Protein Family IF00191

Metagenome Isolate
136 Members
48 Samples
126 Scaffolds
230.52 Avg Length

🧬 Representative Sequence

ID
3300000062|IMNBL1DRAFT_c0000125|IMNBL1DRAFT_000012546
Length
254 aa
Sequence
MMNFNFIINQSYFNFVSCYKTKIQMTNFYSREDKLFVAVDCIILGFKDHEINVLIIKRKFDPLKGGRSLMGGFVREKEALNDTVTRVVAEYTGVENMYMEQVGTYGEIERDLGERVITIVYYALIDMEKFDEKLQKKHDAEWININDVGTLVLDHNQILTDTIKLLQLRTATRPVGFNLLPEKFTLPQLQSLYEAIYQKPLDKRNFRKKVLEMDILERLEEKDKSSSKRGAYLYKFNKEKYDSLLEEGFYFSL*

📊 Sample Types

Isolate 7.3%
Metagenome 92.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 29.8%
Termitidae 17.0%
Blattidae 12.8%
Unclassified 8.5%
Rhinotermitidae 8.5%
Termopsidae 6.4%
Culicidae 6.4%
Passalidae 4.3%
Hydrophilidae 2.1%
Apidae 2.1%
Armadillidiidae 2.1%

🌳 Taxonomy

Archaea 0
Bacteria 130
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
2 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
3 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
4 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
5 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
6 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
7 2873776654 Pedobacter sp. HDW13 Isolate Hydrophilidae
8 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
9 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
10 8065497608 Tellurirhabdus bombi IE-0392 Isolate Apidae
11 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
12 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
13 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
14 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
15 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
16 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
17 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
18 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
19 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
20 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
21 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
22 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
23 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
24 3004677695 Bacteroides sp. 214 Isolate Blattidae
25 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
26 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
27 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
28 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
29 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
30 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
31 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
32 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
33 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
34 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
35 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
36 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
37 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
38 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
39 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
40 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
41 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
42 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
43 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
44 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
45 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
46 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
47 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
48 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_451616 3300042612 Bacteria 5616
2 Ga0466715_013663 3300042616 Unclassified 16200
3 Ga0466715_274249 3300042616 Bacteria 11120
4 Ga0466726_132684 3300042619 Bacteria 8466
5 Ga0466707_137647 3300042601 Bacteria 5043
6 Ga0466707_302666 3300042601 Unclassified 6353
7 Ga0466713_019038 3300042602 Bacteria 32605
8 Ga0466713_112154 3300042602 Bacteria 38459
9 Ga0466719_561083 3300042606 Bacteria 10483
10 Ga0160446_100006 3300012835 Bacteria 445354
11 Ga0466691_073635 3300042593 Bacteria 11602
12 Ga0466691_094074 3300042593 Bacteria 24969
13 Ga0466729_286958 3300042621 Bacteria 1293
14 Ga0466735_012966 3300042624 Bacteria 3462
15 Ga0466735_079622 3300042624 Bacteria 3451
16 Ga0466704_172969 3300042643 Bacteria 12357
17 Ga0466733_197920 3300042659 Bacteria 2844
18 Ga0466711_118037 3300042615 Bacteria 1715
19 Ga0466711_152207 3300042615 Bacteria 2161
20 Ga0466715_180477 3300042616 Bacteria 7005
21 Ga0466723_023862 3300042618 Bacteria 63714
22 Ga0466726_404308 3300042619 Bacteria 9418
23 Ga0466728_088307 3300042620 Bacteria 7862
24 Ga0466713_094496 3300042602 Bacteria 333875
25 Ga0466719_156435 3300042606 Bacteria 3666
