Protein Family IF00171

Metagenome Isolate
145 Members
47 Samples
126 Scaffolds
1473.03 Avg Length

🧬 Representative Sequence

ID
2225789004|2227663513|2228265340
Length
1532 aa
Sequence
MLQKNLYHPDYEHDACGVGLLVDIYGKKTHDIVEKGLQVLENMVHRGAESADNKTGDGAGIMLQIPHEFILLQGIPVPEKGRYGTGLIFLPKNDEEASLCMDIVESVLEQEELRLLAVRDVQVCSDVLGEISKGNEPAIKQIFVVDSSSSLEFRLYVARKKIEKKILKSAIPNRRSFYVVSLSSQRIIYKGMLTSTQLREYFPDLVNPYFTSGLALVHSRFSTNTFPSWDLAQPFRFLGHNGEINTIRGNRYWMEAREELFGASSVESGKWRSKKKKLSTLNSQLSTKEDSLLSTLNSESIFPIIQQGMSDSASLDNVLEFLVMSGKSLPHALAMLVPESMNDKNPISPELKAFYEYHSLLMEPWDGPATILFTDGRYAGGMLDRNGLRPARYFITKNDIMVVASEAGVLPFDASEIRKKGRLQPGKMLMVDMQEGTVKYDPELKAELANAFPYAEWLSENRILLSNISSGRTVRYTVDNFDAHLRAFGYSKEDVERIILPMTIDGKEPVGSMGNDTPLAVLSDKPQLLFNYFRQLFAQVTNPPIDPIREELVMSLSLYIGCQDTNLLTPSPDLCKMVKLESPVINNDGLDILTHLGYKHFRTKVLPMLFDATASDPVDSMAKALTLLCQQAEEAVVEEYNYIILSDRGINEKMAAIPSLLAVSAVHHHLIEKRKRMQIAIVVETAEAREVMHFALLFGFGASAVNPYMAFAILDEKVKSHEIQLDYHTAEKHYIKSINKGLLKVLSKMGISTLRSYRGAQIFEAVGISQALLDRYFRGMTSPIGGIELDDIVRDVLIAHSKAFSPLSTLNSQLFTEGVYSYRKGGEVHAWNPETISKLQIATRLGDYSKFKEYTRIVDEKIQPIFLRDFLTYKRAATGPANNTNKAALEVDVVGNSAYTRKPISIDEVEPVEAITKRFVTGAMSFGSISKEAHEAMAIALNILKGRSNTGEGGEDPERFKVGEDGLNRRSAIKQIASGRFGVTAEYLVNADELQIKVAQGAKPGEGGQLPGFKVNKIIAQTRHSIPGITLISPPPHHDIYSIEDLAQLIFDLKNINPQAEISVKLVAESGVGTIAAGVAKAKADRIVISGSEGGTGASPVSSIRHAGSAGELGLAEVQQTLVMNNLRGNVRLQADGQLKTGKDIITSALLGAEEFGFATSALIVLGCVMMRKCHLNTCPVGVATQDEKLRARFKGKHEYLVNFMTFLAEEVREHLAQMGFRSMDEIIGRADLLEKRCFQEENEDASCNHKVAKLNLSKLTYFADCDNDIRCTKTQDHKIDKVLDRELIKKAKLSIEKALPVEMKMQIANTDRSVGAMLSGEVAKKYGNTGLPDGTIVTKLCGSAGQSFGAFLAGGITFRLEGEANDYLGKGLSGXRIIVVPPHNSTFPPEENIIAGNTLLYGATSGEVYINGMVGERFCVRNSGAIAVVEGVGDHCCEYMLDMDGRFDYFCNMEMIELTLVEDKTDNRELHRLISAHAGYTQSPLAKKILADWDNYLKHFIKVTPIEYKKVLQEEKIEAINKRIAQVEHDY

📊 Sample Types

Isolate 13.1%
Metagenome 86.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 30.4%
Unclassified 15.2%
Blattidae 15.2%
Apidae 10.9%
Rhinotermitidae 8.7%
Termopsidae 6.5%
Hydrophilidae 4.3%
Passalidae 4.3%
Hodotermitidae 2.2%
Termitidae 2.2%

🌳 Taxonomy

Archaea 1
Bacteria 141
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
2 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
3 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
4 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
5 2785510743 Apibacter sp. ESL0404 Isolate Apidae
6 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
7 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
8 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
9 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
10 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
11 2799112231 Apibacter sp. ESL0432 Isolate Unclassified
12 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
13 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
14 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
15 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
16 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
17 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
18 2832343623 Apibacter adventoris wkB180 Isolate Apidae
19 2923982719 Parabacteroides sp. 52 Isolate Blattidae
20 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
21 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
22 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
23 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
