302 Ga0123357_100993025 316
131 3300009784 Ga0123357_10106248 Ga0123357_101062482 316
132 3300009784 Ga0123357_10112556 Ga0123357_101125562 316
133 3300009784 Ga0123357_10411319 Ga0123357_104113192 316
134 3300010049 Ga0123356_10000522 Ga0123356_1000052219 316
135 3300010167 Ga0123353_10082090 Ga0123353_100820902 316
136 3300010167 Ga0123353_10266538 Ga0123353_102665382 316
137 3300010882 Ga0123354_10000687 Ga0123354_100006879 316
138 3300010882 Ga0123354_10022331 Ga0123354_100223312 316
139 3300010882 Ga0123354_10036143 Ga0123354_100361433 316
140 3300010882 Ga0123354_10140035 Ga0123354_101400352 316
141 3300042603 Ga0466714_061849 Ga0466714_061849_1353_2303 316
142 3300042603 Ga0466714_064217 Ga0466714_064217_693_1643 316
143 3300042603 Ga0466714_075627 Ga0466714_075627_152_1102 316
144 3300042616 Ga0466715_118812 Ga0466715_118812_1852_2802 316
145 iso_pu_archaea 2773857689 2774163895 317
146 3300000062 IMNBL1DRAFT_c0007499 IMNBL1DRAFT_00074993 318
147 3300042591 Ga0466692_067935 Ga0466692_067935_84485_85441 318
148 3300042601 Ga0466707_013194 Ga0466707_013194_814_1770 318
149 3300042619 Ga0466726_081656 Ga0466726_081656_11422_12378 318
150 3300042659 Ga0466733_151008 Ga0466733_151008_657_1616 319
151 3300042616 Ga0466715_081089 Ga0466715_081089_396_1358 320
152 3300010167 Ga0123353_10001341 Ga0123353_100013418 321
153 3300042590 Ga0466690_303437 Ga0466690_303437_511_1476 321
154 3300042609 Ga0466722_137996 Ga0466722_137996_140_1111 323
155 3300042652 Ga0466708_296454 Ga0466708_296454_18142_19113 323
156 3300010049 Ga0123356_10000518 Ga0123356_1000051813 324
157 3300042603 Ga0466714_158934 Ga0466714_158934_405_1379 324
158 3300042582 Ga0466657_046695 Ga0466657_046695_1587_2564 325
159 3300042655 Ga0466727_114271 Ga0466727_114271_1457_2434 325
160 3300010167 Ga0123353_10759176 Ga0123353_107591761 328
161 3300042590 Ga0466690_035694 Ga0466690_035694_3558_4553 331
162 3300042615 Ga0466711_042164 Ga0466711_042164_6396_7406 336
163 3300042616 Ga0466715_061300 Ga0466715_061300_1705_2724 339
164 3300042654 Ga0466725_168201 Ga0466725_168201_13894_15078 378

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00291 PALP Pyridoxal-phosphate dependent enzyme 12 299 0.92

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.9 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.