26 Ga0160472_100653 3300012839 Bacteria 17639
27 Ga0466691_023961 3300042593 Bacteria 17173
28 Ga0466696_286046 3300042596 Bacteria 11686
29 Ga0466704_082791 3300042643 Bacteria 24873
30 Ga0466704_256491 3300042643 Bacteria 12118
31 Ga0466709_208869 3300042648 Bacteria 17257
32 Ga0466708_259041 3300042652 Bacteria 17584
33 2227545478 2225789004 Bacteria 2926
34 Ga0466697_158902 3300042611 Bacteria 1881
35 Ga0466715_109715 3300042616 Bacteria 9701
36 Ga0466715_256414 3300042616 Bacteria 4295
37 Ga0466713_052862 3300042602 Bacteria 42531
38 Ga0466716_140503 3300042605 Bacteria 8662
39 Ga0466722_254735 3300042609 Bacteria 6616
40 Ga0160453_100804 3300012814 Bacteria 16822
41 Ga0466656_258586 3300042550 Bacteria 1441
42 Ga0466690_228091 3300042590 Bacteria 31086
43 Ga0466703_031196 3300042636 Bacteria 8277
44 Ga0466703_060810 3300042636 Bacteria 10071
45 Ga0466703_063257 3300042636 Bacteria 21853
46 Ga0466703_275324 3300042636 Bacteria 50115
47 2227340517 2225789004 Bacteria 1158
48 2227489373 2225789004 Bacteria 4138
49 Ga0466705_279583 3300042612 Bacteria 6152
50 Ga0466733_035826 3300042659 Bacteria 26745
51 Ga0466733_098622 3300042659 Bacteria 1728
52 Ga0123357_10435667 3300009784 Unclassified 1153
53 Ga0466715_035702 3300042616 Bacteria 4005
54 Ga0466723_101690 3300042618 Bacteria 10611
55 Ga0466716_081450 3300042605 Bacteria 2137
56 Ga0466719_404744 3300042606 Bacteria 1677
57 Ga0466696_265860 3300042596 Bacteria 11142
58 Ga0466703_186119 3300042636 Bacteria 15613
59 Ga0466703_403611 3300042636 Bacteria 9899
60 Ga0466703_426220 3300042636 Bacteria 39212
61 Ga0466704_012096 3300042643 Bacteria 26124
62 Ga0466704_545894 3300042643 Bacteria 13346
63 Ga0466727_124195 3300042655 Bacteria 107642
64 Ga0466711_104172 3300042615 Bacteria 17590
65 Ga0466729_178010 3300042621 Bacteria 1330
66 Ga0466719_030097 3300042606 Bacteria 1529
67 Ga0466719_471103 3300042606 Bacteria 2096
68 Ga0160445_100207 3300012847 Bacteria 44365
69 Ga0466692_123090 3300042591 Bacteria 15817
70 Ga0466691_206225 3300042593 Bacteria 5938
71 Ga0466703_220245 3300042636 Bacteria 1741
72 Ga0466704_106931 3300042643 Bacteria 4779
73 Ga0466704_195138 3300042643 Bacteria 14925
74 Ga0466709_404800 3300042648 Bacteria 4349
75 Ga0466725_089174 3300042654 Bacteria 11445
76 IMNBL1DRAFT_c0000125 3300000062 Bacteria 68757
77 Ga0068305_10013323 3300005083 Bacteria 8419
78 Ga0466733_010915 3300042659 Unclassified 1972
79 Ga0466711_033361 3300042615 Bacteria 49617
80 Ga0466711_265445 3300042615 Bacteria 9284
81 Ga0466715_047111 3300042616 Bacteria 5769
82 Ga0466723_221705 3300042618 Bacteria 9345
83 Ga0466707_009170 3300042601 Bacteria 5684
84 Ga0466707_089415 3300042601 Unclassified 7230
85 Ga0466707_116649 3300042601 Unclassified 1474
86 Ga0466716_499897 3300042605 Bacteria 17414
87 Ga0466722_073126 3300042609 Bacteria 1178
88 Ga0466735_005040 3300042624 Bacteria 4201
89 Ga0466735_235419 3300042624 Bacteria 1500
90 Ga0466704_011408 3300042643 Bacteria 2297
91 Ga0466704_196130 3300042643 Bacteria 1640
92 Ga0466709_164307 3300042648 Bacteria 50982
93 Ga0466708_083525 3300042652 Bacteria 1198
94 Ga0466727_105126 3300042655 Bacteria 17217
95 Ga0466727_308857 3300042655 Bacteria 2912
96 IMNBL1DRAFT_c0002398 3300000062 Bacteria 13047
97 Ga0466715_057348 3300042616 Bacteria 36717
98 Ga0466707_045810 3300042601 Bacteria 3043
99 Ga0466714_104394 3300042603 Bacteria 4379
100 Ga0466735_046963 3300042624 Bacteria 3941
101 Ga0466735_076481 3300042624 Bacteria 1499
102 2227652397 2225789004 Bacteria 10757
103 Ga0466733_156676 3300042659 Bacteria 5578
104 Ga0123354_10142833 3300010882 Bacteria 2949
105 Ga0466711_337203 3300042615 Bacteria 5009
106 Ga0466711_480807 3300042615 Bacteria 7985
107 Ga0466715_038410 3300042616 Bacteria 19135
108 Ga0466715_141137 3300042616 Bacteria 11682
109 Ga0466728_218501 3300042620 Bacteria 3266
110 Ga0466728_279239 3300042620 Bacteria 3212
111 Ga0466728_284552 3300042620 Bacteria 12713
112 Ga0466707_076992 3300042601 Bacteria 3972
113 Ga0466707_082408 3300042601 Bacteria 3566
114 Ga0466707_104581 3300042601 Bacteria 5436
115 Ga0466707_164963 3300042601 Bacteria 15338
116 Ga0160460_101249 3300012845 Bacteria 9373
117 Ga0466690_270167 3300042590 Bacteria 35972
118 Ga0466692_063097 3300042591 Bacteria 2249
119 Ga0466692_117004 3300042591 Bacteria 3220
120 Ga0466696_415123 3300042596 Bacteria 1146
121 Ga0466703_132942 3300042636 Bacteria 7817
122 Ga0466704_081344 3300042643 Bacteria 118045
123 Ga0466704_204146 3300042643 Bacteria 4499
124 Ga0466708_139687 3300042652 Bacteria 1127
125 IMNBL1DRAFT_c0002054 3300000062 Bacteria 14385
126 JGI24702J35022_10438377 3300002462 Bacteria 794