24 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
25 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
26 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
27 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
28 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
29 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
30 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
31 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
32 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
33 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
34 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
35 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
36 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
37 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
38 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
39 2832372155 Apibacter adventoris wkB301 Isolate Apidae
40 2920168565 Paludibacter sp. 221 Isolate Blattidae
41 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
42 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
43 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
44 2832298047 Apibacter sp. wkB309 Isolate Apidae
45 643348524 Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 Isolate Unclassified
46 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
47 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_055877 3300042612 Bacteria 9899
2 Ga0466705_101004 3300042612 Bacteria 23546
3 Ga0466711_454301 3300042615 Bacteria 18317
4 Ga0466715_044260 3300042616 Bacteria 13404
5 Ga0466715_231804 3300042616 Bacteria 12015
6 Ga0466723_026213 3300042618 Bacteria 14458
7 Ga0466708_155893 3300042652 Bacteria 9404
8 Ga0466708_259456 3300042652 Bacteria 10354
9 Ga0466727_298515 3300042655 Bacteria 5481
10 Ga0466690_169422 3300042590 Bacteria 39612
11 Ga0466690_310829 3300042590 Bacteria 5001
12 Ga0466696_139050 3300042596 Bacteria 18174
13 2227663513 2225789004 Bacteria 10408
14 IMNBL1DRAFT_c0001562 3300000062 Bacteria 17042
15 Ga0466706_012301 3300042599 Bacteria 8050
16 Ga0466716_003945 3300042605 Bacteria 9817
17 Ga0466716_102876 3300042605 Bacteria 11206
18 Ga0466716_449356 3300042605 Bacteria 31338
19 Ga0466722_024099 3300042609 Bacteria 30187
20 Ga0466722_096505 3300042609 Bacteria 4798
21 Ga0466715_038459 3300042616 Bacteria 4844
22 Ga0466715_232894 3300042616 Bacteria 30718
23 Ga0466723_322373 3300042618 Bacteria 11767
24 Ga0466728_134519 3300042620 Bacteria 6706
25 Ga0466735_167418 3300042624 Bacteria 4917
26 Ga0466735_194257 3300042624 Bacteria 7871
27 Ga0466704_023495 3300042643 Bacteria 52577
28 Ga0466690_022164 3300042590 Bacteria 20369
29 Ga0466692_121438 3300042591 Bacteria 29354
30 IMNBL1DRAFT_c0000101 3300000062 Bacteria 74878
31 JGI24699J35502_11134043 3300002509 Bacteria 26521
32 Ga0072941_1327505 3300005201 Bacteria 5652
33 Ga0466707_010858 3300042601 Bacteria 10766
34 Ga0466707_228601 3300042601 Bacteria 32570
35 Ga0466713_036041 3300042602 Bacteria 5395
36 Ga0466713_047384 3300042602 Bacteria 14775
37 Ga0466713_119093 3300042602 Bacteria 59442
38 Ga0466719_418728 3300042606 Bacteria 36150
39 Ga0466711_246639 3300042615 Bacteria 53228
40 Ga0466715_069614 3300042616 Bacteria 8086
41 Ga0466726_142521 3300042619 Bacteria 18957
42 Ga0466729_064521 3300042621 Bacteria 21158
43 Ga0466729_117371 3300042621 Bacteria 7993
44 Ga0466703_234712 3300042636 Bacteria 20169
45 Ga0466704_571664 3300042643 Bacteria 6398
46 Ga0466708_019276 3300042652 Bacteria 21307
47 Ga0466727_092300 3300042655 Bacteria 29838
48 Ga0466727_121354 3300042655 Bacteria 12082
49 Ga0466692_192934 3300042591 Bacteria 5946
50 Ga0466691_056156 3300042593 Bacteria 16811
51 Ga0466691_124423 3300042593 Bacteria 23661
52 Ga0466706_037013 3300042599 Bacteria 55068
53 Ga0466707_112015 3300042601 Bacteria 23228
54 Ga0466707_138418 3300042601 Bacteria 13284
55 Ga0466707_144970 3300042601 Bacteria 107655
56 Ga0466713_003223 3300042602 Bacteria 11508
57 Ga0466711_067051 3300042615 Bacteria 5209
58 Ga0466723_090431 3300042618 Bacteria 14522
59 Ga0466709_176307 3300042648 Bacteria 46103
60 Ga0466708_118951 3300042652 Bacteria 18039
61 Ga0466690_148568 3300042590 Bacteria 13283
62 Ga0466691_001910 3300042593 Bacteria 14434
63 Ga0466691_170023 3300042593 Bacteria 23340
64 Ga0466696_004261 3300042596 Bacteria 18622
65 Ga0466696_396464 3300042596 Bacteria 5547
66 2227158583 2225789004 Bacteria 8395
67 Ga0466707_004458 3300042601 Bacteria 15021
68 Ga0466716_098082 3300042605 Bacteria 9599
69 Ga0466719_089595 3300042606 Unclassified 7177
70 Ga0466722_056814 3300042609 Bacteria 80468
71 Ga0466705_265643 3300042612 Bacteria 15146
72 Ga0466705_514418 3300042612 Bacteria 26386
73 Ga0466715_219381 3300042616 Bacteria 46408
74 Ga0466715_582189 3300042616 Bacteria 18313
75 Ga0466723_102275 3300042618 Bacteria 9131
76 Ga0466704_024708 3300042643 Bacteria 42885
77 Ga0466704_055758 3300042643 Unclassified 13348
78 Ga0466704_177078 3300042643 Bacteria 55313
79 Ga0466704_524377 3300042643 Bacteria 20150
80 Ga0466708_015517 3300042652 Bacteria 5785
81 Ga0466727_104042 3300042655 Bacteria 28997
82 Ga0466690_005517 3300042590 Bacteria 5615
83 HBC_ctgsDRAFT_1000545 3300000333 Bacteria 8380
84 Ga0466706_063924 3300042599 Bacteria 13148
85 Ga0466706_070140 3300042599 Bacteria 35282
86 Ga0466713_145668 3300042602 Bacteria 9598
87 Ga0466716_042283 3300042605 Bacteria 46440
88 Ga0466722_206312 3300042609 Bacteria 50435
89 Ga0466722_252821 3300042609 Bacteria 235840
90 Ga0466726_104123 3300042619 Unclassified 6978
91 Ga0466703_257396 3300042636 Bacteria 15106
92 Ga0466704_150725 3300042643 Bacteria 13396
93 Ga0466709_345527 3300042648 Bacteria 65587
94 Ga0466709_361113 3300042648 Bacteria 7904
95 Ga0466708_275929 3300042652 Bacteria 19874
96 Ga0466708_299349 3300042652 Bacteria 43943
97 Ga0466690_024417 3300042590 Bacteria 8380
98 Ga0466690_048635 3300042590 Bacteria 14569
99 Ga0466692_059014 3300042591 Bacteria 6928
100 Ga0466692_066865 3300042591 Bacteria 168349
101 Ga0466696_293717 3300042596 Bacteria 8555
102 Ga0466706_122623 3300042599 Bacteria 44263
103 Ga0466716_398226 3300042605 Bacteria 12743
104 Ga0466719_155715 3300042606 Bacteria 13693
105 Ga0466705_329915 3300042612 Bacteria 17803
106 Ga0466728_030268 3300042620 Bacteria 18228
107 Ga0466703_066889 3300042636 Bacteria 4616
108 Ga0466703_097395 3300042636 Bacteria 6949
109 Ga0466690_008835 3300042590 Bacteria 27085
110 Ga0466696_214108 3300042596 Bacteria 16171
111 Ga0466705_503724 3300042612 Bacteria 14377
112 Ga0466711_013368 3300042615 Bacteria 5277
113 Ga0466715_077430 3300042616 Bacteria 19859
114 Ga0466715_117809 3300042616 Bacteria 8696