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042593 Ga0466691_094074 Ga0466691_094074_2449_3090 213
2 3300042606 Ga0466719_030097 Ga0466719_030097_588_1250 220
3 3300042616 Ga0466715_057348 Ga0466715_057348_32071_32736 221
4 2225789004 2227340517 2227787432 225
5 3300042593 Ga0466691_073635 Ga0466691_073635_2989_3666 225
6 3300042550 Ga0466656_258586 Ga0466656_258586_566_1249 227
7 3300042596 Ga0466696_286046 Ga0466696_286046_9934_10617 227
8 3300042603 Ga0466714_104394 Ga0466714_104394_2047_2730 227
9 3300042636 Ga0466703_403611 Ga0466703_403611_6834_7517 227
10 3300042643 Ga0466704_011408 Ga0466704_011408_825_1508 227
11 3300042659 Ga0466733_098622 Ga0466733_098622_777_1460 227
12 3300002462 JGI24702J35022_10438377 JGI24702J35022_104383771 228
13 3300042593 Ga0466691_023961 Ga0466691_023961_15556_16242 228
14 3300042593 Ga0466691_206225 Ga0466691_206225_4847_5533 228
15 2225789004 2227545478 2228070689 229
16 3300042590 Ga0466690_228091 Ga0466690_228091_21407_22096 229
17 3300042591 Ga0466692_117004 Ga0466692_117004_1776_2465 229
18 3300042596 Ga0466696_265860 Ga0466696_265860_9956_10645 229
19 3300042601 Ga0466707_009170 Ga0466707_009170_2881_3570 229
20 3300042601 Ga0466707_045810 Ga0466707_045810_2344_3033 229
21 3300042601 Ga0466707_076992 Ga0466707_076992_113_802 229
22 3300042601 Ga0466707_082408 Ga0466707_082408_1122_1811 229
23 3300042601 Ga0466707_089415 Ga0466707_089415_2962_3651 229
24 3300042601 Ga0466707_116649 Ga0466707_116649_222_911 229
25 3300042601 Ga0466707_137647 Ga0466707_137647_4174_4863 229
26 3300042601 Ga0466707_164963 Ga0466707_164963_89_778 229
27 3300042605 Ga0466716_081450 Ga0466716_081450_940_1629 229
28 3300042606 Ga0466719_156435 Ga0466719_156435_550_1239 229
29 3300042609 Ga0466722_073126 Ga0466722_073126_410_1099 229
30 3300042612 Ga0466705_279583 Ga0466705_279583_2628_3317 229
31 3300042615 Ga0466711_033361 Ga0466711_033361_2034_2723 229
32 3300042615 Ga0466711_118037 Ga0466711_118037_888_1577 229
33 3300042615 Ga0466711_152207 Ga0466711_152207_198_887 229
34 3300042615 Ga0466711_265445 Ga0466711_265445_2735_3424 229
35 3300042615 Ga0466711_337203 Ga0466711_337203_2437_3126 229
36 3300042615 Ga0466711_480807 Ga0466711_480807_6510_7199 229
37 3300042616 Ga0466715_109715 Ga0466715_109715_3638_4327 229
38 3300042618 Ga0466723_101690 Ga0466723_101690_551_1240 229
39 3300042619 Ga0466726_132684 Ga0466726_132684_3019_3708 229
40 3300042621 Ga0466729_178010 Ga0466729_178010_614_1303 229
41 3300042621 Ga0466729_286958 Ga0466729_286958_577_1266 229
42 3300042624 Ga0466735_005040 Ga0466735_005040_2687_3376 229
43 3300042624 Ga0466735_046963 Ga0466735_046963_1472_2161 229
44 3300042624 Ga0466735_076481 Ga0466735_076481_408_1097 229
45 3300042636 Ga0466703_031196 Ga0466703_031196_6737_7426 229
46 3300042636 Ga0466703_060810 Ga0466703_060810_1274_1963 229