115 Ga0466723_105098 3300042618 Bacteria 22389
116 Ga0466723_113798 3300042618 Bacteria 6033
117 Ga0466723_370758 3300042618 Bacteria 8033
118 Ga0466726_123595 3300042619 Bacteria 23616
119 Ga0466703_003821 3300042636 Bacteria 7568
120 Ga0466704_137650 3300042643 Bacteria 21300
121 Ga0466704_201534 3300042643 Bacteria 8199
122 IMNBL1DRAFT_c0000014 3300000062 Archaea 180092
123 Ga0466713_152619 3300042602 Bacteria 16856
124 Ga0466716_119960 3300042605 Bacteria 7052
125 Ga0466719_008701 3300042606 Bacteria 13516
126 Ga0466722_090408 3300042609 Bacteria 5690

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042655 Ga0466727_298515 Ga0466727_298515_39_3860 1247
2 3300042648 Ga0466709_361113 Ga0466709_361113_3894_7835 1287
3 3300042621 Ga0466729_117371 Ga0466729_117371_3890_7921 1317
4 3300042609 Ga0466722_090408 Ga0466722_090408_1429_5649 1381
5 3300042652 Ga0466708_275929 Ga0466708_275929_7046_11533 1428
6 3300042605 Ga0466716_102876 Ga0466716_102876_4859_9346 1431
7 3300042643 Ga0466704_571664 Ga0466704_571664_1727_6169 1436
8 3300042643 Ga0466704_201534 Ga0466704_201534_3681_8189 1442
9 3300042596 Ga0466696_396464 Ga0466696_396464_283_4770 1443
10 3300042609 Ga0466722_206312 Ga0466722_206312_43485_47906 1443
11 3300042652 Ga0466708_299349 Ga0466708_299349_32083_36585 1443
12 3300042602 Ga0466713_036041 Ga0466713_036041_415_4899 1444
13 3300042601 Ga0466707_004458 Ga0466707_004458_4041_8561 1445
14 3300042618 Ga0466723_370758 Ga0466723_370758_31_4455 1445
15 3300042605 Ga0466716_098082 Ga0466716_098082_3827_8344 1446
16 3300042612 Ga0466705_055877 Ga0466705_055877_878_5398 1446
17 3300000333 HBC_ctgsDRAFT_1000545 HBC_ctgsDRAFT_10005453 1448
18 3300042590 Ga0466690_008835 Ga0466690_008835_15937_20457 1449
19 3300042591 Ga0466692_192934 Ga0466692_192934_38_4555 1450
20 3300000062 IMNBL1DRAFT_c0000014 IMNBL1DRAFT_0000014139 1452
21 3300042616 Ga0466715_044260 Ga0466715_044260_4348_8865 1452
22 3300042615 Ga0466711_454301 Ga0466711_454301_12203_16693 1453
23 3300042609 Ga0466722_056814 Ga0466722_056814_21101_25588 1454
24 3300042593 Ga0466691_001910 Ga0466691_001910_1729_6222 1455
25 3300042605 Ga0466716_398226 Ga0466716_398226_3008_7540 1455
26 3300042602 Ga0466713_047384 Ga0466713_047384_2928_7445 1458
27 3300042605 Ga0466716_042283 Ga0466716_042283_23041_27522 1458
28 3300042591 Ga0466692_059014 Ga0466692_059014_1735_6252 1460
29 3300042609 Ga0466722_024099 Ga0466722_024099_14654_19132 1460
30 3300002509 JGI24699J35502_11134043 JGI24699J35502_1113404312 1461
31 3300042599 Ga0466706_012301 Ga0466706_012301_2160_6662 1461
32 3300042643 Ga0466704_177078 Ga0466704_177078_49642_54168 1462
33 3300042590 Ga0466690_024417 Ga0466690_024417_46_4482 1464
34 3300042593 Ga0466691_056156 Ga0466691_056156_11279_15715 1464
35 3300042596 Ga0466696_004261 Ga0466696_004261_2885_7417 1465
36 3300042636 Ga0466703_257396 Ga0466703_257396_5228_9709 1465
37 3300042652 Ga0466708_118951 Ga0466708_118951_4246_8739 1465
38 3300042596 Ga0466696_139050 Ga0466696_139050_5525_10033 1466
39 3300042599 Ga0466706_063924 Ga0466706_063924_6861_11342 1466
40 3300042602 Ga0466713_145668 Ga0466713_145668_3586_8121 1466
41 3300042616 Ga0466715_077430 Ga0466715_077430_5577_10058 1466
42 3300042616 Ga0466715_219381 Ga0466715_219381_25674_30155 1466
43 3300042593 Ga0466691_170023 Ga0466691_170023_17357_21838 1467