47 3300042636 Ga0466703_132942 Ga0466703_132942_448_1137 229
48 3300042636 Ga0466703_186119 Ga0466703_186119_13746_14435 229
49 3300042636 Ga0466703_220245 Ga0466703_220245_589_1278 229
50 3300042643 Ga0466704_012096 Ga0466704_012096_2661_3350 229
51 3300042643 Ga0466704_082791 Ga0466704_082791_23988_24677 229
52 3300042643 Ga0466704_106931 Ga0466704_106931_4075_4764 229
53 3300042643 Ga0466704_196130 Ga0466704_196130_755_1444 229
54 3300042643 Ga0466704_204146 Ga0466704_204146_3338_4027 229
55 3300042643 Ga0466704_256491 Ga0466704_256491_6649_7338 229
56 3300042648 Ga0466709_208869 Ga0466709_208869_503_1192 229
57 3300042648 Ga0466709_404800 Ga0466709_404800_52_741 229
58 3300042652 Ga0466708_083525 Ga0466708_083525_23_712 229
59 3300042652 Ga0466708_259041 Ga0466708_259041_4370_5059 229
60 3300042659 Ga0466733_035826 Ga0466733_035826_13532_14221 229
61 3300042659 Ga0466733_197920 Ga0466733_197920_411_1100 229
62 iso_pr_bacteria 2967483437 2967486499 229
63 3300000062 IMNBL1DRAFT_c0002398 IMNBL1DRAFT_00023986 230
64 3300042590 Ga0466690_270167 Ga0466690_270167_15004_15696 230
65 3300042596 Ga0466696_415123 Ga0466696_415123_149_841 230
66 3300042601 Ga0466707_104581 Ga0466707_104581_2420_3112 230
67 3300042601 Ga0466707_302666 Ga0466707_302666_235_927 230
68 3300042602 Ga0466713_019038 Ga0466713_019038_26914_27606 230
69 3300042602 Ga0466713_052862 Ga0466713_052862_35350_36042 230
70 3300042602 Ga0466713_094496 Ga0466713_094496_274554_275246 230
71 3300042602 Ga0466713_112154 Ga0466713_112154_35142_35834 230
72 3300042605 Ga0466716_140503 Ga0466716_140503_882_1574 230
73 3300042606 Ga0466719_404744 Ga0466719_404744_686_1378 230
74 3300042606 Ga0466719_471103 Ga0466719_471103_757_1449 230
75 3300042606 Ga0466719_561083 Ga0466719_561083_1304_1996 230
76 3300042611 Ga0466697_158902 Ga0466697_158902_477_1169 230
77 3300042612 Ga0466705_451616 Ga0466705_451616_1883_2575 230
78 3300042615 Ga0466711_104172 Ga0466711_104172_5064_5756 230
79 3300042616 Ga0466715_013663 Ga0466715_013663_14190_14882 230
80 3300042616 Ga0466715_035702 Ga0466715_035702_2185_2877 230
81 3300042616 Ga0466715_038410 Ga0466715_038410_4331_5023 230
82 3300042616 Ga0466715_141137 Ga0466715_141137_4634_5326 230
83 3300042616 Ga0466715_256414 Ga0466715_256414_827_1519 230
84 3300042618 Ga0466723_221705 Ga0466723_221705_625_1317 230
85 3300042619 Ga0466726_404308 Ga0466726_404308_8579_9271 230
86 3300042620 Ga0466728_088307 Ga0466728_088307_2262_2954 230
87 3300042620 Ga0466728_218501 Ga0466728_218501_184_876 230
88 3300042620 Ga0466728_279239 Ga0466728_279239_2306_2998 230
89 3300042620 Ga0466728_284552 Ga0466728_284552_535_1227 230
90 3300042624 Ga0466735_012966 Ga0466735_012966_1896_2588 230
91 3300042624 Ga0466735_079622 Ga0466735_079622_628_1320 230
92 3300042624 Ga0466735_235419 Ga0466735_235419_542_1234 230
93 3300042636 Ga0466703_275324 Ga0466703_275324_38804_39496 230
94 3300042636 Ga0466703_426220 Ga0466703_426220_6429_7121 230
95 3300042643 Ga0466704_081344 Ga0466704_081344_113748_114440 230
96 3300042643 Ga0466704_172969 Ga0466704_172969_2770_3462 230
97 3300042643 Ga0466704_195138 Ga0466704_195138_14077_14769 230
98 3300042648 Ga0466709_164307 Ga0466709_164307_6160_6852 230
99 3300042652 Ga0466708_139687 Ga0466708_139687_122_814 230
100 3300042654 Ga0466725_089174 Ga0466725_089174_5421_6113 230
101 3300042655 Ga0466727_105126 Ga0466727_105126_4778_5470 230
102 3300042655 Ga0466727_124195 Ga0466727_124195_64318_65010 230
103 3300042655 Ga0466727_308857 Ga0466727_308857_455_1147 230
104 3300042659 Ga0466733_010915 Ga0466733_010915_225_917 230
105 3300042659 Ga0466733_156676 Ga0466733_156676_2723_3415 230
106 iso_pr_bacteria 2910942425 2910944261 230
107 iso_pr_bacteria 2910949487 2910951067 230
108 iso_pr_bacteria 2940248789 2940249660 230
109 iso_pr_bacteria 2940253009 2940253770 230
110 iso_pr_bacteria 2940257232 2940257625 230
111 iso_pr_bacteria 8100166142 8100170608 230
112 3300005083 Ga0068305_10013323 Ga0068305_100133236 231
113 3300009784 Ga0123357_10435667 Ga0123357_104356671 231
114 3300010882 Ga0123354_10142833 Ga0123354_101428332 231
115 3300042591 Ga0466692_123090 Ga0466692_123090_13858_14553 231
116 3300042616 Ga0466715_047111 Ga0466715_047111_3055_3750 231
117 3300042636 Ga0466703_063257 Ga0466703_063257_20767_21462 231
118 3300042643 Ga0466704_545894 Ga0466704_545894_2782_3477 231
119 2225789004 2227489373 2227959491 232
120 2225789004 2227652397 2228248659 232
121 3300012845 Ga0160460_101249 Ga0160460_1012492 232
122 3300042616 Ga0466715_274249 Ga0466715_274249_6421_7119 232
123 3300000062 IMNBL1DRAFT_c0002054 IMNBL1DRAFT_000205410 233
124 3300012814 Ga0160453_100804 Ga0160453_10080417 233
125 3300012835 Ga0160446_100006 Ga0160446_100006275 233
126 3300012839 Ga0160472_100653 Ga0160472_1006535 233
127 3300042609 Ga0466722_254735 Ga0466722_254735_3587_4288 233
128 iso_pr_bacteria 2873776654 2873781576 233
129 iso_pr_bacteria 8065497608 8065498777 233
130 3300042605 Ga0466716_499897 Ga0466716_499897_10890_11594 234
131 3300012847 Ga0160445_100207 Ga0160445_10020729 236
132 iso_pr_bacteria 3004677695 3004678571 244
133 3300042618 Ga0466723_023862 Ga0466723_023862_2311_3054 247
134 3300042616 Ga0466715_180477 Ga0466715_180477_2805_3560 251
135 3300000062 IMNBL1DRAFT_c0000125 IMNBL1DRAFT_000012546 254
136 3300042591 Ga0466692_063097 Ga0466692_063097_431_1324 297

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF21906 NrtR_WHD NrtR DNA-binding winged helix domain 176 236 0.99
PF19368 AraR_C AraR C-terminal winged HTH domain 174 249 0.92
PF00293 NUDIX NUDIX domain 36 156 0.74

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF19368 GO:0003677 DNA binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.77 0.83 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.