44 3300042621 Ga0466729_064521 Ga0466729_064521_1781_6268 1467
45 3300042643 Ga0466704_137650 Ga0466704_137650_2291_6772 1467
46 3300042602 Ga0466713_119093 Ga0466713_119093_32015_36514 1468
47 3300005201 Ga0072941_1327505 Ga0072941_13275051 1469
48 3300042590 Ga0466690_048635 Ga0466690_048635_3276_7811 1469
49 3300042591 Ga0466692_121438 Ga0466692_121438_338_4867 1469
50 3300042601 Ga0466707_112015 Ga0466707_112015_6297_10820 1469
51 3300042605 Ga0466716_449356 Ga0466716_449356_2175_6662 1469
52 3300042616 Ga0466715_069614 Ga0466715_069614_2573_7060 1469
53 3300042612 Ga0466705_514418 Ga0466705_514418_13899_18395 1470
54 3300042615 Ga0466711_067051 Ga0466711_067051_26_4519 1470
55 2225789004 2227158583 2227567264 1471
56 3300042620 Ga0466728_134519 Ga0466728_134519_1041_5534 1471
57 3300042652 Ga0466708_259456 Ga0466708_259456_3550_8049 1471
58 3300042612 Ga0466705_101004 Ga0466705_101004_7115_11683 1472
59 3300042590 Ga0466690_310829 Ga0466690_310829_147_4649 1473
60 3300042606 Ga0466719_155715 Ga0466719_155715_7486_11985 1473
61 3300042618 Ga0466723_090431 Ga0466723_090431_3417_7904 1473
62 3300042643 Ga0466704_024708 Ga0466704_024708_1909_6405 1473
63 3300042643 Ga0466704_524377 Ga0466704_524377_12258_16760 1473
64 3300042655 Ga0466727_092300 Ga0466727_092300_24108_28610 1473
65 3300042619 Ga0466726_104123 Ga0466726_104123_719_5245 1474
66 3300042648 Ga0466709_345527 Ga0466709_345527_12086_16570 1474
67 3300042618 Ga0466723_113798 Ga0466723_113798_1211_5701 1476
68 3300042620 Ga0466728_030268 Ga0466728_030268_9178_13665 1476
69 3300042652 Ga0466708_015517 Ga0466708_015517_10_4500 1477
70 3300042601 Ga0466707_138418 Ga0466707_138418_316_4830 1478
71 3300042612 Ga0466705_503724 Ga0466705_503724_9599_14128 1478
72 3300042618 Ga0466723_105098 Ga0466723_105098_11674_16170 1478
73 3300042624 Ga0466735_194257 Ga0466735_194257_3108_7625 1478
74 3300042636 Ga0466703_003821 Ga0466703_003821_510_5027 1478
75 3300042643 Ga0466704_150725 Ga0466704_150725_8029_12561 1478
76 3300042609 Ga0466722_096505 Ga0466722_096505_95_4612 1479
77 3300042618 Ga0466723_102275 Ga0466723_102275_4247_8758 1479
78 3300042636 Ga0466703_234712 Ga0466703_234712_11801_16333 1479
79 3300042648 Ga0466709_176307 Ga0466709_176307_11953_16473 1479
80 3300000062 IMNBL1DRAFT_c0001562 IMNBL1DRAFT_000156210 1480
81 3300042590 Ga0466690_022164 Ga0466690_022164_7984_12480 1480
82 3300042615 Ga0466711_246639 Ga0466711_246639_20461_24984 1480
83 3300042643 Ga0466704_055758 Ga0466704_055758_8565_13067 1480
84 3300042590 Ga0466690_169422 Ga0466690_169422_8102_12625 1481
85 3300042591 Ga0466692_066865 Ga0466692_066865_27082_31608 1481
86 3300042593 Ga0466691_124423 Ga0466691_124423_374_4897 1481
87 3300042602 Ga0466713_003223 Ga0466713_003223_3798_8321 1481
88 3300042605 Ga0466716_119960 Ga0466716_119960_1225_5712 1481
89 3300042606 Ga0466719_008701 Ga0466719_008701_8615_13138 1481
90 3300042606 Ga0466719_089595 Ga0466719_089595_498_5021 1481
91 3300042609 Ga0466722_252821 Ga0466722_252821_153425_157948 1481
92 3300042616 Ga0466715_038459 Ga0466715_038459_168_4691 1481
93 3300042616 Ga0466715_582189 Ga0466715_582189_9778_14301 1481
94 3300042618 Ga0466723_026213 Ga0466723_026213_1891_6414 1481
95 3300042636 Ga0466703_097395 Ga0466703_097395_125_4648 1481
96 3300000062 IMNBL1DRAFT_c0000101 IMNBL1DRAFT_00001012 1482
97 3300042599 Ga0466706_070140 Ga0466706_070140_19883_24412 1482
98 3300042619 Ga0466726_142521 Ga0466726_142521_8754_13277 1482
99 3300042596 Ga0466696_214108 Ga0466696_214108_495_4982 1483
100 3300042602 Ga0466713_152619 Ga0466713_152619_4916_9460 1483
101 3300042615 Ga0466711_013368 Ga0466711_013368_650_5173 1483
102 3300042636 Ga0466703_066889 Ga0466703_066889_24_4520 1483
103 3300042652 Ga0466708_155893 Ga0466708_155893_835_5361 1484
104 3300042655 Ga0466727_121354 Ga0466727_121354_4186_8718 1484
105 3300042590 Ga0466690_148568 Ga0466690_148568_2009_6532 1485
106 3300042596 Ga0466696_293717 Ga0466696_293717_3131_7666 1485
107 3300042612 Ga0466705_265643 Ga0466705_265643_7267_11769 1485
108 3300042618 Ga0466723_322373 Ga0466723_322373_295_4830 1485
109 3300042599 Ga0466706_037013 Ga0466706_037013_12673_17235 1486
110 3300042605 Ga0466716_003945 Ga0466716_003945_912_5447 1486
111 3300042616 Ga0466715_232894 Ga0466715_232894_3879_8414 1488
112 iso_pr_bacteria 2940202316 2940203031 1490
113 3300042599 Ga0466706_122623 Ga0466706_122623_35262_39818 1492
114 3300042619 Ga0466726_123595 Ga0466726_123595_11044_15555 1492
115 iso_pr_bacteria 2940216256 2940216926 1492
116 3300042616 Ga0466715_117809 Ga0466715_117809_251_4807 1493
117 3300042624 Ga0466735_167418 Ga0466735_167418_303_4877 1493
118 3300042616 Ga0466715_231804 Ga0466715_231804_1706_6268 1494
119 iso_pr_bacteria 2785510743 2785735415 1499
120 iso_pr_bacteria 2799112231 2799233337 1499
121 iso_pr_bacteria 2832298047 2832298120 1499
122 iso_pr_bacteria 2832343623 2832343914 1499
123 iso_pr_bacteria 2832372155 2832373425 1499
124 3300042601 Ga0466707_228601 Ga0466707_228601_22542_27122 1500
125 iso_pr_bacteria 2695420317 2695484825 1500
126 iso_pr_bacteria 2873600114 2873603339 1500
127 iso_pr_bacteria 2873610414 2873613732 1500
128 iso_pr_bacteria 8100157865 8100161133 1500
129 3300042652 Ga0466708_019276 Ga0466708_019276_9172_13695 1501
130 3300042655 Ga0466727_104042 Ga0466727_104042_23743_28269 1501
131 3300042601 Ga0466707_010858 Ga0466707_010858_25_4614 1504
132 iso_pr_bacteria 2920168565 2920170723 1505
133 iso_pr_bacteria 2967483437 2967487046 1508
134 iso_pr_bacteria 643348524 643422962 1508
135 3300042612 Ga0466705_329915 Ga0466705_329915_4120_8727 1509
136 3300042643 Ga0466704_023495 Ga0466704_023495_14022_18629 1509
137 iso_pr_bacteria 2820757377 2820758475 1511
138 3300042601 Ga0466707_144970 Ga0466707_144970_47767_52428 1512
139 iso_pr_bacteria 2923982719 2923983515 1521
140 iso_pr_bacteria 2940199050 2940199945 1521
141 iso_pr_bacteria 2940346213 2940346625 1521
142 iso_pr_bacteria 2940371297 2940371446 1521
143 3300042606 Ga0466719_418728 Ga0466719_418728_26069_30721 1524
144 3300042590 Ga0466690_005517 Ga0466690_005517_201_4868 1530
145 2225789004 2227663513 2228265340 1532

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01493 GXGXG GXGXG motif 1306 1441 0.99
PF01645 Glu_synthase Conserved region in glutamate synthase 830 1221 0.97
PF00310 GATase_2 Glutamine amidotransferases class-II 297 457 0.95
PF04898 Glu_syn_central Glutamate synthase central domain 485 769 0.95

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01493 GO:0016491 oxidoreductase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.89 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.